F466902

General Info

Members Datasets Scaffolds Average Seq Length
589 259 568 277

Family's Representative Sequence

Representative Sequence 3300048916|Ga0496113_0404829|Ga0496113_0404829_43_1008
Length 321
Sequence MERLAAKRGTARLLPAELIAVDAIFARGVHGIGTTWQNAGTFAPMTGTSGKVSGSALTGVSETALMTLQVRAHEARRPDSLIDDPMAVQLVDSIDFDFAKFGYTRRQDMALRSLLFDRVTSDYLRDHPKATVVALAEGLQTSFYRLDAADLGHEFRWLSVDLEPMIELRNKLLPKPDRVTQCAQSALDFSWMDHVDTTDGVFITAEGLLMYLQPEEAMSLIRACAQRFPGGQMMFDLPPAFFAFLTRKGTPTSMRYRVPPMPFSLSPAELADLVNTVPGVRTVRDLPMPPGRGAVLNAVVRWQHLPIFDRVRPVVGLLEFG

Samples

Sample ID Description Type Environment
1 2582581312 Streptomyces atratus OK008 Isolate Rhizosphere
2 2616644941 Streptomyces atratus OK807 Isolate Rhizosphere
3 2643221687 Mycobacterium sp. Root135 Isolate Unclassified
4 2643221715 Mycobacterium sp. Root265 Isolate Unclassified
5 2738541264 Mycobacterium sp. OK889 Isolate Unclassified
6 2738541274 Mycobacterium sp. YR708 Isolate Unclassified
7 2738541356 Mycobacterium sp. OK887 Isolate Unclassified
8 2738543028 Mycobacterium sp. YR782 Isolate Unclassified
9 2842134933 Mycolicibacterium obuense SEMIA 442 Isolate Nodule
10 2902792274 Mycolicibacterium sp. P9-64 Isolate Unclassified
11 2902799365 Mycolicibacterium sp. P1-5 Isolate Unclassified
12 2902810491 Mycolicibacterium sp. P9-22 Isolate Unclassified
13 2902837492 Mycolicibacterium sp. P1-18 Isolate Unclassified
14 2929212328 Mycolicibacterium sp. R-73050 Hybrid assembly Isolate Unclassified
15 2939582691 Mycolicibacterium sp. 624 Isolate Rhizosphere
16 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
17 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
18 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
19 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
20 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
21 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
22 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
23 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
24 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
25 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
26 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
27 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
28 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
29 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
30 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
31 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
32 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
33 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
34 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
35 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
36 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
37 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
38 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
39 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
40 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
41 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
42 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
43 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
44 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
45 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
46 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
47 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
48 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
49 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
50 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
51 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
52 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
53 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
54 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
55 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
56 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
57 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
58 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
59 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
60 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
61 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
62 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
63 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
64 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
65 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
66 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
67 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
68 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
69 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
70 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
71 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
72 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
73 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
74 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
75 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
76 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
77 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
78 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
79 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
80 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
81 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
82 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
83 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
84 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
85 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
86 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
87 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
88 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
89 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
90 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
91 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
92 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
93 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
94 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
95 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
96 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
97 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
98 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
99 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
100 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
101 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
102 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
103 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
104 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
105 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
106 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
107 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
108 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
109 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
110 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
111 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
112 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
113 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
114 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
115 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
116 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
117 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
118 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
119 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
173 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
174 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
175 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
176 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
177 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
178 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
179 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
180 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
181 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
182 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
183 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
184 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
185 3300041462 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_8 MetaG Metagenome Rhizoplane
186 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
187 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
188 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
189 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
190 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
191 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
192 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
193 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
194 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
195 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
196 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
197 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
198 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
199 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
200 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
201 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
202 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
203 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
204 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
205 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
206 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
207 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
208 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
209 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
210 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
211 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
212 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
213 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
214 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
215 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
216 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
217 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
218 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
219 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
220 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
221 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
222 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
223 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
224 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
225 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
226 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
227 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
228 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
229 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
230 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
231 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
232 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
233 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
234 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
235 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
236 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
237 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
238 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
239 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
240 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
241 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
242 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
243 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
244 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
245 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
246 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
247 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
248 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
249 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
250 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
251 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
252 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
253 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
254 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
255 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
256 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
257 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
258 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
259 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.6
Metatranscriptomes 0
Isolates 3.4

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 17.83
Nodule 0.34
Rhizoplane 11.21
Rhizosphere 61.8
Stem 0
Stem Tuber 0
Unclassified 8.83

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24750J21931_1003241 3300002070 Bacteria 1953
2 JGI24744J21845_10001122 3300002077 Bacteria 5212
3 Ga0055540_1002167 3300003792 Bacteria 10699
4 Ga0055540_1003666 3300003792 Bacteria 7308
5 Ga0055540_1008124 3300003792 Bacteria 3825
6 Ga0070676_10004806 3300005328 Bacteria 7150
7 Ga0070690_100013662 3300005330 Bacteria 4805
8 Ga0070666_10065870 3300005335 Bacteria 2458
9 Ga0070680_100157478 3300005336 Bacteria 1908
10 Ga0070682_100064761 3300005337 Bacteria 2321
11 Ga0070682_100143643 3300005337 Bacteria 1630
12 Ga0068868_100002879 3300005338 Bacteria 11941
13 Ga0070660_100316654 3300005339 Bacteria 1281
14 Ga0070689_100020457 3300005340 Bacteria 4911
15 Ga0070689_100066818 3300005340 Bacteria 2801
16 Ga0070691_10007143 3300005341 Bacteria 5119
17 Ga0070687_100053915 3300005343 Bacteria 2093
18 Ga0070668_100001043 3300005347 Bacteria 19452
19 Ga0070669_100000269 3300005353 Bacteria 42657
20 Ga0070669_100002080 3300005353 Bacteria 14461
21 Ga0070669_100095893 3300005353 Bacteria 2231
22 Ga0070675_100077259 3300005354 Bacteria 2771
23 Ga0070675_100120157 3300005354 Bacteria 2232
24 Ga0070671_100002403 3300005355 Bacteria 14472
25 Ga0070671_100075548 3300005355 Bacteria 2815
26 Ga0070671_100259649 3300005355 Bacteria 1476
27 Ga0070674_100005257 3300005356 Bacteria 7455
28 Ga0070673_100075881 3300005364 Bacteria 2712
29 Ga0070673_100316736 3300005364 Bacteria 1377
30 Ga0070688_100030794 3300005365 Bacteria 3223
31 Ga0070688_100035153 3300005365 Bacteria 3043
32 Ga0070659_100132969 3300005366 Bacteria 2021
33 Ga0070667_100000109 3300005367 Bacteria 105260
34 Ga0070667_100000138 3300005367 Bacteria 92766
35 Ga0070667_100000525 3300005367 Bacteria 38503
36 Ga0070667_100045298 3300005367 Bacteria 3697
37 Ga0070667_100104437 3300005367 Bacteria 2451
38 Ga0070667_100155688 3300005367 Bacteria 2010
39 Ga0070667_100157754 3300005367 Bacteria 1997
40 Ga0070709_10006934 3300005434 Bacteria 6185
41 Ga0070714_100067394 3300005435 Bacteria 3086
42 Ga0070714_100429174 3300005435 Bacteria 1253
43 Ga0070710_10001278 3300005437 Bacteria 11940
44 Ga0070710_10005383 3300005437 Bacteria 6074
45 Ga0070701_10015295 3300005438 Bacteria 3539
46 Ga0070711_100001283 3300005439 Bacteria 13652
47 Ga0070705_100001679 3300005440 Bacteria 11583
48 Ga0070700_100000736 3300005441 Bacteria 16181
49 Ga0070700_100074254 3300005441 Bacteria 2178
50 Ga0070700_100115851 3300005441 Bacteria 1789
51 Ga0070694_100005267 3300005444 Bacteria 7819
52 Ga0070663_100121246 3300005455 Bacteria 1975
53 Ga0070663_100309650 3300005455 Bacteria 1267
54 Ga0070678_100004492 3300005456 Bacteria 7918
55 Ga0070662_100006487 3300005457 Bacteria 7545
56 Ga0068867_100001022 3300005459 Bacteria 19129
57 Ga0068853_100004870 3300005539 Bacteria 10439
58 Ga0068853_100118208 3300005539 Bacteria 2362
59 Ga0068853_100183636 3300005539 Bacteria 1897
60 Ga0070672_100117418 3300005543 Bacteria 2175
61 Ga0070686_100431287 3300005544 Bacteria 1009
62 Ga0070695_100016240 3300005545 Bacteria 4504
63 Ga0070696_100004733 3300005546 Bacteria 9095
64 Ga0070693_100003031 3300005547 Bacteria 7786
65 Ga0070665_100002736 3300005548 Bacteria 19103
66 Ga0070665_100003767 3300005548 Bacteria 16047
67 Ga0070665_100004708 3300005548 Bacteria 14221
68 Ga0070704_100002013 3300005549 Bacteria 11262
69 Ga0070704_100383669 3300005549 Bacteria 1194
70 Ga0068855_100064287 3300005563 Bacteria 4279
71 Ga0068855_100262107 3300005563 Bacteria 1925
72 Ga0070664_100166365 3300005564 Bacteria 1954
73 Ga0070664_100563394 3300005564 Bacteria 1054
74 Ga0068854_100007902 3300005578 Bacteria 6807
75 Ga0068854_100193147 3300005578 Bacteria 1596
76 Ga0068856_100052764 3300005614 Bacteria 4011
77 Ga0070702_100003743 3300005615 Bacteria 6861
78 Ga0070702_100239742 3300005615 Bacteria 1223
79 Ga0068859_100001404 3300005617 Bacteria 24453
80 Ga0068859_100001848 3300005617 Bacteria 21522
81 Ga0068859_100022895 3300005617 Bacteria 6264
82 Ga0068859_100124501 3300005617 Bacteria 2646
83 Ga0068859_100242094 3300005617 Bacteria 1893
84 Ga0068864_100062955 3300005618 Bacteria 3214
85 Ga0068864_100195183 3300005618 Bacteria 1857
86 Ga0068864_100277886 3300005618 Bacteria 1562
87 Ga0068864_100403139 3300005618 Bacteria 1300
88 Ga0068866_10000157 3300005718 Bacteria 31326
89 Ga0068861_100003872 3300005719 Bacteria 10003
90 Ga0068861_100537724 3300005719 Bacteria 1063
91 Ga0068870_10118475 3300005840 Bacteria 1522
92 Ga0068870_10191671 3300005840 Bacteria 1234
93 Ga0068863_100000123 3300005841 Bacteria 80999
94 Ga0068863_100003252 3300005841 Bacteria 16066
95 Ga0068863_100229538 3300005841 Bacteria 1790
96 Ga0068858_100002311 3300005842 Bacteria 19272
97 Ga0068858_100029058 3300005842 Bacteria 5134
98 Ga0068858_100036557 3300005842 Bacteria 4553
99 Ga0068858_100076497 3300005842 Bacteria 3108
100 Ga0068860_100000079 3300005843 Bacteria 170752
101 Ga0068860_100000175 3300005843 Bacteria 105260
102 Ga0068860_100009924 3300005843 Bacteria 9437
103 Ga0068860_100190015 3300005843 Bacteria 1987
104 Ga0068862_100000091 3300005844 Bacteria 107015
105 Ga0068862_100000643 3300005844 Bacteria 36101
106 Ga0068862_100021844 3300005844 Bacteria 5351
107 Ga0068862_100341309 3300005844 Bacteria 1387
108 Ga0081455_10013138 3300005937 Bacteria 8207
109 Ga0081455_10149488 3300005937 Bacteria 1802
110 Ga0075365_10002159 3300006038 Bacteria 9458
111 Ga0075365_10014579 3300006038 Bacteria 4733
112 Ga0075365_10037424 3300006038 Bacteria 3150
113 Ga0075365_10074874 3300006038 Bacteria 2284
114 Ga0075365_10161507 3300006038 Bacteria 1561
115 Ga0075365_10306353 3300006038 Bacteria 1118
116 Ga0075368_10011590 3300006042 Bacteria 3209
117 Ga0075368_10036042 3300006042 Bacteria 1932
118 Ga0075363_100000180 3300006048 Bacteria 16621
119 Ga0075363_100002100 3300006048 Bacteria 7989
120 Ga0075363_100004544 3300006048 Bacteria 6084
121 Ga0075363_100004912 3300006048 Bacteria 5911
122 Ga0075363_100009115 3300006048 Bacteria 4658
123 Ga0075363_100019935 3300006048 Bacteria 3358
124 Ga0075363_100022310 3300006048 Bacteria 3199
125 Ga0075363_100053003 3300006048 Bacteria 2166
126 Ga0075363_100060864 3300006048 Bacteria 2034
127 Ga0075363_100074824 3300006048 Bacteria 1844
128 Ga0075363_100238144 3300006048 Bacteria 1046
129 Ga0075363_100249777 3300006048 Bacteria 1021
130 Ga0075364_10009126 3300006051 Bacteria 5941
131 Ga0075364_10010353 3300006051 Bacteria 5630
132 Ga0075364_10013248 3300006051 Bacteria 5062
133 Ga0075364_10022152 3300006051 Bacteria 4009
134 Ga0075364_10041018 3300006051 Bacteria 3004
135 Ga0075364_10074756 3300006051 Bacteria 2235
136 Ga0075364_10075962 3300006051 Bacteria 2217
137 Ga0075364_10084254 3300006051 Bacteria 2105
138 Ga0075364_10085750 3300006051 Bacteria 2086
139 Ga0075364_10088699 3300006051 Bacteria 2051
140 Ga0075364_10136011 3300006051 Bacteria 1651
141 Ga0075364_10154587 3300006051 Bacteria 1547
142 Ga0070715_10009555 3300006163 Bacteria 3424
143 Ga0070716_100002696 3300006173 Bacteria 8223
144 Ga0070716_100027764 3300006173 Bacteria 3043
145 Ga0070716_100045339 3300006173 Bacteria 2468
146 Ga0070712_100000595 3300006175 Bacteria 21132
147 Ga0070712_100013054 3300006175 Bacteria 5297
148 Ga0070712_100469070 3300006175 Bacteria 1051
149 Ga0075362_10077735 3300006177 Bacteria 1525
150 Ga0075367_10163879 3300006178 Bacteria 1383
151 Ga0075369_10002229 3300006186 Bacteria 6873
152 Ga0075369_10004191 3300006186 Bacteria 5314
153 Ga0075369_10004539 3300006186 Bacteria 5139
154 Ga0075369_10031457 3300006186 Bacteria 2241
155 Ga0075369_10037312 3300006186 Bacteria 2070
156 Ga0075369_10044918 3300006186 Bacteria 1899
157 Ga0075369_10045473 3300006186 Bacteria 1888
158 Ga0075369_10079839 3300006186 Bacteria 1450
159 Ga0075370_10003571 3300006353 Bacteria 7434
160 Ga0075370_10025895 3300006353 Bacteria 3247
161 Ga0075370_10044257 3300006353 Bacteria 2517
162 Ga0075370_10065702 3300006353 Bacteria 2069
163 Ga0075370_10094918 3300006353 Bacteria 1722
164 Ga0075370_10098692 3300006353 Bacteria 1689
165 Ga0075370_10152656 3300006353 Bacteria 1354
166 Ga0075370_10179175 3300006353 Bacteria 1247
167 Ga0075370_10285989 3300006353 Bacteria 980
168 Ga0068871_100222214 3300006358 Bacteria 1637
169 Ga0068871_100307978 3300006358 Bacteria 1392
170 Ga0075428_100000335 3300006844 Bacteria 46700
171 Ga0075430_100122282 3300006846 Bacteria 2170
172 Ga0075430_100196054 3300006846 Bacteria 1678
173 Ga0075431_100022056 3300006847 Bacteria 6512
174 Ga0075431_100145134 3300006847 Bacteria 2446
175 Ga0075429_100001677 3300006880 Bacteria 18316
176 Ga0068865_100002343 3300006881 Bacteria 11169
177 Ga0097620_100001404 3300006931 Bacteria 24453
178 Ga0097620_100001848 3300006931 Bacteria 21522
179 Ga0097620_100022894 3300006931 Bacteria 6264
180 Ga0097620_100124504 3300006931 Bacteria 2646
181 Ga0097620_100242100 3300006931 Bacteria 1893
182 Ga0105244_10073950 3300009036 Bacteria 1696
183 Ga0105250_10049552 3300009092 Bacteria 1685
184 Ga0105245_10017190 3300009098 Bacteria 6310
185 Ga0105245_10350296 3300009098 Bacteria 1463
186 Ga0105247_10000044 3300009101 Bacteria 153728
187 Ga0105247_10004162 3300009101 Bacteria 9280
188 Ga0105247_10150417 3300009101 Bacteria 1533
189 Ga0114129_10013994 3300009147 Bacteria 11430
190 Ga0105243_10006009 3300009148 Bacteria 9398
191 Ga0105243_10320876 3300009148 Bacteria 1411
192 Ga0105243_10401698 3300009148 Bacteria 1273
193 Ga0105241_10008438 3300009174 Bacteria 7577
194 Ga0105242_10000185 3300009176 Bacteria 47677
195 Ga0105248_10000060 3300009177 Bacteria 131634
196 Ga0105248_10000458 3300009177 Bacteria 46439
197 Ga0105248_10034071 3300009177 Bacteria 5692
198 Ga0105237_10004358 3300009545 Bacteria 16404
199 Ga0105237_10039453 3300009545 Bacteria 4767
200 Ga0105237_10048303 3300009545 Bacteria 4278
201 Ga0105238_10241972 3300009551 Bacteria 1782
202 Ga0105238_10701058 3300009551 Bacteria 1024
203 Ga0105249_10000020 3300009553 Bacteria 260634
204 Ga0105249_10000049 3300009553 Bacteria 169899
205 Ga0105249_10006548 3300009553 Bacteria 10133
206 Ga0105249_10007930 3300009553 Bacteria 9256
207 Ga0105239_10004760 3300010375 Bacteria 16109
208 Ga0105239_10009569 3300010375 Bacteria 10904
209 Ga0105246_10010539 3300011119 Bacteria 5725
210 Ga0105246_10284641 3300011119 Bacteria 1328
211 Ga0157369_10385927 3300013105 Bacteria 1453
212 Ga0157374_10092796 3300013296 Bacteria 2881
213 Ga0157374_10104105 3300013296 Bacteria 2724
214 Ga0157378_10009545 3300013297 Bacteria 8450
215 Ga0163162_10086868 3300013306 Bacteria 3205
216 Ga0157372_10028792 3300013307 Bacteria 6062
217 Ga0157375_10003738 3300013308 Bacteria 13203
218 Ga0163163_10027965 3300014325 Bacteria 5409
219 Ga0163163_10070200 3300014325 Bacteria 3488
220 Ga0157380_10000359 3300014326 Bacteria 27341
221 Ga0157379_10005718 3300014968 Bacteria 10696
222 Ga0157379_10320439 3300014968 Bacteria 1415
223 Ga0157376_10827128 3300014969 Bacteria 940
224 Ga0163161_10002219 3300017792 Bacteria 13979
225 Ga0163161_10124214 3300017792 Bacteria 1942
226 Ga0213875_10017316 3300021388 Bacteria 3482
227 Ga0209673_1009120 3300025273 Bacteria 4332
228 Ga0209051_1000516 3300025303 Bacteria 48783
229 Ga0209051_1000521 3300025303 Bacteria 48210
230 Ga0209051_1038193 3300025303 Bacteria 1750
231 Ga0207653_10023418 3300025885 Bacteria 1967
232 Ga0207692_10005094 3300025898 Bacteria 5237
233 Ga0207692_10006799 3300025898 Bacteria 4652
234 Ga0207642_10000150 3300025899 Bacteria 19641
235 Ga0207710_10000010 3300025900 Bacteria 482087
236 Ga0207710_10000066 3300025900 Bacteria 153734
237 Ga0207688_10000337 3300025901 Bacteria 21745
238 Ga0207688_10002282 3300025901 Bacteria 10311
239 Ga0207680_10014175 3300025903 Bacteria 4117
240 Ga0207680_10052289 3300025903 Bacteria 2447
241 Ga0207685_10002624 3300025905 Bacteria 4170
242 Ga0207699_10025720 3300025906 Bacteria 3235
243 Ga0207645_10016956 3300025907 Bacteria 4812
244 Ga0207654_10015397 3300025911 Bacteria 3969
245 Ga0207654_10249177 3300025911 Bacteria 1190
246 Ga0207671_10070783 3300025914 Bacteria 2601
247 Ga0207671_10283143 3300025914 Bacteria 1308
248 Ga0207693_10000261 3300025915 Bacteria 48548
249 Ga0207693_10001726 3300025915 Bacteria 19214
250 Ga0207693_10367586 3300025915 Bacteria 1125
251 Ga0207663_10003786 3300025916 Bacteria 7464
252 Ga0207663_10193784 3300025916 Bacteria 1461
253 Ga0207660_10315933 3300025917 Bacteria 1246
254 Ga0207662_10186819 3300025918 Bacteria 1336
255 Ga0207657_10360912 3300025919 Bacteria 1145
256 Ga0207681_10000979 3300025923 Bacteria 18652
257 Ga0207681_10004401 3300025923 Bacteria 8678
258 Ga0207681_10030198 3300025923 Bacteria 3531
259 Ga0207681_10252358 3300025923 Bacteria 1378
260 Ga0207650_10420873 3300025925 Bacteria 1108
261 Ga0207687_10002135 3300025927 Bacteria 13476
262 Ga0207664_10169446 3300025929 Bacteria 1868
263 Ga0207644_10007489 3300025931 Bacteria 7121
264 Ga0207644_10038081 3300025931 Bacteria 3385
265 Ga0207644_10109706 3300025931 Bacteria 2085
266 Ga0207706_10015497 3300025933 Bacteria 6887
267 Ga0207706_10018810 3300025933 Bacteria 6212
268 Ga0207686_10014209 3300025934 Bacteria 4428
269 Ga0207709_10006052 3300025935 Bacteria 6818
270 Ga0207709_10026514 3300025935 Bacteria 3330
271 Ga0207670_10013554 3300025936 Bacteria 4811
272 Ga0207669_10000439 3300025937 Bacteria 18087
273 Ga0207669_10202423 3300025937 Bacteria 1442
274 Ga0207704_10001841 3300025938 Bacteria 9501
275 Ga0207704_10256857 3300025938 Bacteria 1315
276 Ga0207665_10004521 3300025939 Bacteria 9226
277 Ga0207665_10004603 3300025939 Bacteria 9161
278 Ga0207665_10066465 3300025939 Bacteria 2454
279 Ga0207691_10215790 3300025940 Bacteria 1665
280 Ga0207711_10000058 3300025941 Bacteria 133317
281 Ga0207711_10000422 3300025941 Bacteria 44472
282 Ga0207711_10251926 3300025941 Bacteria 1622
283 Ga0207689_10035332 3300025942 Bacteria 4153
284 Ga0207689_10054075 3300025942 Bacteria 3307
285 Ga0207661_10250725 3300025944 Bacteria 1573
286 Ga0207679_10174922 3300025945 Bacteria 1771
287 Ga0207667_10592345 3300025949 Bacteria 1119
288 Ga0207712_10000010 3300025961 Bacteria 455972
289 Ga0207712_10000038 3300025961 Bacteria 192762
290 Ga0207712_10008700 3300025961 Bacteria 6420
291 Ga0207668_10000336 3300025972 Bacteria 30375
292 Ga0207668_10107570 3300025972 Bacteria 2085
293 Ga0207640_10207248 3300025981 Bacteria 1490
294 Ga0207658_10000061 3300025986 Bacteria 119045
295 Ga0207658_10000257 3300025986 Bacteria 55345
296 Ga0207658_10004329 3300025986 Bacteria 9881
297 Ga0207658_10027612 3300025986 Bacteria 3990
298 Ga0207658_10134739 3300025986 Bacteria 1989
299 Ga0207658_10225123 3300025986 Bacteria 1580
300 Ga0207658_10309665 3300025986 Bacteria 1363
301 Ga0207677_10002097 3300026023 Bacteria 10485
302 Ga0207677_10102274 3300026023 Bacteria 2112
303 Ga0207703_10009962 3300026035 Bacteria 7455
304 Ga0207703_10031724 3300026035 Bacteria 4179
305 Ga0207703_10080722 3300026035 Bacteria 2709
306 Ga0207703_10317248 3300026035 Bacteria 1426
307 Ga0207703_10510295 3300026035 Bacteria 1130
308 Ga0207639_10211395 3300026041 Bacteria 1670
309 Ga0207639_10344722 3300026041 Bacteria 1329
310 Ga0207678_10016208 3300026067 Bacteria 6539
311 Ga0207678_10147295 3300026067 Bacteria 2009
312 Ga0207678_10329712 3300026067 Bacteria 1314
313 Ga0207708_10000491 3300026075 Bacteria 30328
314 Ga0207708_10012802 3300026075 Bacteria 6256
315 Ga0207708_10134228 3300026075 Bacteria 1937
316 Ga0207702_10058110 3300026078 Bacteria 3291
317 Ga0207641_10005931 3300026088 Bacteria 10355
318 Ga0207648_10002698 3300026089 Bacteria 18881
319 Ga0207648_10021203 3300026089 Bacteria 5841
320 Ga0207676_10135807 3300026095 Bacteria 2098
321 Ga0207676_10171047 3300026095 Bacteria 1893
322 Ga0207676_10199966 3300026095 Bacteria 1765
323 Ga0207674_10599394 3300026116 Bacteria 1064
324 Ga0207675_100011056 3300026118 Bacteria 8455
325 Ga0207675_100044025 3300026118 Bacteria 4168
326 Ga0207683_10000103 3300026121 Bacteria 70068
327 Ga0207683_10004092 3300026121 Bacteria 12592
328 Ga0268266_10003096 3300028379 Bacteria 16954
329 Ga0268266_10004053 3300028379 Bacteria 14163
330 Ga0268266_10074691 3300028379 Bacteria 2944
331 Ga0268265_10000053 3300028380 Bacteria 170215
332 Ga0268265_10000105 3300028380 Bacteria 105463
333 Ga0268265_10020974 3300028380 Bacteria 4568
334 Ga0268264_10000017 3300028381 Bacteria 498037
335 Ga0268264_10000237 3300028381 Bacteria 105274
336 Ga0268264_10014920 3300028381 Bacteria 6380
337 Ga0265327_10000336 3300031251 Bacteria 89407
338 Ga0307413_10066750 3300031824 Bacteria 2246
339 Ga0307410_10036313 3300031852 Bacteria 3208
340 Ga0307410_10410648 3300031852 Bacteria 1096
341 Ga0307406_10039227 3300031901 Bacteria 2937
342 Ga0307406_10300841 3300031901 Bacteria 1232
343 Ga0307409_100012589 3300031995 Bacteria 5398
344 Ga0307409_100124800 3300031995 Bacteria 2188
345 Ga0307409_100328486 3300031995 Bacteria 1434
346 Ga0307416_100029810 3300032002 Bacteria 4083
347 Ga0373931_0067983 3300035691 Bacteria 1938
348 Ga0316584_0082910 3300036712 Bacteria 2401
349 Ga0436364_0708750 3300037853 Bacteria 22585
350 Ga0439461_0000438 3300041410 Bacteria 5995
351 Ga0439466_0007535 3300041411 Bacteria 4116
352 Ga0439466_0007901 3300041411 Bacteria 4012
353 Ga0439466_0045598 3300041411 Bacteria 1449
354 Ga0439465_0006711 3300041413 Bacteria 3654
355 Ga0439465_0037259 3300041413 Bacteria 1563
356 Ga0439465_0076496 3300041413 Bacteria 1128
357 Ga0451793_0338240 3300041452 Bacteria 1571
358 Ga0451806_157444 3300041462 Bacteria 1100
359 Ga0451843_1626385 3300041509 Bacteria 1127
360 Ga0439431_0009129 3300041997 Bacteria 2235
361 Ga0439442_019949 3300042002 Bacteria 1389
362 Ga0439445_0004502 3300042004 Bacteria 3158
363 Ga0439445_0011095 3300042004 Bacteria 2142
364 Ga0439445_0013493 3300042004 Bacteria 1978
365 Ga0439445_0019470 3300042004 Bacteria 1692
366 Ga0439434_0010970 3300042435 Bacteria 2676
367 Ga0439434_0025081 3300042435 Bacteria 1799
368 Ga0439435_0010605 3300042436 Bacteria 2192
369 Ga0466972_0005273 3300044658 Bacteria 6470
370 Ga0466972_0014245 3300044658 Bacteria 3985
371 Ga0466972_0046927 3300044658 Bacteria 2090
372 Ga0466972_0074776 3300044658 Bacteria 1614
373 Ga0466965_0000450 3300044683 Bacteria 14434
374 Ga0466965_0002264 3300044683 Bacteria 8109
375 Ga0466965_0002608 3300044683 Bacteria 7715
376 Ga0466965_0042303 3300044683 Bacteria 2247
377 Ga0466965_0160361 3300044683 Bacteria 1179
378 Ga0466965_0252424 3300044683 Bacteria 946
379 Ga0466966_0014090 3300044684 Bacteria 5293
380 Ga0466963_0101404 3300044694 Bacteria 1971
381 Ga0466968_0027674 3300044735 Bacteria 2334
382 Ga0466968_0084585 3300044735 Bacteria 1398
383 Ga0466970_0047685 3300044765 Bacteria 2283
384 Ga0466957_0027534 3300044842 Bacteria 3378
385 Ga0466957_0053201 3300044842 Bacteria 2468
386 Ga0466960_0001352 3300044901 Bacteria 8909
387 Ga0466960_0002405 3300044901 Bacteria 7053
388 Ga0466960_0028674 3300044901 Bacteria 2549
389 Ga0466959_0017570 3300045049 Bacteria 5244
390 Ga0466959_0152281 3300045049 Unclassified 1629
391 Ga0466958_0026984 3300045836 Bacteria 3396
392 Ga0466958_0051154 3300045836 Bacteria 2501
393 Ga0466967_0010869 3300045976 Bacteria 6858
394 Ga0466967_0074050 3300045976 Bacteria 3057
395 Ga0466967_0181796 3300045976 Bacteria 1984
396 Ga0466967_0209655 3300045976 Bacteria 1848
397 Ga0495603_0001075 3300046455 Bacteria 15819
398 Ga0495603_0014685 3300046455 Bacteria 4734
399 Ga0495603_0018759 3300046455 Bacteria 4187
400 Ga0495629_0004479 3300046459 Bacteria 10464
401 Ga0495629_0017753 3300046459 Bacteria 5100
402 Ga0495638_0006390 3300046460 Bacteria 8581
403 Ga0495641_0055186 3300046461 Bacteria 1804
404 Ga0495639_0073673 3300046475 Bacteria 1581
405 Ga0495594_0000363 3300046499 Bacteria 22776
406 Ga0495665_0014503 3300046531 Bacteria 4252
407 Ga0495640_0041814 3300046533 Bacteria 3201
408 Ga0495588_0004139 3300046674 Bacteria 6387
409 Ga0495613_0000795 3300046689 Bacteria 24569
410 Ga0495581_0042384 3300047315 Bacteria 2634
411 Ga0495676_0004478 3300047321 Bacteria 12771
412 Ga0495676_0024041 3300047321 Bacteria 5279
413 Ga0495676_0090968 3300047321 Bacteria 2282
414 Ga0495593_0020379 3300047673 Bacteria 3714
415 Ga0495593_0059173 3300047673 Bacteria 2008
416 Ga0495614_0002599 3300048089 Bacteria 8028
417 Ga0496100_0000073 3300048903 Bacteria 55397
418 Ga0496100_0001679 3300048903 Bacteria 10991
419 Ga0496100_0005721 3300048903 Bacteria 6724
420 Ga0496100_0053088 3300048903 Bacteria 2638
421 Ga0496100_0109014 3300048903 Bacteria 1921
422 Ga0496101_0000126 3300048904 Bacteria 74316
423 Ga0496101_0001089 3300048904 Bacteria 16114
424 Ga0496101_0119037 3300048904 Bacteria 1995
425 Ga0496101_0217541 3300048904 Bacteria 1482
426 Ga0496102_0000006 3300048905 Bacteria 471494
427 Ga0496102_0000227 3300048905 Bacteria 74131
428 Ga0496102_0000526 3300048905 Bacteria 41473
429 Ga0496102_0009713 3300048905 Bacteria 8272
430 Ga0496102_0017105 3300048905 Bacteria 6348
431 Ga0496102_0030969 3300048905 Bacteria 4792
432 Ga0496102_0049038 3300048905 Bacteria 3841
433 Ga0496102_0267980 3300048905 Bacteria 1610
434 Ga0496102_0676326 3300048905 Bacteria 955
435 Ga0496103_0000006 3300048906 Bacteria 470539
436 Ga0496103_0000356 3300048906 Bacteria 41484
437 Ga0496103_0000692 3300048906 Bacteria 25101
438 Ga0496103_0005234 3300048906 Bacteria 7791
439 Ga0496103_0056578 3300048906 Bacteria 2435
440 Ga0496103_0165806 3300048906 Bacteria 1417
441 Ga0496104_0158457 3300048907 Bacteria 2172
442 Ga0496104_0385045 3300048907 Bacteria 1315
443 Ga0496106_0000180 3300048909 Bacteria 45250
444 Ga0496106_0010186 3300048909 Bacteria 6945
445 Ga0496106_0014412 3300048909 Bacteria 5841
446 Ga0496107_0001744 3300048910 Bacteria 13682
447 Ga0496107_0016336 3300048910 Bacteria 5210
448 Ga0496107_0026774 3300048910 Bacteria 4090
449 Ga0496107_0128743 3300048910 Bacteria 1868
450 Ga0496108_0015379 3300048911 Bacteria 6241
451 Ga0496108_0036172 3300048911 Bacteria 4107
452 Ga0496108_0045355 3300048911 Bacteria 3672
453 Ga0496108_0056128 3300048911 Bacteria 3308
454 Ga0496108_0065405 3300048911 Bacteria 3065
455 Ga0496108_0621557 3300048911 Bacteria 940
456 Ga0496109_0000128 3300048912 Bacteria 77887
457 Ga0496109_0013709 3300048912 Bacteria 7041
458 Ga0496109_0068502 3300048912 Bacteria 3253
459 Ga0496109_0167124 3300048912 Bacteria 2063
460 Ga0496110_0000633 3300048913 Bacteria 24060
461 Ga0496110_0007433 3300048913 Bacteria 8752
462 Ga0496110_0041875 3300048913 Bacteria 3998
463 Ga0496110_0129410 3300048913 Bacteria 2279
464 Ga0496111_0072992 3300048914 Bacteria 2498
465 Ga0496112_0003825 3300048915 Bacteria 12574
466 Ga0496112_0019023 3300048915 Bacteria 6474
467 Ga0496112_0053648 3300048915 Bacteria 3960
468 Ga0496112_0055611 3300048915 Bacteria 3892
469 Ga0496112_0372326 3300048915 Bacteria 1370
470 Ga0496113_0006604 3300048916 Bacteria 7375
471 Ga0496113_0250448 3300048916 Bacteria 1414
472 Ga0496113_0404829 3300048916 Bacteria 1096
473 Ga0496113_0563237 3300048916 Bacteria 914
474 Ga0496114_0021673 3300048917 Bacteria 5228
475 Ga0496114_0064683 3300048917 Bacteria 3063
476 Ga0496114_0135955 3300048917 Bacteria 2126
477 Ga0496114_0212605 3300048917 Bacteria 1697
478 Ga0496114_0289611 3300048917 Bacteria 1445
479 Ga0496115_0003703 3300048918 Bacteria 10998
480 Ga0496115_0005658 3300048918 Bacteria 9090
481 Ga0496116_0000025 3300048919 Bacteria 470539
482 Ga0496116_0005486 3300048919 Bacteria 11744
483 Ga0496116_0016684 3300048919 Bacteria 5736
484 Ga0496116_0026890 3300048919 Bacteria 4197
485 Ga0496117_0000006 3300048920 Bacteria 758420
486 Ga0496117_0000614 3300048920 Bacteria 57852
487 Ga0496117_0001032 3300048920 Bacteria 42493
488 Ga0496117_0026079 3300048920 Bacteria 4579
489 Ga0496118_0000004 3300048921 Bacteria 758420
490 Ga0496118_0000249 3300048921 Bacteria 95339
491 Ga0496118_0000558 3300048921 Bacteria 61328
492 Ga0496118_0002324 3300048921 Bacteria 25808
493 Ga0496119_0000041 3300048922 Bacteria 203687
494 Ga0496119_0005591 3300048922 Bacteria 11952
495 Ga0496119_0019232 3300048922 Bacteria 5043
496 Ga0496119_0052946 3300048922 Bacteria 2482
497 Ga0496120_0000027 3300048923 Bacteria 231507
498 Ga0496120_0011121 3300048923 Bacteria 6211
499 Ga0496121_0000004 3300048924 Bacteria 1139011
500 Ga0496121_0000171 3300048924 Bacteria 144073
501 Ga0496121_0002984 3300048924 Bacteria 24591
502 Ga0496121_0010416 3300048924 Bacteria 10490
503 Ga0496122_0000474 3300048925 Bacteria 83393
504 Ga0496122_0019056 3300048925 Bacteria 6293
505 Ga0496123_0009090 3300048926 Bacteria 8997
506 Ga0496124_0000117 3300048927 Bacteria 164439
507 Ga0496125_0000003 3300048928 Bacteria 1189767
508 Ga0496125_0169088 3300048928 Bacteria 1472
509 Ga0496126_0000001 3300048929 Bacteria 1139011
510 Ga0496126_0001352 3300048929 Bacteria 38905
511 Ga0496126_0004251 3300048929 Bacteria 17242
512 Ga0496126_0006132 3300048929 Bacteria 13470
513 Ga0496126_0019190 3300048929 Bacteria 6739
514 Ga0496126_0020980 3300048929 Bacteria 6393
515 Ga0496126_0069862 3300048929 Bacteria 3130
516 nmdc:mga03n38_10938_c1 3300050490 Bacteria 3363
517 nmdc:mga03n38_13607_c1 3300050490 Bacteria 3095
518 nmdc:mga03n38_1586_c1 3300050490 Bacteria 6622
519 nmdc:mga03n38_179210_c1 3300050490 Bacteria 1084
520 nmdc:mga03n38_2128_c1 3300050490 Bacteria 6017
521 nmdc:mga03n38_2385_c1 3300050490 Bacteria 5794
522 nmdc:mga03n38_4903_c1 3300050490 Bacteria 4489
523 nmdc:mga03n38_5678_c1 3300050490 Bacteria 4272
524 nmdc:mga03n38_70392_c1 3300050490 Bacteria 1111
525 nmdc:mga03n38_963_c1 3300050490 Bacteria 7816
526 nmdc:mga00v17_107642_c1 3300050491 Bacteria 1766
527 nmdc:mga00v17_1531_c1 3300050491 Bacteria 12066
528 nmdc:mga00v17_312669_c1 3300050491 Bacteria 1021
529 nmdc:mga00v17_34871_c1 3300050491 Bacteria 2992
530 nmdc:mga00v17_39138_c1 3300050491 Bacteria 2838
531 nmdc:mga00v17_410606_c1 3300050491 Bacteria 880
532 nmdc:mga00v17_44665_c1 3300050491 Bacteria 2673
533 nmdc:mga00v17_59819_c1 3300050491 Bacteria 2339
534 nmdc:mga00v17_8370_c1 3300050491 Bacteria 5565
535 nmdc:mga00v17_95341_c1 3300050491 Bacteria 1873
536 nmdc:mga0yw44_12173_c1 3300050492 Bacteria 4473
537 nmdc:mga0yw44_212220_c1 3300050492 Bacteria 1281
538 nmdc:mga0yw44_223233_c1 3300050492 Bacteria 1249
539 nmdc:mga0yw44_405477_c1 3300050492 Bacteria 922
540 nmdc:mga0yw44_415_c1 3300050492 Bacteria 9342
541 nmdc:mga0k408_71919_c1 3300050493 Bacteria 2019
542 nmdc:mga06z11_14789_c1 3300050494 Bacteria 3466
543 nmdc:mga04h51_2337_c1 3300050495 Bacteria 4488
544 nmdc:mga07m45_175617_c1 3300050496 Bacteria 1245
545 nmdc:mga07m45_18732_c1 3300050496 Bacteria 3744
546 nmdc:mga07m45_3090_c1 3300050496 Bacteria 7961
547 nmdc:mga07m45_37062_c1 3300050496 Bacteria 2719
548 nmdc:mga07m45_47530_c1 3300050496 Bacteria 2413
549 nmdc:mga07m45_96009_c1 3300050496 Bacteria 1701
550 nmdc:mga07m45_9847_c1 3300050496 Bacteria 4972
551 nmdc:mga05p37_92081_c1 3300050507 Bacteria 3736
552 nmdc:mga0qj67_121373_c1 3300050509 Bacteria 2114
553 nmdc:mga0qj67_310977_c1 3300050509 Bacteria 1276
554 nmdc:mga06r32_19375_c1 3300050510 Bacteria 6242
555 nmdc:mga06r32_77124_c1 3300050510 Bacteria 3237
556 nmdc:mga0sz30_101432_c1 3300050516 Bacteria 1257
557 nmdc:mga0sz30_102101_c1 3300050516 Bacteria 1253
558 nmdc:mga0sz30_1819_c1 3300050516 Bacteria 7585
559 nmdc:mga0sz30_61862_c1 3300050516 Bacteria 1600
560 nmdc:mga0sz30_76424_c1 3300050516 Bacteria 1446
561 nmdc:mga0sz30_8274_c2 3300050516 Bacteria 2607
562 Ga0500635_0001120 3300053080 Bacteria 6410
563 Ga0500556_0004614 3300053104 Bacteria 3916
564 Ga0500652_000152 3300053131 Bacteria 26371
565 Ga0500616_0020256 3300053153 Bacteria 3738
566 Ga0500616_0051534 3300053153 Bacteria 2168
567 Ga0500645_000014 3300053730 Bacteria 151349
568 Ga0466962_0024704 3300061719 Bacteria 2885

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300006844 Ga0075428_100000335 Ga0075428_10000033521 229
2 3300006846 Ga0075430_100196054 Ga0075430_1001960542 229
3 3300006847 Ga0075431_100145134 Ga0075431_1001451343 229
4 3300005353 Ga0070669_100002080 Ga0070669_1000020807 236
5 3300005367 Ga0070667_100000138 Ga0070667_1000001388 236
6 3300005548 Ga0070665_100002736 Ga0070665_1000027367 236
7 3300005617 Ga0068859_100022895 Ga0068859_1000228955 236
8 3300005843 Ga0068860_100000079 Ga0068860_1000000798 236
9 3300005844 Ga0068862_100000643 Ga0068862_1000006438 236
10 3300006931 Ga0097620_100022894 Ga0097620_1000228945 236
11 3300025900 Ga0207710_10000066 Ga0207710_100000668 236
12 3300025923 Ga0207681_10004401 Ga0207681_100044013 236
13 3300025941 Ga0207711_10000058 Ga0207711_10000058114 236
14 3300025986 Ga0207658_10000061 Ga0207658_100000618 236
15 3300028379 Ga0268266_10003096 Ga0268266_100030966 236
16 3300028381 Ga0268264_10000017 Ga0268264_100000178 236
17 3300050492 nmdc:mga0yw44_405477_c1 nmdc:mga0yw44_405477_c1_26_736 236
18 3300003792 Ga0055540_1003666 Ga0055540_10036669 257
19 3300025303 Ga0209051_1000521 Ga0209051_100052142 257
20 3300005617 Ga0068859_100124501 Ga0068859_1001245014 258
21 3300006931 Ga0097620_100124504 Ga0097620_1001245044 258
22 3300026116 Ga0207674_10599394 Ga0207674_105993942 258
23 3300046455 Ga0495603_0014685 Ga0495603_0014685_682_1491 262
24 3300046499 Ga0495594_0000363 Ga0495594_0000363_6574_7383 262
25 3300046674 Ga0495588_0004139 Ga0495588_0004139_3620_4429 262
26 3300047321 Ga0495676_0024041 Ga0495676_0024041_1932_2741 262
27 3300005564 Ga0070664_100563394 Ga0070664_1005633942 264
28 3300006846 Ga0075430_100122282 Ga0075430_1001222822 264
29 3300006847 Ga0075431_100022056 Ga0075431_1000220566 264
30 3300006880 Ga0075429_100001677 Ga0075429_10000167714 264
31 3300009147 Ga0114129_10013994 Ga0114129_100139942 264
32 3300050507 nmdc:mga05p37_92081_c1 nmdc:mga05p37_92081_c1_2433_3242 264
33 3300050509 nmdc:mga0qj67_121373_c1 nmdc:mga0qj67_121373_c1_547_1356 264
34 3300050509 nmdc:mga0qj67_310977_c1 nmdc:mga0qj67_310977_c1_222_1031 264
35 3300050510 nmdc:mga06r32_77124_c1 nmdc:mga06r32_77124_c1_331_1140 264
36 iso_pu_bacteria 2582581312 2585299815 264
37 iso_pu_bacteria 2616644941 2616899488 264
38 3300053080 Ga0500635_0001120 Ga0500635_0001120_4194_4994 265
39 3300005615 Ga0070702_100239742 Ga0070702_1002397422 266
40 3300005563 Ga0068855_100262107 Ga0068855_1002621072 267
41 3300006038 Ga0075365_10014579 Ga0075365_100145792 267
42 3300006048 Ga0075363_100004544 Ga0075363_1000045443 267
43 3300006048 Ga0075363_100022310 Ga0075363_1000223104 267
44 3300006051 Ga0075364_10084254 Ga0075364_100842542 267
45 3300009545 Ga0105237_10004358 Ga0105237_100043589 267
46 3300010375 Ga0105239_10004760 Ga0105239_1000476011 267
47 3300044683 Ga0466965_0042303 Ga0466965_0042303_606_1460 267
48 3300044684 Ga0466966_0014090 Ga0466966_0014090_1665_2519 267
49 3300044735 Ga0466968_0027674 Ga0466968_0027674_672_1526 267
50 3300045049 Ga0466959_0152281 Ga0466959_0152281_495_1349 267
51 3300045836 Ga0466958_0026984 Ga0466958_0026984_1392_2246 267
52 3300048911 Ga0496108_0045355 Ga0496108_0045355_265_1068 267
53 3300048913 Ga0496110_0041875 Ga0496110_0041875_1187_1990 267
54 3300050490 nmdc:mga03n38_10938_c1 nmdc:mga03n38_10938_c1_373_1176 267
55 3300050491 nmdc:mga00v17_59819_c1 nmdc:mga00v17_59819_c1_490_1293 267
56 3300050516 nmdc:mga0sz30_76424_c1 nmdc:mga0sz30_76424_c1_273_1076 267
57 3300005441 Ga0070700_100115851 Ga0070700_1001158511 268
58 3300046455 Ga0495603_0001075 Ga0495603_0001075_7775_8602 268
59 3300046459 Ga0495629_0004479 Ga0495629_0004479_4731_5558 268
60 3300046689 Ga0495613_0000795 Ga0495613_0000795_13376_14203 268
61 3300047321 Ga0495676_0004478 Ga0495676_0004478_7218_8045 268
62 3300047673 Ga0495593_0059173 Ga0495593_0059173_346_1173 268
63 3300048089 Ga0495614_0002599 Ga0495614_0002599_1187_2014 268
64 3300048905 Ga0496102_0267980 Ga0496102_0267980_362_1282 268
65 3300048917 Ga0496114_0064683 Ga0496114_0064683_34_954 268
66 iso_pu_bacteria 2643221687 2644490940 268
67 iso_pu_bacteria 2902837492 2902843912 268
68 3300005353 Ga0070669_100000269 Ga0070669_10000026926 270
69 3300005367 Ga0070667_100000109 Ga0070667_10000010947 270
70 3300005548 Ga0070665_100004708 Ga0070665_1000047086 270
71 3300005617 Ga0068859_100001848 Ga0068859_10000184817 270
72 3300005618 Ga0068864_100195183 Ga0068864_1001951832 270
73 3300005841 Ga0068863_100000123 Ga0068863_10000012376 270
74 3300005842 Ga0068858_100029058 Ga0068858_1000290583 270
75 3300005843 Ga0068860_100000175 Ga0068860_10000017574 270
76 3300005844 Ga0068862_100000091 Ga0068862_10000009148 270
77 3300006186 Ga0075369_10045473 Ga0075369_100454733 270
78 3300006931 Ga0097620_100001848 Ga0097620_10000184817 270
79 3300009148 Ga0105243_10401698 Ga0105243_104016982 270
80 3300025900 Ga0207710_10000010 Ga0207710_10000010324 270
81 3300025923 Ga0207681_10000979 Ga0207681_1000097913 270
82 3300025941 Ga0207711_10000422 Ga0207711_1000042242 270
83 3300025961 Ga0207712_10000010 Ga0207712_1000001070 270
84 3300025986 Ga0207658_10000257 Ga0207658_1000025754 270
85 3300026035 Ga0207703_10080722 Ga0207703_100807223 270
86 3300026095 Ga0207676_10171047 Ga0207676_101710472 270
87 3300028380 Ga0268265_10000105 Ga0268265_1000010569 270
88 3300028381 Ga0268264_10000237 Ga0268264_1000023748 270
89 iso_pu_bacteria 2902810491 2902815271 270
90 3300006353 Ga0075370_10098692 Ga0075370_100986922 271
91 3300045976 Ga0466967_0181796 Ga0466967_0181796_726_1577 271
92 3300046531 Ga0495665_0014503 Ga0495665_0014503_1960_2787 271
93 3300048903 Ga0496100_0001679 Ga0496100_0001679_1072_1953 271
94 3300048904 Ga0496101_0000126 Ga0496101_0000126_5808_6689 271
95 3300048909 Ga0496106_0014412 Ga0496106_0014412_4110_4991 271
96 3300048922 Ga0496119_0000041 Ga0496119_0000041_37081_37962 271
97 3300048923 Ga0496120_0000027 Ga0496120_0000027_163043_163924 271
98 3300048924 Ga0496121_0000171 Ga0496121_0000171_10960_11841 271
99 3300048929 Ga0496126_0001352 Ga0496126_0001352_32356_33237 271
100 iso_pu_bacteria 2643221715 2644634355 271
101 iso_pu_bacteria 2643221715 2644637645 271
102 iso_pu_bacteria 2738541274 2738705002 271
103 iso_pu_bacteria 2738543028 2739330177 271
104 iso_pu_bacteria 2902799365 2902803321 271
105 3300003792 Ga0055540_1002167 Ga0055540_100216711 272
106 3300003792 Ga0055540_1008124 Ga0055540_10081243 272
107 3300005337 Ga0070682_100143643 Ga0070682_1001436432 272
108 3300006038 Ga0075365_10161507 Ga0075365_101615072 272
109 3300006353 Ga0075370_10065702 Ga0075370_100657023 272
110 3300017792 Ga0163161_10002219 Ga0163161_100022196 272
111 3300025273 Ga0209673_1009120 Ga0209673_10091206 272
112 3300025303 Ga0209051_1000516 Ga0209051_100051617 272
113 3300025303 Ga0209051_1038193 Ga0209051_10381932 272
114 3300026067 Ga0207678_10147295 Ga0207678_101472952 272
115 3300041452 Ga0451793_0338240 Ga0451793_0338240_439_1260 272
116 3300046461 Ga0495641_0055186 Ga0495641_0055186_215_1057 272
117 3300050496 nmdc:mga07m45_37062_c1 nmdc:mga07m45_37062_c1_877_1698 272
118 iso_pu_bacteria 2643221715 2644634353 272
119 iso_pu_bacteria 2902810491 2902816910 272
120 3300005435 Ga0070714_100067394 Ga0070714_1000673942 273
121 3300025929 Ga0207664_10169446 Ga0207664_101694463 273
122 3300041462 Ga0451806_157444 Ga0451806_157444_67_918 273
123 iso_pu_bacteria 2738541264 2738669088 273
124 iso_pu_bacteria 2738541356 2739147625 273
125 iso_pu_bacteria 2902792274 2902798952 273
126 iso_pu_bacteria 2929212328 2929217182 273
127 iso_pu_bacteria 2939582691 2939584383 273
128 3300005339 Ga0070660_100316654 Ga0070660_1003166542 274
129 3300005455 Ga0070663_100309650 Ga0070663_1003096502 274
130 3300005539 Ga0068853_100118208 Ga0068853_1001182083 274
131 3300005564 Ga0070664_100166365 Ga0070664_1001663652 274
132 3300005578 Ga0068854_100193147 Ga0068854_1001931473 274
133 3300005618 Ga0068864_100277886 Ga0068864_1002778862 274
134 3300005618 Ga0068864_100403139 Ga0068864_1004031392 274
135 3300005840 Ga0068870_10118475 Ga0068870_101184752 274
136 3300005841 Ga0068863_100229538 Ga0068863_1002295382 274
137 3300006048 Ga0075363_100002100 Ga0075363_1000021007 274
138 3300006353 Ga0075370_10152656 Ga0075370_101526562 274
139 3300009148 Ga0105243_10320876 Ga0105243_103208762 274
140 3300011119 Ga0105246_10284641 Ga0105246_102846412 274
141 3300021388 Ga0213875_10017316 Ga0213875_100173164 274
142 3300025919 Ga0207657_10360912 Ga0207657_103609122 274
143 3300025944 Ga0207661_10250725 Ga0207661_102507252 274
144 3300025945 Ga0207679_10174922 Ga0207679_101749223 274
145 3300025981 Ga0207640_10207248 Ga0207640_102072482 274
146 3300026035 Ga0207703_10510295 Ga0207703_105102951 274
147 3300026067 Ga0207678_10329712 Ga0207678_103297122 274
148 3300026075 Ga0207708_10134228 Ga0207708_101342283 274
149 3300026095 Ga0207676_10199966 Ga0207676_101999663 274
150 3300037853 Ga0436364_0708750 Ga0436364_0708750_19740_20564 274
151 3300041411 Ga0439466_0007901 Ga0439466_0007901_175_1002 274
152 3300041509 Ga0451843_1626385 Ga0451843_1626385_90_914 274
153 3300042004 Ga0439445_0013493 Ga0439445_0013493_457_1284 274
154 3300042435 Ga0439434_0025081 Ga0439434_0025081_621_1448 274
155 3300046455 Ga0495603_0018759 Ga0495603_0018759_1971_2795 274
156 3300046459 Ga0495629_0017753 Ga0495629_0017753_2834_3658 274
157 3300046475 Ga0495639_0073673 Ga0495639_0073673_694_1518 274
158 3300046533 Ga0495640_0041814 Ga0495640_0041814_1623_2447 274
159 3300047315 Ga0495581_0042384 Ga0495581_0042384_1313_2137 274
160 3300047321 Ga0495676_0090968 Ga0495676_0090968_685_1509 274
161 3300047673 Ga0495593_0020379 Ga0495593_0020379_299_1123 274
162 3300048903 Ga0496100_0109014 Ga0496100_0109014_486_1313 274
163 3300048905 Ga0496102_0049038 Ga0496102_0049038_921_1748 274
164 3300048905 Ga0496102_0676326 Ga0496102_0676326_64_888 274
165 3300048907 Ga0496104_0158457 Ga0496104_0158457_677_1504 274
166 3300048910 Ga0496107_0128743 Ga0496107_0128743_898_1725 274
167 3300048911 Ga0496108_0036172 Ga0496108_0036172_3145_3969 274
168 3300048911 Ga0496108_0065405 Ga0496108_0065405_1654_2478 274
169 3300048912 Ga0496109_0013709 Ga0496109_0013709_3945_4769 274
170 3300048912 Ga0496109_0167124 Ga0496109_0167124_1158_1982 274
171 3300048913 Ga0496110_0129410 Ga0496110_0129410_497_1321 274
172 3300048915 Ga0496112_0019023 Ga0496112_0019023_5284_6108 274
173 3300048916 Ga0496113_0563237 Ga0496113_0563237_22_846 274
174 3300050490 nmdc:mga03n38_963_c1 nmdc:mga03n38_963_c1_4798_5622 274
175 3300050496 nmdc:mga07m45_175617_c1 nmdc:mga07m45_175617_c1_270_1094 274
176 iso_pu_bacteria 2842134933 2842139458 274
177 3300005364 Ga0070673_100316736 Ga0070673_1003167361 275
178 3300006038 Ga0075365_10002159 Ga0075365_100021598 275
179 3300006048 Ga0075363_100019935 Ga0075363_1000199352 275
180 3300006051 Ga0075364_10010353 Ga0075364_100103535 275
181 3300006051 Ga0075364_10088699 Ga0075364_100886992 275
182 3300006186 Ga0075369_10004539 Ga0075369_100045394 275
183 3300006186 Ga0075369_10044918 Ga0075369_100449182 275
184 3300031901 Ga0307406_10039227 Ga0307406_100392274 275
185 3300041413 Ga0439465_0076496 Ga0439465_0076496_196_1059 275
186 3300044658 Ga0466972_0005273 Ga0466972_0005273_4974_5837 275
187 3300044842 Ga0466957_0027534 Ga0466957_0027534_1354_2217 275
188 3300045836 Ga0466958_0051154 Ga0466958_0051154_1143_2006 275
189 3300046460 Ga0495638_0006390 Ga0495638_0006390_5282_6109 275
190 3300048917 Ga0496114_0212605 Ga0496114_0212605_12_839 275
191 3300048929 Ga0496126_0020980 Ga0496126_0020980_3592_4419 275
192 3300050490 nmdc:mga03n38_4903_c1 nmdc:mga03n38_4903_c1_1369_2199 275
193 3300050490 nmdc:mga03n38_5678_c1 nmdc:mga03n38_5678_c1_1745_2572 275
194 3300050491 nmdc:mga00v17_312669_c1 nmdc:mga00v17_312669_c1_58_885 275
195 3300050492 nmdc:mga0yw44_415_c1 nmdc:mga0yw44_415_c1_3626_4453 275
196 3300050516 nmdc:mga0sz30_61862_c1 nmdc:mga0sz30_61862_c1_476_1303 275
197 3300053104 Ga0500556_0004614 Ga0500556_0004614_1231_2058 275
198 3300053131 Ga0500652_000152 Ga0500652_000152_21075_21905 275
199 3300053730 Ga0500645_000014 Ga0500645_000014_104661_105488 275
200 3300006038 Ga0075365_10306353 Ga0075365_103063531 276
201 3300006051 Ga0075364_10041018 Ga0075364_100410184 276
202 3300006051 Ga0075364_10085750 Ga0075364_100857502 276
203 3300006186 Ga0075369_10004191 Ga0075369_100041916 276
204 3300009177 Ga0105248_10000458 Ga0105248_1000045842 276
205 3300009553 Ga0105249_10000020 Ga0105249_10000020194 276
206 3300014325 Ga0163163_10027965 Ga0163163_100279651 276
207 3300031901 Ga0307406_10300841 Ga0307406_103008412 276
208 3300041410 Ga0439461_0000438 Ga0439461_0000438_323_1156 276
209 3300041411 Ga0439466_0007535 Ga0439466_0007535_2657_3490 276
210 3300041997 Ga0439431_0009129 Ga0439431_0009129_345_1178 276
211 3300042004 Ga0439445_0011095 Ga0439445_0011095_1217_2050 276
212 3300042435 Ga0439434_0010970 Ga0439434_0010970_1489_2322 276
213 3300044683 Ga0466965_0000450 Ga0466965_0000450_5989_6825 276
214 3300044901 Ga0466960_0002405 Ga0466960_0002405_2528_3364 276
215 3300048905 Ga0496102_0000526 Ga0496102_0000526_13690_14520 276
216 3300048906 Ga0496103_0000356 Ga0496103_0000356_33484_34314 276
217 3300048910 Ga0496107_0026774 Ga0496107_0026774_2000_2830 276
218 3300048915 Ga0496112_0055611 Ga0496112_0055611_2646_3479 276
219 3300048916 Ga0496113_0006604 Ga0496113_0006604_1107_1940 276
220 3300048919 Ga0496116_0026890 Ga0496116_0026890_1675_2505 276
221 3300048920 Ga0496117_0000614 Ga0496117_0000614_22526_23356 276
222 3300048921 Ga0496118_0000558 Ga0496118_0000558_40006_40836 276
223 3300048922 Ga0496119_0005591 Ga0496119_0005591_8918_9748 276
224 3300048924 Ga0496121_0010416 Ga0496121_0010416_6859_7689 276
225 3300048925 Ga0496122_0019056 Ga0496122_0019056_4064_4897 276
226 3300048928 Ga0496125_0169088 Ga0496125_0169088_535_1365 276
227 3300048929 Ga0496126_0006132 Ga0496126_0006132_8924_9754 276
228 3300048929 Ga0496126_0019190 Ga0496126_0019190_238_1071 276
229 3300050490 nmdc:mga03n38_179210_c1 nmdc:mga03n38_179210_c1_89_937 276
230 3300050491 nmdc:mga00v17_44665_c1 nmdc:mga00v17_44665_c1_153_986 276
231 3300050491 nmdc:mga00v17_8370_c1 nmdc:mga00v17_8370_c1_870_1703 276
232 3300050491 nmdc:mga00v17_95341_c1 nmdc:mga00v17_95341_c1_653_1519 276
233 3300050516 nmdc:mga0sz30_8274_c2 nmdc:mga0sz30_8274_c2_980_1810 276
234 3300053153 Ga0500616_0020256 Ga0500616_0020256_2774_3604 276
235 iso_pu_bacteria 2939582691 2939585368 276
236 3300005367 Ga0070667_100000525 Ga0070667_10000052539 277
237 3300005937 Ga0081455_10149488 Ga0081455_101494882 277
238 3300006042 Ga0075368_10036042 Ga0075368_100360422 277
239 3300006048 Ga0075363_100249777 Ga0075363_1002497772 277
240 3300006051 Ga0075364_10154587 Ga0075364_101545872 277
241 3300006353 Ga0075370_10094918 Ga0075370_100949183 277
242 3300025903 Ga0207680_10014175 Ga0207680_100141751 277
243 3300025986 Ga0207658_10309665 Ga0207658_103096652 277
244 3300031251 Ga0265327_10000336 Ga0265327_1000033623 277
245 3300045976 Ga0466967_0209655 Ga0466967_0209655_681_1547 277
246 3300048903 Ga0496100_0000073 Ga0496100_0000073_25826_26659 277
247 3300048905 Ga0496102_0009713 Ga0496102_0009713_3533_4366 277
248 3300048906 Ga0496103_0000692 Ga0496103_0000692_14393_15226 277
249 3300048909 Ga0496106_0000180 Ga0496106_0000180_18011_18844 277
250 3300048911 Ga0496108_0015379 Ga0496108_0015379_5195_6028 277
251 3300048912 Ga0496109_0000128 Ga0496109_0000128_64219_65052 277
252 3300048913 Ga0496110_0000633 Ga0496110_0000633_5462_6295 277
253 3300048916 Ga0496113_0404829 Ga0496113_0404829_43_1008 277
254 3300048917 Ga0496114_0135955 Ga0496114_0135955_483_1316 277
255 3300048918 Ga0496115_0003703 Ga0496115_0003703_5345_6178 277
256 3300048919 Ga0496116_0005486 Ga0496116_0005486_4877_5710 277
257 3300048920 Ga0496117_0026079 Ga0496117_0026079_356_1189 277
258 3300048921 Ga0496118_0002324 Ga0496118_0002324_11160_11993 277
259 3300048922 Ga0496119_0052946 Ga0496119_0052946_1294_2127 277
260 3300048923 Ga0496120_0011121 Ga0496120_0011121_375_1208 277
261 3300048924 Ga0496121_0000004 Ga0496121_0000004_25826_26659 277
262 3300048925 Ga0496122_0000474 Ga0496122_0000474_1239_2072 277
263 3300048926 Ga0496123_0009090 Ga0496123_0009090_6871_7704 277
264 3300048927 Ga0496124_0000117 Ga0496124_0000117_25826_26659 277
265 3300048928 Ga0496125_0000003 Ga0496125_0000003_1163109_1163942 277
266 3300048929 Ga0496126_0000001 Ga0496126_0000001_25826_26659 277
267 3300048929 Ga0496126_0004251 Ga0496126_0004251_1319_2155 277
268 3300050496 nmdc:mga07m45_47530_c1 nmdc:mga07m45_47530_c1_130_966 277
269 3300053153 Ga0500616_0051534 Ga0500616_0051534_37_900 277
270 3300005435 Ga0070714_100429174 Ga0070714_1004291742 278
271 3300005842 Ga0068858_100036557 Ga0068858_1000365573 278
272 3300006048 Ga0075363_100238144 Ga0075363_1002381442 278
273 3300006051 Ga0075364_10074756 Ga0075364_100747563 278
274 3300006051 Ga0075364_10136011 Ga0075364_101360113 278
275 3300009092 Ga0105250_10049552 Ga0105250_100495523 278
276 3300009101 Ga0105247_10000044 Ga0105247_10000044122 278
277 3300009177 Ga0105248_10000060 Ga0105248_100000608 278
278 3300009553 Ga0105249_10000049 Ga0105249_100000498 278
279 3300014968 Ga0157379_10320439 Ga0157379_103204392 278
280 3300025961 Ga0207712_10000038 Ga0207712_1000003820 278
281 3300025972 Ga0207668_10000336 Ga0207668_1000033631 278
282 3300026035 Ga0207703_10031724 Ga0207703_100317242 278
283 3300026035 Ga0207703_10317248 Ga0207703_103172482 278
284 3300028380 Ga0268265_10000053 Ga0268265_10000053142 278
285 3300036712 Ga0316584_0082910 Ga0316584_0082910_532_1368 278
286 3300044658 Ga0466972_0014245 Ga0466972_0014245_1294_2142 278
287 3300044683 Ga0466965_0002264 Ga0466965_0002264_4852_5736 278
288 3300044683 Ga0466965_0002608 Ga0466965_0002608_1141_1989 278
289 3300044735 Ga0466968_0084585 Ga0466968_0084585_389_1273 278
290 3300044765 Ga0466970_0047685 Ga0466970_0047685_1141_2025 278
291 3300044901 Ga0466960_0001352 Ga0466960_0001352_7624_8508 278
292 3300045049 Ga0466959_0017570 Ga0466959_0017570_1141_2025 278
293 3300045976 Ga0466967_0010869 Ga0466967_0010869_860_1744 278
294 3300048903 Ga0496100_0053088 Ga0496100_0053088_608_1462 278
295 3300048904 Ga0496101_0119037 Ga0496101_0119037_72_926 278
296 3300048905 Ga0496102_0000006 Ga0496102_0000006_66215_67096 278
297 3300048905 Ga0496102_0000227 Ga0496102_0000227_29457_30311 278
298 3300048906 Ga0496103_0000006 Ga0496103_0000006_66013_66894 278
299 3300048907 Ga0496104_0385045 Ga0496104_0385045_61_915 278
300 3300048917 Ga0496114_0289611 Ga0496114_0289611_260_1114 278
301 3300048919 Ga0496116_0000025 Ga0496116_0000025_403646_404527 278
302 3300048919 Ga0496116_0016684 Ga0496116_0016684_440_1294 278
303 3300048920 Ga0496117_0000006 Ga0496117_0000006_403646_404527 278
304 3300048920 Ga0496117_0001032 Ga0496117_0001032_12183_13037 278
305 3300048921 Ga0496118_0000004 Ga0496118_0000004_403646_404527 278
306 3300048921 Ga0496118_0000249 Ga0496118_0000249_23998_24852 278
307 3300048922 Ga0496119_0019232 Ga0496119_0019232_1677_2531 278
308 3300048924 Ga0496121_0002984 Ga0496121_0002984_21902_22756 278
309 3300048929 Ga0496126_0069862 Ga0496126_0069862_440_1294 278
310 3300050490 nmdc:mga03n38_70392_c1 nmdc:mga03n38_70392_c1_158_994 278
311 iso_pu_bacteria 2842134933 2842135944 278
312 3300002070 JGI24750J21931_1003241 JGI24750J21931_10032412 279
313 3300002077 JGI24744J21845_10001122 JGI24744J21845_100011222 279
314 3300005328 Ga0070676_10004806 Ga0070676_100048068 279
315 3300005330 Ga0070690_100013662 Ga0070690_1000136624 279
316 3300005335 Ga0070666_10065870 Ga0070666_100658702 279
317 3300005336 Ga0070680_100157478 Ga0070680_1001574783 279
318 3300005337 Ga0070682_100064761 Ga0070682_1000647613 279
319 3300005338 Ga0068868_100002879 Ga0068868_1000028799 279
320 3300005340 Ga0070689_100020457 Ga0070689_1000204573 279
321 3300005340 Ga0070689_100066818 Ga0070689_1000668182 279
322 3300005341 Ga0070691_10007143 Ga0070691_100071432 279
323 3300005343 Ga0070687_100053915 Ga0070687_1000539153 279
324 3300005347 Ga0070668_100001043 Ga0070668_10000104319 279
325 3300005353 Ga0070669_100095893 Ga0070669_1000958932 279
326 3300005354 Ga0070675_100077259 Ga0070675_1000772592 279
327 3300005354 Ga0070675_100120157 Ga0070675_1001201574 279
328 3300005355 Ga0070671_100002403 Ga0070671_1000024032 279
329 3300005355 Ga0070671_100075548 Ga0070671_1000755481 279
330 3300005355 Ga0070671_100259649 Ga0070671_1002596492 279
331 3300005356 Ga0070674_100005257 Ga0070674_1000052573 279
332 3300005364 Ga0070673_100075881 Ga0070673_1000758812 279
333 3300005365 Ga0070688_100030794 Ga0070688_1000307943 279
334 3300005365 Ga0070688_100035153 Ga0070688_1000351531 279
335 3300005366 Ga0070659_100132969 Ga0070659_1001329692 279
336 3300005367 Ga0070667_100045298 Ga0070667_1000452982 279
337 3300005367 Ga0070667_100104437 Ga0070667_1001044372 279
338 3300005367 Ga0070667_100155688 Ga0070667_1001556882 279
339 3300005367 Ga0070667_100157754 Ga0070667_1001577542 279
340 3300005434 Ga0070709_10006934 Ga0070709_100069345 279
341 3300005437 Ga0070710_10001278 Ga0070710_100012789 279
342 3300005437 Ga0070710_10005383 Ga0070710_100053836 279
343 3300005438 Ga0070701_10015295 Ga0070701_100152953 279
344 3300005439 Ga0070711_100001283 Ga0070711_10000128311 279
345 3300005440 Ga0070705_100001679 Ga0070705_1000016798 279
346 3300005441 Ga0070700_100000736 Ga0070700_10000073616 279
347 3300005441 Ga0070700_100074254 Ga0070700_1000742542 279
348 3300005444 Ga0070694_100005267 Ga0070694_1000052679 279
349 3300005455 Ga0070663_100121246 Ga0070663_1001212462 279
350 3300005456 Ga0070678_100004492 Ga0070678_1000044926 279
351 3300005457 Ga0070662_100006487 Ga0070662_1000064876 279
352 3300005459 Ga0068867_100001022 Ga0068867_10000102219 279
353 3300005539 Ga0068853_100004870 Ga0068853_1000048707 279
354 3300005539 Ga0068853_100183636 Ga0068853_1001836362 279
355 3300005543 Ga0070672_100117418 Ga0070672_1001174181 279
356 3300005544 Ga0070686_100431287 Ga0070686_1004312871 279
357 3300005545 Ga0070695_100016240 Ga0070695_1000162405 279
358 3300005546 Ga0070696_100004733 Ga0070696_1000047336 279
359 3300005547 Ga0070693_100003031 Ga0070693_1000030313 279
360 3300005548 Ga0070665_100003767 Ga0070665_10000376711 279
361 3300005549 Ga0070704_100002013 Ga0070704_1000020138 279
362 3300005549 Ga0070704_100383669 Ga0070704_1003836692 279
363 3300005563 Ga0068855_100064287 Ga0068855_1000642877 279
364 3300005578 Ga0068854_100007902 Ga0068854_1000079028 279
365 3300005614 Ga0068856_100052764 Ga0068856_1000527642 279
366 3300005615 Ga0070702_100003743 Ga0070702_1000037434 279
367 3300005617 Ga0068859_100001404 Ga0068859_1000014046 279
368 3300005617 Ga0068859_100242094 Ga0068859_1002420942 279
369 3300005618 Ga0068864_100062955 Ga0068864_1000629552 279
370 3300005718 Ga0068866_10000157 Ga0068866_100001578 279
371 3300005719 Ga0068861_100003872 Ga0068861_1000038727 279
372 3300005719 Ga0068861_100537724 Ga0068861_1005377241 279
373 3300005840 Ga0068870_10191671 Ga0068870_101916712 279
374 3300005841 Ga0068863_100003252 Ga0068863_10000325214 279
375 3300005842 Ga0068858_100002311 Ga0068858_10000231118 279
376 3300005842 Ga0068858_100076497 Ga0068858_1000764972 279
377 3300005843 Ga0068860_100009924 Ga0068860_1000099248 279
378 3300005843 Ga0068860_100190015 Ga0068860_1001900152 279
379 3300005844 Ga0068862_100021844 Ga0068862_1000218448 279
380 3300005844 Ga0068862_100341309 Ga0068862_1003413092 279
381 3300005937 Ga0081455_10013138 Ga0081455_100131387 279
382 3300006038 Ga0075365_10037424 Ga0075365_100374242 279
383 3300006038 Ga0075365_10074874 Ga0075365_100748742 279
384 3300006042 Ga0075368_10011590 Ga0075368_100115904 279
385 3300006048 Ga0075363_100000180 Ga0075363_1000001805 279
386 3300006048 Ga0075363_100004912 Ga0075363_1000049125 279
387 3300006048 Ga0075363_100009115 Ga0075363_1000091156 279
388 3300006048 Ga0075363_100053003 Ga0075363_1000530032 279
389 3300006048 Ga0075363_100060864 Ga0075363_1000608642 279
390 3300006048 Ga0075363_100074824 Ga0075363_1000748242 279
391 3300006051 Ga0075364_10009126 Ga0075364_100091262 279
392 3300006051 Ga0075364_10013248 Ga0075364_100132484 279
393 3300006051 Ga0075364_10022152 Ga0075364_100221525 279
394 3300006051 Ga0075364_10075962 Ga0075364_100759622 279
395 3300006163 Ga0070715_10009555 Ga0070715_100095555 279
396 3300006173 Ga0070716_100002696 Ga0070716_1000026964 279
397 3300006173 Ga0070716_100027764 Ga0070716_1000277645 279
398 3300006173 Ga0070716_100045339 Ga0070716_1000453393 279
399 3300006175 Ga0070712_100000595 Ga0070712_10000059513 279
400 3300006175 Ga0070712_100013054 Ga0070712_10001305410 279
401 3300006175 Ga0070712_100469070 Ga0070712_1004690701 279
402 3300006177 Ga0075362_10077735 Ga0075362_100777352 279
403 3300006178 Ga0075367_10163879 Ga0075367_101638792 279
404 3300006186 Ga0075369_10002229 Ga0075369_100022299 279
405 3300006186 Ga0075369_10031457 Ga0075369_100314572 279
406 3300006186 Ga0075369_10037312 Ga0075369_100373122 279
407 3300006186 Ga0075369_10079839 Ga0075369_100798391 279
408 3300006353 Ga0075370_10003571 Ga0075370_100035716 279
409 3300006353 Ga0075370_10025895 Ga0075370_100258952 279
410 3300006353 Ga0075370_10044257 Ga0075370_100442573 279
411 3300006353 Ga0075370_10179175 Ga0075370_101791751 279
412 3300006353 Ga0075370_10285989 Ga0075370_102859891 279
413 3300006358 Ga0068871_100222214 Ga0068871_1002222141 279
414 3300006358 Ga0068871_100307978 Ga0068871_1003079782 279
415 3300006881 Ga0068865_100002343 Ga0068865_1000023439 279
416 3300006931 Ga0097620_100001404 Ga0097620_10000140424 279
417 3300006931 Ga0097620_100242100 Ga0097620_1002421002 279
418 3300009036 Ga0105244_10073950 Ga0105244_100739502 279
419 3300009098 Ga0105245_10017190 Ga0105245_100171907 279
420 3300009098 Ga0105245_10350296 Ga0105245_103502962 279
421 3300009101 Ga0105247_10004162 Ga0105247_100041628 279
422 3300009101 Ga0105247_10150417 Ga0105247_101504172 279
423 3300009148 Ga0105243_10006009 Ga0105243_100060094 279
424 3300009174 Ga0105241_10008438 Ga0105241_100084383 279
425 3300009176 Ga0105242_10000185 Ga0105242_1000018514 279
426 3300009177 Ga0105248_10034071 Ga0105248_100340717 279
427 3300009545 Ga0105237_10039453 Ga0105237_100394535 279
428 3300009545 Ga0105237_10048303 Ga0105237_100483036 279
429 3300009551 Ga0105238_10241972 Ga0105238_102419722 279
430 3300009551 Ga0105238_10701058 Ga0105238_107010581 279
431 3300009553 Ga0105249_10006548 Ga0105249_100065486 279
432 3300009553 Ga0105249_10007930 Ga0105249_100079307 279
433 3300010375 Ga0105239_10009569 Ga0105239_100095694 279
434 3300011119 Ga0105246_10010539 Ga0105246_100105396 279
435 3300013105 Ga0157369_10385927 Ga0157369_103859271 279
436 3300013296 Ga0157374_10092796 Ga0157374_100927962 279
437 3300013296 Ga0157374_10104105 Ga0157374_101041053 279
438 3300013297 Ga0157378_10009545 Ga0157378_100095455 279
439 3300013306 Ga0163162_10086868 Ga0163162_100868682 279
440 3300013307 Ga0157372_10028792 Ga0157372_100287926 279
441 3300013308 Ga0157375_10003738 Ga0157375_100037386 279
442 3300014325 Ga0163163_10070200 Ga0163163_100702002 279
443 3300014326 Ga0157380_10000359 Ga0157380_100003597 279
444 3300014968 Ga0157379_10005718 Ga0157379_100057188 279
445 3300014969 Ga0157376_10827128 Ga0157376_108271282 279
446 3300017792 Ga0163161_10002219 Ga0163161_100022198 279
447 3300017792 Ga0163161_10124214 Ga0163161_101242142 279
448 3300025885 Ga0207653_10023418 Ga0207653_100234183 279
449 3300025898 Ga0207692_10005094 Ga0207692_100050946 279
450 3300025898 Ga0207692_10006799 Ga0207692_100067995 279
451 3300025899 Ga0207642_10000150 Ga0207642_100001507 279
452 3300025901 Ga0207688_10000337 Ga0207688_1000033713 279
453 3300025901 Ga0207688_10002282 Ga0207688_100022828 279
454 3300025903 Ga0207680_10052289 Ga0207680_100522892 279
455 3300025905 Ga0207685_10002624 Ga0207685_100026241 279
456 3300025906 Ga0207699_10025720 Ga0207699_100257206 279
457 3300025907 Ga0207645_10016956 Ga0207645_100169563 279
458 3300025911 Ga0207654_10015397 Ga0207654_100153973 279
459 3300025911 Ga0207654_10249177 Ga0207654_102491772 279
460 3300025914 Ga0207671_10070783 Ga0207671_100707831 279
461 3300025914 Ga0207671_10283143 Ga0207671_102831432 279
462 3300025915 Ga0207693_10000261 Ga0207693_1000026139 279
463 3300025915 Ga0207693_10001726 Ga0207693_1000172612 279
464 3300025915 Ga0207693_10367586 Ga0207693_103675861 279
465 3300025916 Ga0207663_10003786 Ga0207663_100037862 279
466 3300025916 Ga0207663_10193784 Ga0207663_101937842 279
467 3300025917 Ga0207660_10315933 Ga0207660_103159332 279
468 3300025918 Ga0207662_10186819 Ga0207662_101868192 279
469 3300025923 Ga0207681_10030198 Ga0207681_100301983 279
470 3300025923 Ga0207681_10252358 Ga0207681_102523582 279
471 3300025925 Ga0207650_10420873 Ga0207650_104208731 279
472 3300025927 Ga0207687_10002135 Ga0207687_100021353 279
473 3300025931 Ga0207644_10007489 Ga0207644_1000748910 279
474 3300025931 Ga0207644_10038081 Ga0207644_100380814 279
475 3300025931 Ga0207644_10109706 Ga0207644_101097061 279
476 3300025933 Ga0207706_10015497 Ga0207706_100154974 279
477 3300025933 Ga0207706_10018810 Ga0207706_100188106 279
478 3300025934 Ga0207686_10014209 Ga0207686_100142092 279
479 3300025935 Ga0207709_10006052 Ga0207709_100060524 279
480 3300025935 Ga0207709_10026514 Ga0207709_100265143 279
481 3300025936 Ga0207670_10013554 Ga0207670_100135544 279
482 3300025937 Ga0207669_10000439 Ga0207669_1000043916 279
483 3300025937 Ga0207669_10202423 Ga0207669_102024232 279
484 3300025938 Ga0207704_10001841 Ga0207704_100018418 279
485 3300025938 Ga0207704_10256857 Ga0207704_102568572 279
486 3300025939 Ga0207665_10004521 Ga0207665_100045217 279
487 3300025939 Ga0207665_10004603 Ga0207665_100046036 279
488 3300025939 Ga0207665_10066465 Ga0207665_100664652 279
489 3300025940 Ga0207691_10215790 Ga0207691_102157902 279
490 3300025941 Ga0207711_10251926 Ga0207711_102519262 279
491 3300025942 Ga0207689_10035332 Ga0207689_100353327 279
492 3300025942 Ga0207689_10054075 Ga0207689_100540752 279
493 3300025949 Ga0207667_10592345 Ga0207667_105923452 279
494 3300025961 Ga0207712_10008700 Ga0207712_100087003 279
495 3300025972 Ga0207668_10107570 Ga0207668_101075702 279
496 3300025986 Ga0207658_10004329 Ga0207658_100043292 279
497 3300025986 Ga0207658_10027612 Ga0207658_100276123 279
498 3300025986 Ga0207658_10134739 Ga0207658_101347392 279
499 3300025986 Ga0207658_10225123 Ga0207658_102251232 279
500 3300026023 Ga0207677_10002097 Ga0207677_1000209711 279
501 3300026023 Ga0207677_10102274 Ga0207677_101022742 279
502 3300026035 Ga0207703_10009962 Ga0207703_100099626 279
503 3300026041 Ga0207639_10211395 Ga0207639_102113952 279
504 3300026041 Ga0207639_10344722 Ga0207639_103447222 279
505 3300026067 Ga0207678_10016208 Ga0207678_100162082 279
506 3300026075 Ga0207708_10000491 Ga0207708_1000049116 279
507 3300026075 Ga0207708_10012802 Ga0207708_100128023 279
508 3300026078 Ga0207702_10058110 Ga0207702_100581102 279
509 3300026088 Ga0207641_10005931 Ga0207641_100059318 279
510 3300026089 Ga0207648_10002698 Ga0207648_100026986 279
511 3300026089 Ga0207648_10021203 Ga0207648_100212033 279
512 3300026095 Ga0207676_10135807 Ga0207676_101358072 279
513 3300026118 Ga0207675_100011056 Ga0207675_1000110568 279
514 3300026118 Ga0207675_100044025 Ga0207675_1000440251 279
515 3300026121 Ga0207683_10000103 Ga0207683_1000010338 279
516 3300026121 Ga0207683_10004092 Ga0207683_1000409210 279
517 3300028379 Ga0268266_10004053 Ga0268266_1000405311 279
518 3300028379 Ga0268266_10074691 Ga0268266_100746912 279
519 3300028380 Ga0268265_10020974 Ga0268265_100209747 279
520 3300028381 Ga0268264_10014920 Ga0268264_100149208 279
521 3300031824 Ga0307413_10066750 Ga0307413_100667502 279
522 3300031852 Ga0307410_10036313 Ga0307410_100363134 279
523 3300031852 Ga0307410_10410648 Ga0307410_104106481 279
524 3300031995 Ga0307409_100012589 Ga0307409_1000125894 279
525 3300031995 Ga0307409_100124800 Ga0307409_1001248003 279
526 3300031995 Ga0307409_100328486 Ga0307409_1003284862 279
527 3300032002 Ga0307416_100029810 Ga0307416_1000298103 279
528 3300035691 Ga0373931_0067983 Ga0373931_0067983_122_961 279
529 3300041411 Ga0439466_0045598 Ga0439466_0045598_145_984 279
530 3300041413 Ga0439465_0006711 Ga0439465_0006711_1455_2294 279
531 3300041413 Ga0439465_0037259 Ga0439465_0037259_336_1175 279
532 3300042002 Ga0439442_019949 Ga0439442_019949_341_1180 279
533 3300042004 Ga0439445_0004502 Ga0439445_0004502_2102_2941 279
534 3300042004 Ga0439445_0019470 Ga0439445_0019470_147_986 279
535 3300042436 Ga0439435_0010605 Ga0439435_0010605_467_1306 279
536 3300044658 Ga0466972_0046927 Ga0466972_0046927_13_852 279
537 3300044658 Ga0466972_0074776 Ga0466972_0074776_574_1413 279
538 3300044683 Ga0466965_0160361 Ga0466965_0160361_50_889 279
539 3300044683 Ga0466965_0252424 Ga0466965_0252424_85_924 279
540 3300044694 Ga0466963_0101404 Ga0466963_0101404_837_1676 279
541 3300044842 Ga0466957_0053201 Ga0466957_0053201_1496_2338 279
542 3300044901 Ga0466960_0028674 Ga0466960_0028674_150_989 279
543 3300045976 Ga0466967_0074050 Ga0466967_0074050_1921_2760 279
544 3300048903 Ga0496100_0005721 Ga0496100_0005721_4388_5227 279
545 3300048904 Ga0496101_0001089 Ga0496101_0001089_6606_7445 279
546 3300048904 Ga0496101_0217541 Ga0496101_0217541_299_1138 279
547 3300048905 Ga0496102_0017105 Ga0496102_0017105_4489_5328 279
548 3300048905 Ga0496102_0030969 Ga0496102_0030969_1159_1998 279
549 3300048906 Ga0496103_0005234 Ga0496103_0005234_3981_4820 279
550 3300048906 Ga0496103_0056578 Ga0496103_0056578_1271_2110 279
551 3300048906 Ga0496103_0165806 Ga0496103_0165806_496_1335 279
552 3300048909 Ga0496106_0010186 Ga0496106_0010186_3248_4087 279
553 3300048910 Ga0496107_0001744 Ga0496107_0001744_8303_9142 279
554 3300048910 Ga0496107_0016336 Ga0496107_0016336_3275_4114 279
555 3300048911 Ga0496108_0056128 Ga0496108_0056128_932_1771 279
556 3300048911 Ga0496108_0621557 Ga0496108_0621557_47_886 279
557 3300048912 Ga0496109_0068502 Ga0496109_0068502_323_1162 279
558 3300048913 Ga0496110_0007433 Ga0496110_0007433_7517_8356 279
559 3300048914 Ga0496111_0072992 Ga0496111_0072992_120_959 279
560 3300048915 Ga0496112_0003825 Ga0496112_0003825_7671_8510 279
561 3300048915 Ga0496112_0053648 Ga0496112_0053648_1185_2024 279
562 3300048915 Ga0496112_0372326 Ga0496112_0372326_26_865 279
563 3300048916 Ga0496113_0250448 Ga0496113_0250448_356_1195 279
564 3300048917 Ga0496114_0021673 Ga0496114_0021673_3369_4208 279
565 3300048918 Ga0496115_0005658 Ga0496115_0005658_3704_4543 279
566 3300050490 nmdc:mga03n38_13607_c1 nmdc:mga03n38_13607_c1_1831_2670 279
567 3300050490 nmdc:mga03n38_1586_c1 nmdc:mga03n38_1586_c1_410_1252 279
568 3300050490 nmdc:mga03n38_2128_c1 nmdc:mga03n38_2128_c1_3309_4151 279
569 3300050490 nmdc:mga03n38_2385_c1 nmdc:mga03n38_2385_c1_955_1794 279
570 3300050491 nmdc:mga00v17_107642_c1 nmdc:mga00v17_107642_c1_486_1328 279
571 3300050491 nmdc:mga00v17_1531_c1 nmdc:mga00v17_1531_c1_5628_6467 279
572 3300050491 nmdc:mga00v17_34871_c1 nmdc:mga00v17_34871_c1_1109_1951 279
573 3300050491 nmdc:mga00v17_39138_c1 nmdc:mga00v17_39138_c1_1857_2699 279
574 3300050491 nmdc:mga00v17_410606_c1 nmdc:mga00v17_410606_c1_20_859 279
575 3300050492 nmdc:mga0yw44_12173_c1 nmdc:mga0yw44_12173_c1_2163_3005 279
576 3300050492 nmdc:mga0yw44_212220_c1 nmdc:mga0yw44_212220_c1_423_1265 279
577 3300050492 nmdc:mga0yw44_223233_c1 nmdc:mga0yw44_223233_c1_346_1185 279
578 3300050493 nmdc:mga0k408_71919_c1 nmdc:mga0k408_71919_c1_551_1393 279
579 3300050494 nmdc:mga06z11_14789_c1 nmdc:mga06z11_14789_c1_2346_3188 279
580 3300050495 nmdc:mga04h51_2337_c1 nmdc:mga04h51_2337_c1_1765_2607 279
581 3300050496 nmdc:mga07m45_18732_c1 nmdc:mga07m45_18732_c1_217_1059 279
582 3300050496 nmdc:mga07m45_3090_c1 nmdc:mga07m45_3090_c1_2599_3441 279
583 3300050496 nmdc:mga07m45_96009_c1 nmdc:mga07m45_96009_c1_824_1663 279
584 3300050496 nmdc:mga07m45_9847_c1 nmdc:mga07m45_9847_c1_1115_1957 279
585 3300050510 nmdc:mga06r32_19375_c1 nmdc:mga06r32_19375_c1_3482_4321 279
586 3300050516 nmdc:mga0sz30_101432_c1 nmdc:mga0sz30_101432_c1_42_884 279
587 3300050516 nmdc:mga0sz30_102101_c1 nmdc:mga0sz30_102101_c1_258_1097 279
588 3300050516 nmdc:mga0sz30_1819_c1 nmdc:mga0sz30_1819_c1_44_883 279
589 3300061719 Ga0466962_0024704 Ga0466962_0024704_614_1453 279

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04072

LCM

Leucine carboxyl methyltransferase

64

225

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
2uyo-assembly1.cif.gz_A crystal structure of ml2640c from mycobacterium leprae in an hexagonal crystal form 0.7316 17 279
6id6-assembly1.cif.gz_A crystal structure of rv0731c from mycobacterium tuberculosis at 1.63 angstroms. 0.7072 13 279
2uyo-assembly1.cif.gz_A crystal structure of ml2640c from mycobacterium leprae in an hexagonal crystal form 0.7003 17 279
3p71-assembly1.cif.gz_T crystal structure of the complex of lcmt-1 and pp2a 0.6858 12 279
1rjd-assembly1.cif.gz_A structure of ppm1, a leucine carboxy methyltransferase involved in the regulation of protein phosphatase 2a activity 0.6798 12 279
ID Description Score Start End Superfamily
af_O06551_7_232_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9812 7 234 3.40.50.150
af_O06551_7_232_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9769 7 234 3.40.50.150
af_Q2FWN7_4_222_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8823 19 205 3.40.50.150
af_Q2FWN7_4_222_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.7564 19 205 3.40.50.150
af_Q6AVK7_405_596_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.7503 63 192 3.40.50.150
ID Description Score Start End GO Terms
AF-A1TDU3-F1-model_v4 O-methyltransferase domain protein 0.9875 5 279 GO:0008168
GO:0032259
AF-A0A5C7YBF9-F1-model_v4 Class I SAM-dependent methyltransferase 0.9841 7 131 GO:0008168
GO:0032259
AF-A0A810KPX2-F1-model_v4 deleted 0.9797 123 279
AF-G8RK85-F1-model_v4 O-methyltransferase involved in polyketide biosynthesis 0.9783 19 249 GO:0008168
GO:0032259
AF-A0A2S8M319-F1-model_v4 deleted 0.9754 5 140

Feature Viewer

pLDDT pTM Quality
92 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map