metagRoot

F466764

General Info

Members	Datasets	Scaffolds	Average Seq Length
588	254	588	144

Family's Representative Sequence

Representative Sequence	3300009147\|Ga0114129_11153090\|Ga0114129_111530902
Length	160
Sequence	LLRAKDLVDARYREPLDVPALARAAHLSAAHFSREFRRAFGETPHHYLLTRRLERAAALLRNTDRTVADICLAVGLRSVGSFTTSFGRAFGLSPAAYRAAHPPAVTHVRIPACLLVAWGRPRSGVGPRVSGEPKERTRRSAGNREFQSSSFREDERAPSD

Samples

	Sample ID	Description	Type	Environment
1	3300002077	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3	Metagenome	Rhizosphere
2	3300003373	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1	Metagenome	Rhizosphere
3	3300005327	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG	Metagenome	Rhizosphere
4	3300005329	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG	Metagenome	Rhizosphere
5	3300005330	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG	Metagenome	Rhizosphere
6	3300005334	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2	Metagenome	Rhizosphere
7	3300005336	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG	Metagenome	Rhizosphere
8	3300005339	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG	Metagenome	Rhizosphere
9	3300005340	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG	Metagenome	Rhizosphere
10	3300005344	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG	Metagenome	Rhizosphere
11	3300005347	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG	Metagenome	Rhizosphere
12	3300005353	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG	Metagenome	Rhizosphere
13	3300005356	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG	Metagenome	Rhizosphere
14	3300005364	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG	Metagenome	Rhizosphere
15	3300005366	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG	Metagenome	Rhizosphere
16	3300005434	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG	Metagenome	Rhizosphere
17	3300005436	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG	Metagenome	Rhizosphere
18	3300005437	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG	Metagenome	Rhizosphere
19	3300005438	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG	Metagenome	Rhizosphere
20	3300005440	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG	Metagenome	Rhizosphere
21	3300005441	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG	Metagenome	Rhizosphere
22	3300005445	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG	Metagenome	Rhizosphere
23	3300005458	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG	Metagenome	Rhizosphere
24	3300005459	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2	Metagenome	Rhizosphere
25	3300005466	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG	Metagenome	Rhizosphere
26	3300005467	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG	Metagenome	Rhizosphere
27	3300005468	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG	Metagenome	Rhizosphere
28	3300005471	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG	Metagenome	Rhizosphere
29	3300005518	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG	Metagenome	Rhizosphere
30	3300005530	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG	Metagenome	Rhizosphere
31	3300005535	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG	Metagenome	Rhizosphere
32	3300005536	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG	Metagenome	Rhizosphere
33	3300005539	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2	Metagenome	Rhizosphere
34	3300005543	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG	Metagenome	Rhizosphere
35	3300005544	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG	Metagenome	Rhizosphere
36	3300005545	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG	Metagenome	Rhizosphere
37	3300005546	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG	Metagenome	Rhizosphere
38	3300005547	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG	Metagenome	Rhizosphere
39	3300005549	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG	Metagenome	Rhizosphere
40	3300005563	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2	Metagenome	Rhizosphere
41	3300005577	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2	Metagenome	Rhizosphere
42	3300005578	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2	Metagenome	Rhizosphere
43	3300005614	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2	Metagenome	Rhizosphere
44	3300005615	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG	Metagenome	Rhizosphere
45	3300005718	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2	Metagenome	Rhizosphere
46	3300005719	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2	Metagenome	Rhizosphere
47	3300005840	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2	Metagenome	Rhizosphere
48	3300005842	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2	Metagenome	Rhizosphere
49	3300005843	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2	Metagenome	Rhizosphere
50	3300005937	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1	Metagenome	Rhizosphere
51	3300005981	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1	Metagenome	Rhizosphere
52	3300005983	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1	Metagenome	Rhizosphere
53	3300006028	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG	Metagenome	Rhizosphere
54	3300006173	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG	Metagenome	Rhizosphere
55	3300006175	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG	Metagenome	Rhizosphere
56	3300006237	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2)	Metagenome	Rhizosphere
57	3300006844	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2	Metagenome	Rhizosphere
58	3300006847	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5	Metagenome	Rhizosphere
59	3300006852	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2	Metagenome	Rhizosphere
60	3300006871	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3	Metagenome	Rhizosphere
61	3300006881	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2	Metagenome	Rhizosphere
62	3300006914	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5	Metagenome	Rhizosphere
63	3300007076	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4	Metagenome	Rhizosphere
64	3300009093	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG	Metagenome	Rhizosphere
65	3300009094	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2)	Metagenome	Rhizosphere
66	3300009098	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG	Metagenome	Rhizosphere
67	3300009147	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2)	Metagenome	Rhizosphere
68	3300009148	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG	Metagenome	Rhizosphere
69	3300009174	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG	Metagenome	Rhizosphere
70	3300009176	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG	Metagenome	Rhizosphere
71	3300009177	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG	Metagenome	Rhizosphere
72	3300009545	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG	Metagenome	Rhizosphere
73	3300009551	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG	Metagenome	Rhizosphere
74	3300009553	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG	Metagenome	Rhizosphere
75	3300010375	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG	Metagenome	Rhizosphere
76	3300011119	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG	Metagenome	Rhizosphere
77	3300012494	Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.yng.030610	Metagenome	Rhizosphere
78	3300013104	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG	Metagenome	Rhizosphere
79	3300013105	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG	Metagenome	Rhizosphere
80	3300013296	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG	Metagenome	Rhizosphere
81	3300013297	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG	Metagenome	Rhizosphere
82	3300013306	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG	Metagenome	Rhizosphere
83	3300013307	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG	Metagenome	Rhizosphere
84	3300013308	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG	Metagenome	Rhizosphere
85	3300014325	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG	Metagenome	Rhizosphere
86	3300014326	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG	Metagenome	Rhizosphere
87	3300014497	Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG	Metagenome	Rhizosphere
88	3300014969	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG	Metagenome	Rhizosphere
89	3300020069	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2)	Metatranscriptome	Rhizosphere
90	3300020070	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2)	Metatranscriptome	Rhizosphere
91	3300020082	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2)	Metatranscriptome	Rhizosphere
92	3300025899	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
93	3300025906	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
94	3300025908	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
95	3300025909	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
96	3300025910	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
97	3300025911	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
98	3300025912	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
99	3300025913	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
100	3300025914	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
101	3300025915	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
102	3300025916	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
103	3300025917	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
104	3300025919	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
105	3300025921	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
106	3300025922	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
107	3300025923	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
108	3300025927	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
109	3300025928	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
110	3300025929	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
111	3300025932	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
112	3300025933	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
113	3300025934	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
114	3300025935	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
115	3300025937	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
116	3300025938	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
117	3300025939	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
118	3300025940	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
119	3300025941	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
120	3300025944	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
121	3300025949	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
122	3300025961	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
123	3300025972	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
124	3300025981	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
125	3300026023	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
126	3300026035	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
127	3300026041	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
128	3300026075	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
129	3300026078	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
130	3300026088	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
131	3300026089	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
132	3300026116	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
133	3300026118	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
134	3300026121	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
135	3300026142	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
136	3300027907	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3)	Metagenome	Rhizosphere
137	3300028379	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
138	3300031665	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3	Metagenome	Rhizosphere
139	3300031691	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA	Metagenome	Rhizosphere
140	3300031727	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5	Metagenome	Rhizosphere
141	3300031728	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC	Metagenome	Rhizosphere
142	3300031733	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1	Metagenome	Rhizosphere
143	3300031824	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2	Metagenome	Rhizosphere
144	3300031852	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3	Metagenome	Rhizosphere
145	3300031901	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2	Metagenome	Rhizosphere
146	3300031903	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1	Metagenome	Rhizosphere
147	3300032002	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3	Metagenome	Rhizosphere
148	3300032126	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2	Metagenome	Rhizosphere
149	3300032137	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC	Metagenome	Rhizosphere
150	3300035114	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3	Metagenome	Rhizosphere
151	3300035171	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4	Metagenome	Rhizosphere
152	3300035398	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1	Metagenome	Rhizosphere
153	3300035691	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4	Metagenome	Rhizosphere
154	3300036647	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA	Metagenome	Rhizosphere
155	3300036712	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA	Metagenome	Rhizosphere
156	3300037312	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2	Metagenome	Rhizosphere
157	3300037418	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3	Metagenome	Rhizosphere
158	3300037466	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1	Metagenome	Rhizosphere
159	3300037471	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11	Metagenome	Rhizosphere
160	3300038443	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4	Metagenome	Rhizosphere
161	3300041498	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG	Metagenome	Unclassified
162	3300041512	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG	Metagenome	Unclassified
163	3300042005	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216	Metagenome	Rhizosphere
164	3300042137	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519	Metagenome	Rhizosphere
165	3300042157	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210	Metagenome	Rhizosphere
166	3300044706	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R	Metagenome	Rhizosphere
167	3300045051	Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED	Metagenome	Rhizosphere
168	3300045836	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R	Metagenome	Rhizosphere
169	3300045976	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R	Metagenome	Rhizosphere
170	3300046455	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere	Metagenome	Rhizosphere
171	3300046459	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere	Metagenome	Rhizosphere
172	3300046461	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere	Metagenome	Rhizosphere
173	3300046491	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere	Metagenome	Rhizosphere
174	3300046492	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere	Metagenome	Rhizosphere
175	3300046501	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere	Metagenome	Rhizosphere
176	3300046517	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere	Metagenome	Rhizosphere
177	3300046523	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere	Metagenome	Rhizosphere
178	3300046525	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere	Metagenome	Rhizosphere
179	3300046533	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere	Metagenome	Rhizosphere
180	3300046538	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere	Metagenome	Rhizosphere
181	3300046539	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere	Metagenome	Rhizosphere
182	3300046615	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere	Metagenome	Rhizosphere
183	3300046616	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere	Metagenome	Rhizosphere
184	3300046642	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere	Metagenome	Rhizosphere
185	3300046664	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere	Metagenome	Rhizosphere
186	3300046674	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere	Metagenome	Rhizosphere
187	3300046678	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere	Metagenome	Rhizosphere
188	3300046683	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere	Metagenome	Rhizosphere
189	3300046689	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere	Metagenome	Rhizosphere
190	3300046691	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere	Metagenome	Rhizosphere
191	3300047317	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere	Metagenome	Rhizosphere
192	3300047318	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere	Metagenome	Rhizosphere
193	3300047319	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere	Metagenome	Rhizosphere
194	3300047471	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere	Metagenome	Rhizosphere
195	3300048903	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled	Metagenome	Rhizoplane
196	3300048904	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled	Metagenome	Rhizoplane
197	3300048905	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15	Metagenome	Rhizoplane
198	3300048906	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15	Metagenome	Rhizoplane
199	3300048907	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15	Metagenome	Rhizoplane
200	3300048908	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15	Metagenome	Rhizoplane
201	3300048909	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15	Metagenome	Rhizoplane
202	3300048910	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15	Metagenome	Rhizoplane
203	3300048911	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled	Metagenome	Rhizoplane
204	3300048912	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled	Metagenome	Rhizoplane
205	3300048913	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15	Metagenome	Rhizoplane
206	3300048914	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15	Metagenome	Rhizoplane
207	3300048915	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15	Metagenome	Rhizoplane
208	3300048916	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15	Metagenome	Rhizoplane
209	3300048917	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15	Metagenome	Rhizoplane
210	3300048918	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15	Metagenome	Rhizoplane
211	3300048929	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15	Metagenome	Unclassified
212	3300049568	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01	Metagenome	Rhizosphere
213	3300049569	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02	Metagenome	Rhizosphere
214	3300049570	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03	Metagenome	Rhizosphere
215	3300049571	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01	Metagenome	Rhizosphere
216	3300049572	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03	Metagenome	Rhizosphere
217	3300049573	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01	Metagenome	Rhizosphere
218	3300049574	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02	Metagenome	Rhizosphere
219	3300049575	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03	Metagenome	Rhizosphere
220	3300049576	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01	Metagenome	Rhizosphere
221	3300049577	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02	Metagenome	Rhizosphere
222	3300049578	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03	Metagenome	Rhizosphere
223	3300049579	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01	Metagenome	Rhizosphere
224	3300049580	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01	Metagenome	Rhizosphere
225	3300049581	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02	Metagenome	Rhizosphere
226	3300049582	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03	Metagenome	Rhizosphere
227	3300049583	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01	Metagenome	Rhizosphere
228	3300049584	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02	Metagenome	Rhizosphere
229	3300049585	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03	Metagenome	Rhizosphere
230	3300049586	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01	Metagenome	Rhizosphere
231	3300049587	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02	Metagenome	Rhizosphere
232	3300049588	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03	Metagenome	Rhizosphere
233	3300049589	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01	Metagenome	Rhizosphere
234	3300049590	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02	Metagenome	Rhizosphere
235	3300049591	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03	Metagenome	Rhizosphere
236	3300049592	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01	Metagenome	Rhizosphere
237	3300049593	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02	Metagenome	Rhizosphere
238	3300049741	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01	Metagenome	Rhizosphere
239	3300049742	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02	Metagenome	Rhizosphere
240	3300049743	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03	Metagenome	Rhizosphere
241	3300049744	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02	Metagenome	Rhizosphere
242	3300049822	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02	Metagenome	Rhizosphere
243	3300049823	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02	Metagenome	Rhizosphere
244	3300049824	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03	Metagenome	Rhizosphere
245	3300050507	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation	Metagenome	Rhizosphere
246	3300050511	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation	Metagenome	Rhizosphere
247	3300050512	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation	Metagenome	Rhizosphere
248	3300050513	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation	Metagenome	Rhizosphere
249	3300050514	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation	Metagenome	Rhizosphere
250	3300050515	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation	Metagenome	Rhizosphere
251	3300054114	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03	Metagenome	Rhizosphere
252	3300059426	Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810	Metagenome	Rhizosphere
253	3300060353	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01	Metagenome	Rhizosphere
254	3300061734	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2)	Metagenome	Rhizosphere

Type Distribution

Type	Percentage (%)
Metagenomes	99.32
Metatranscriptomes	0.68
Isolates	0

Biome Distribution

Category	Percentage (%)
Aerial Root	0
Bulb	0
Endosphere	0
Nodule	0
Rhizoplane	15.65
Rhizosphere	83.84
Stem	0
Stem Tuber	0
Unclassified	0.51

Taxonomy

Scaffolds

	Scaffold	Dataset	Taxonomy	Length
1	JGI24744J21845_10031979	3300002077	Bacteria	1004
2	JGI25407J50210_10001551	3300003373	Bacteria	5231
3	Ga0070658_10101414	3300005327	Bacteria	2380
4	Ga0070658_10323059	3300005327	Bacteria	1318
5	Ga0070683_100351532	3300005329	Bacteria	1404
6	Ga0070690_101531917	3300005330	Bacteria	539
7	Ga0068869_100667398	3300005334	Bacteria	884
8	Ga0070680_100155581	3300005336	Bacteria	1920
9	Ga0070680_100438660	3300005336	Unclassified	1115
10	Ga0070680_101179467	3300005336	Bacteria	662
11	Ga0070660_100026712	3300005339	Bacteria	4302
12	Ga0070660_100157440	3300005339	Bacteria	1829
13	Ga0070660_100616365	3300005339	Unclassified	908
14	Ga0070689_100832344	3300005340	Bacteria	813
15	Ga0070661_100192737	3300005344	Bacteria	1555
16	Ga0070668_100349386	3300005347	Bacteria	1251
17	Ga0070669_100654201	3300005353	Bacteria	884
18	Ga0070674_100171373	3300005356	Bacteria	1655
19	Ga0070673_101552646	3300005364	Unclassified	625
20	Ga0070659_100391594	3300005366	Bacteria	1172
21	Ga0070709_10526246	3300005434	Bacteria	902
22	Ga0070709_10565556	3300005434	Bacteria	872
23	Ga0070713_100063324	3300005436	Bacteria	3100
24	Ga0070713_100654305	3300005436	Unclassified	1001
25	Ga0070710_10065946	3300005437	Bacteria	2075
26	Ga0070701_10115900	3300005438	Bacteria	1503
27	Ga0070701_10434825	3300005438	Bacteria	839
28	Ga0070705_100006228	3300005440	Bacteria	5842
29	Ga0070705_100132005	3300005440	Bacteria	1631
30	Ga0070700_100231624	3300005441	Bacteria	1315
31	Ga0070708_100040693	3300005445	Bacteria	4071
32	Ga0070708_100122751	3300005445	Bacteria	2398
33	Ga0070681_10017927	3300005458	Bacteria	7077
34	Ga0070681_10043215	3300005458	Bacteria	4515
35	Ga0070681_10208563	3300005458	Bacteria	1870
36	Ga0068867_100862948	3300005459	Bacteria	812
37	Ga0070685_10472125	3300005466	Bacteria	883
38	Ga0070706_100292186	3300005467	Bacteria	1521
39	Ga0070706_101616939	3300005467	Bacteria	591
40	Ga0070707_100004044	3300005468	Bacteria	13790
41	Ga0070707_100020070	3300005468	Bacteria	6302
42	Ga0070707_100172959	3300005468	Bacteria	2105
43	Ga0070698_100076954	3300005471	Unclassified	3337
44	Ga0070698_100121382	3300005471	Bacteria	2573
45	Ga0070698_100758200	3300005471	Bacteria	914
46	Ga0070699_100112867	3300005518	Bacteria	2387
47	Ga0070699_100153052	3300005518	Bacteria	2040
48	Ga0070699_101570705	3300005518	Bacteria	603
49	Ga0070679_100004218	3300005530	Bacteria	13262
50	Ga0070679_100089785	3300005530	Bacteria	3060
51	Ga0070679_100163103	3300005530	Bacteria	2202
52	Ga0070679_100499841	3300005530	Unclassified	1160
53	Ga0070679_101077275	3300005530	Bacteria	748
54	Ga0070684_100024211	3300005535	Bacteria	5090
55	Ga0070684_100366669	3300005535	Unclassified	1326
56	Ga0070684_100598990	3300005535	Bacteria	1025
57	Ga0070697_100045689	3300005536	Bacteria	3550
58	Ga0070697_100248456	3300005536	Bacteria	1521
59	Ga0068853_100112857	3300005539	Bacteria	2416
60	Ga0070672_100280728	3300005543	Bacteria	1408
61	Ga0070686_100434470	3300005544	Bacteria	1006
62	Ga0070695_100066131	3300005545	Bacteria	2356
63	Ga0070695_101363822	3300005545	Bacteria	587
64	Ga0070696_100051204	3300005546	Bacteria	2871
65	Ga0070696_100360158	3300005546	Bacteria	1129
66	Ga0070696_100407040	3300005546	Bacteria	1066
67	Ga0070693_100062472	3300005547	Bacteria	2168
68	Ga0070693_100135875	3300005547	Bacteria	1542
69	Ga0070704_101210016	3300005549	Bacteria	689
70	Ga0068855_100028863	3300005563	Bacteria	6637
71	Ga0068855_100560094	3300005563	Unclassified	1236
72	Ga0068857_100445189	3300005577	Bacteria	1210
73	Ga0068854_100171028	3300005578	Bacteria	1691
74	Ga0068856_100117842	3300005614	Bacteria	2656
75	Ga0070702_100346339	3300005615	Bacteria	1045
76	Ga0070702_100509152	3300005615	Bacteria	886
77	Ga0070702_100939310	3300005615	Unclassified	680
78	Ga0068866_10070370	3300005718	Bacteria	1847
79	Ga0068861_100206101	3300005719	Bacteria	1654
80	Ga0068870_10143741	3300005840	Bacteria	1398
81	Ga0068858_100234515	3300005842	Bacteria	1740
82	Ga0068860_100216212	3300005843	Bacteria	1860
83	Ga0081455_10038352	3300005937	Bacteria	4243
84	Ga0081455_10041668	3300005937	Bacteria	4035
85	Ga0081455_10470710	3300005937	Unclassified	853
86	Ga0081538_10012842	3300005981	Bacteria	6685
87	Ga0081540_1004870	3300005983	Bacteria	10113
88	Ga0070717_10040173	3300006028	Bacteria	3810
89	Ga0070717_10166705	3300006028	Bacteria	1913
90	Ga0070716_100020050	3300006173	Bacteria	3505
91	Ga0070716_101494216	3300006173	Bacteria	552
92	Ga0070712_100006134	3300006175	Bacteria	7436
93	Ga0070712_100042267	3300006175	Bacteria	3134
94	Ga0070712_100727960	3300006175	Bacteria	847
95	Ga0097621_100491826	3300006237	Bacteria	1110
96	Ga0075428_102374116	3300006844	Bacteria	545
97	Ga0075431_101340736	3300006847	Bacteria	676
98	Ga0075433_10236886	3300006852	Bacteria	1621
99	Ga0075434_100021464	3300006871	Bacteria	6275
100	Ga0075434_100069864	3300006871	Bacteria	3502
101	Ga0068865_100253902	3300006881	Bacteria	1389
102	Ga0068865_100970131	3300006881	Bacteria	743
103	Ga0075436_100128256	3300006914	Bacteria	1778
104	Ga0075436_100930806	3300006914	Bacteria	651
105	Ga0075435_100032294	3300007076	Bacteria	4133
106	Ga0075435_100399722	3300007076	Bacteria	1182
107	Ga0105240_10013548	3300009093	Bacteria	11191
108	Ga0111539_10092531	3300009094	Bacteria	3553
109	Ga0105245_10182663	3300009098	Bacteria	2005
110	Ga0105245_10806577	3300009098	Bacteria	977
111	Ga0105245_10970812	3300009098	Bacteria	893
112	Ga0114129_10273467	3300009147	Bacteria	2259
113	Ga0114129_10349364	3300009147	Bacteria	1960
114	Ga0114129_11153090	3300009147	Bacteria	968
115	Ga0114129_11576079	3300009147	Bacteria	805
116	Ga0105243_10284770	3300009148	Bacteria	1490
117	Ga0105243_10607725	3300009148	Bacteria	1054
118	Ga0105243_10934878	3300009148	Bacteria	865
119	Ga0105243_11399151	3300009148	Unclassified	720
120	Ga0105241_10916417	3300009174	Bacteria	815
121	Ga0105241_12501718	3300009174	Unclassified	517
122	Ga0105242_10177124	3300009176	Bacteria	1878
123	Ga0105242_10472457	3300009176	Bacteria	1187
124	Ga0105242_10593081	3300009176	Bacteria	1069
125	Ga0105242_10859889	3300009176	Bacteria	903
126	Ga0105242_12183027	3300009176	Bacteria	599
127	Ga0105248_10080058	3300009177	Bacteria	3671
128	Ga0105248_10538156	3300009177	Bacteria	1317
129	Ga0105248_12274585	3300009177	Unclassified	617
130	Ga0105237_10377236	3300009545	Bacteria	1423
131	Ga0105238_10439362	3300009551	Bacteria	1301
132	Ga0105238_12221387	3300009551	Unclassified	583
133	Ga0105249_10200077	3300009553	Bacteria	1955
134	Ga0105249_10968282	3300009553	Bacteria	919
135	Ga0105239_10182190	3300010375	Bacteria	2350
136	Ga0105239_10293154	3300010375	Bacteria	1832
137	Ga0105239_10319917	3300010375	Bacteria	1749
138	Ga0105239_10389956	3300010375	Bacteria	1575
139	Ga0105239_11800563	3300010375	Bacteria	709
140	Ga0105246_10473408	3300011119	Unclassified	1058
141	Ga0105246_10561953	3300011119	Bacteria	979
142	Ga0157341_1035212	3300012494	Bacteria	558
143	Ga0157370_10191549	3300013104	Bacteria	1898
144	Ga0157370_10422798	3300013104	Bacteria	1226
145	Ga0157369_10015785	3300013105	Bacteria	8510
146	Ga0157369_10600651	3300013105	Bacteria	1136
147	Ga0157374_10396188	3300013296	Bacteria	1377
148	Ga0157374_12124185	3300013296	Unclassified	588
149	Ga0157378_10158575	3300013297	Bacteria	2114
150	Ga0157378_11436600	3300013297	Unclassified	733
151	Ga0163162_10894082	3300013306	Bacteria	1002
152	Ga0163162_13183133	3300013306	Bacteria	527
153	Ga0157372_10453299	3300013307	Bacteria	1495
154	Ga0157372_10894454	3300013307	Unclassified	1030
155	Ga0157375_10032018	3300013308	Bacteria	4983
156	Ga0157375_10228589	3300013308	Bacteria	2019
157	Ga0157375_10244252	3300013308	Bacteria	1955
158	Ga0157375_10250081	3300013308	Bacteria	1933
159	Ga0157375_11582726	3300013308	Bacteria	774
160	Ga0157375_12279799	3300013308	Bacteria	645
161	Ga0163163_10293856	3300014325	Bacteria	1677
162	Ga0163163_11257229	3300014325	Unclassified	803
163	Ga0157380_11097869	3300014326	Unclassified	834
164	Ga0182008_10209559	3300014497	Bacteria	994
165	Ga0157376_10401493	3300014969	Bacteria	1326
166	Ga0157376_10695275	3300014969	Bacteria	1021
167	Ga0197907_11132538	3300020069	Unclassified	980
168	Ga0206356_10765740	3300020070	Bacteria	4229
169	Ga0206356_11069274	3300020070	Bacteria	1088
170	Ga0206353_10757095	3300020082	Bacteria	1673
171	Ga0207642_10177140	3300025899	Bacteria	1159
172	Ga0207642_10566617	3300025899	Bacteria	703
173	Ga0207699_10014854	3300025906	Bacteria	4030
174	Ga0207699_10151719	3300025906	Bacteria	1534
175	Ga0207643_10071287	3300025908	Bacteria	2000
176	Ga0207705_10077440	3300025909	Bacteria	2419
177	Ga0207705_10178426	3300025909	Bacteria	1602
178	Ga0207684_10366114	3300025910	Bacteria	1240
179	Ga0207654_10208493	3300025911	Bacteria	1290
180	Ga0207707_10049232	3300025912	Bacteria	3671
181	Ga0207707_10050465	3300025912	Bacteria	3624
182	Ga0207695_10010135	3300025913	Bacteria	11564
183	Ga0207671_10067103	3300025914	Bacteria	2671
184	Ga0207693_10009379	3300025915	Bacteria	7982
185	Ga0207693_10053990	3300025915	Bacteria	3153
186	Ga0207663_10037430	3300025916	Bacteria	2925
187	Ga0207663_11168927	3300025916	Bacteria	619
188	Ga0207660_10013230	3300025917	Bacteria	5404
189	Ga0207660_10096041	3300025917	Bacteria	2206
190	Ga0207657_10169114	3300025919	Bacteria	1772
191	Ga0207657_10188555	3300025919	Bacteria	1665
192	Ga0207652_10041495	3300025921	Bacteria	3912
193	Ga0207652_10258960	3300025921	Bacteria	1569
194	Ga0207652_10394473	3300025921	Bacteria	1249
195	Ga0207652_10645392	3300025921	Bacteria	947
196	Ga0207646_10006249	3300025922	Bacteria	12363
197	Ga0207646_10026800	3300025922	Bacteria	5257
198	Ga0207646_10194152	3300025922	Bacteria	1833
199	Ga0207681_10277808	3300025923	Bacteria	1318
200	Ga0207687_10372389	3300025927	Bacteria	1168
201	Ga0207700_10000002	3300025928	Bacteria	775978
202	Ga0207700_10289991	3300025928	Bacteria	1410
203	Ga0207664_10078950	3300025929	Bacteria	2670
204	Ga0207690_10598866	3300025932	Bacteria	899
205	Ga0207706_10364196	3300025933	Bacteria	1256
206	Ga0207686_10172231	3300025934	Bacteria	1528
207	Ga0207686_10357783	3300025934	Bacteria	1101
208	Ga0207686_10952458	3300025934	Bacteria	695
209	Ga0207709_10088511	3300025935	Bacteria	2016
210	Ga0207709_10122200	3300025935	Bacteria	1760
211	Ga0207709_10145533	3300025935	Bacteria	1634
212	Ga0207669_10465848	3300025937	Bacteria	1004
213	Ga0207669_10970748	3300025937	Unclassified	713
214	Ga0207704_10187837	3300025938	Bacteria	1500
215	Ga0207704_10634451	3300025938	Bacteria	878
216	Ga0207665_10337606	3300025939	Bacteria	1135
217	Ga0207691_10128356	3300025940	Bacteria	2241
218	Ga0207711_10444892	3300025941	Bacteria	1206
219	Ga0207661_10291534	3300025944	Bacteria	1460
220	Ga0207667_10026536	3300025949	Bacteria	6325
221	Ga0207667_10384260	3300025949	Bacteria	1430
222	Ga0207712_10017831	3300025961	Bacteria	4617
223	Ga0207668_10236452	3300025972	Bacteria	1476
224	Ga0207640_10257409	3300025981	Bacteria	1358
225	Ga0207640_11191528	3300025981	Bacteria	677
226	Ga0207677_11148619	3300026023	Unclassified	709
227	Ga0207677_11518478	3300026023	Bacteria	619
228	Ga0207703_10219000	3300026035	Bacteria	1701
229	Ga0207639_10050505	3300026041	Bacteria	3158
230	Ga0207708_10237060	3300026075	Bacteria	1466
231	Ga0207708_10687811	3300026075	Bacteria	873
232	Ga0207702_10090866	3300026078	Bacteria	2672
233	Ga0207641_10408558	3300026088	Bacteria	1305
234	Ga0207648_10085571	3300026089	Bacteria	2750
235	Ga0207648_11830462	3300026089	Bacteria	569
236	Ga0207674_10627774	3300026116	Bacteria	1038
237	Ga0207675_100333922	3300026118	Bacteria	1482
238	Ga0207683_10008984	3300026121	Bacteria	8513
239	Ga0207683_10036224	3300026121	Bacteria	4295
240	Ga0207683_11589397	3300026121	Unclassified	603
241	Ga0207698_10721071	3300026142	Bacteria	994
242	Ga0207428_10396905	3300027907	Bacteria	1010
243	Ga0268266_10414582	3300028379	Bacteria	1276
244	Ga0268266_10545191	3300028379	Bacteria	1111
245	Ga0316575_10039497	3300031665	Bacteria	1863
246	Ga0316579_10034002	3300031691	Bacteria	2343
247	Ga0316576_10555873	3300031727	Unclassified	840
248	Ga0316578_10045634	3300031728	Bacteria	2551
249	Ga0316577_10011008	3300031733	Bacteria	4893
250	Ga0307413_10136053	3300031824	Bacteria	1690
251	Ga0307410_10046296	3300031852	Bacteria	2901
252	Ga0307406_11711322	3300031901	Bacteria	557
253	Ga0307407_10035570	3300031903	Bacteria	2737
254	Ga0307416_100053935	3300032002	Bacteria	3229
255	Ga0307416_100348920	3300032002	Bacteria	1497
256	Ga0307416_100476010	3300032002	Bacteria	1308
257	Ga0307415_100562272	3300032126	Bacteria	1008
258	Ga0307415_101124634	3300032126	Bacteria	736
259	Ga0316585_10033830	3300032137	Bacteria	1613
260	Ga0373939_0187593	3300035114	Bacteria	775
261	Ga0373946_0448556	3300035171	Bacteria	657
262	Ga0316574_0031022	3300035398	Bacteria	3240
263	Ga0373931_0188709	3300035691	Bacteria	1225
264	Ga0373931_0615669	3300035691	Bacteria	711
265	Ga0316582_0001763	3300036647	Bacteria	9750
266	Ga0316584_0003336	3300036712	Bacteria	10405
267	Ga0395899_0005040	3300037312	Bacteria	10274
268	Ga0395899_0005078	3300037312	Bacteria	10241
269	Ga0395899_0016760	3300037312	Bacteria	5587
270	Ga0395899_0022740	3300037312	Bacteria	4750
271	Ga0395899_0024162	3300037312	Bacteria	4597
272	Ga0395899_0038109	3300037312	Bacteria	3602
273	Ga0395899_0181585	3300037312	Bacteria	1477
274	Ga0395900_0002302	3300037418	Bacteria	21216
275	Ga0395900_0005938	3300037418	Bacteria	12745
276	Ga0395900_0005954	3300037418	Bacteria	12731
277	Ga0395900_0019484	3300037418	Bacteria	6917
278	Ga0395900_0020752	3300037418	Bacteria	6715
279	Ga0395900_0046517	3300037418	Bacteria	4468
280	Ga0395900_0063359	3300037418	Bacteria	3800
281	Ga0395900_0083864	3300037418	Bacteria	3274
282	Ga0395900_0110784	3300037418	Bacteria	2820
283	Ga0395900_0161948	3300037418	Bacteria	2281
284	Ga0395900_0229450	3300037418	Bacteria	1868
285	Ga0395900_0279948	3300037418	Bacteria	1660
286	Ga0395900_0308709	3300037418	Unclassified	1565
287	Ga0395900_0365091	3300037418	Unclassified	1414
288	Ga0395900_0421225	3300037418	Bacteria	1296
289	Ga0395900_1134239	3300037418	Unclassified	698
290	Ga0395900_1289705	3300037418	Bacteria	644
291	Ga0395898_0000723	3300037466	Bacteria	58117
292	Ga0395898_0082668	3300037466	Bacteria	3095
293	Ga0395898_0138716	3300037466	Bacteria	2328
294	Ga0395898_0150696	3300037466	Bacteria	2225
295	Ga0395898_0185761	3300037466	Unclassified	1986
296	Ga0395898_0375778	3300037466	Bacteria	1355
297	Ga0395898_0398336	3300037466	Bacteria	1312
298	Ga0395898_0497025	3300037466	Bacteria	1160
299	Ga0395898_1257488	3300037466	Bacteria	670
300	Ga0395898_1618189	3300037466	Bacteria	572
301	Ga0395905_0002667	3300037471	Bacteria	19578
302	Ga0395905_0017677	3300037471	Bacteria	6769
303	Ga0395905_0052268	3300037471	Unclassified	3825
304	Ga0395905_0096177	3300037471	Bacteria	2780
305	Ga0395905_0105699	3300037471	Bacteria	2643
306	Ga0395905_0107418	3300037471	Bacteria	2620
307	Ga0395905_0107479	3300037471	Archaea	2619
308	Ga0395905_0126536	3300037471	Bacteria	2403
309	Ga0395905_0143028	3300037471	Bacteria	2250
310	Ga0395905_0146092	3300037471	Bacteria	2225
311	Ga0395905_1152868	3300037471	Unclassified	678
312	Ga0395905_1299699	3300037471	Bacteria	631
313	Ga0395905_1465317	3300037471	Unclassified	587
314	Ga0395901_0002832	3300038443	Bacteria	17516
315	Ga0395901_0002996	3300038443	Bacteria	17032
316	Ga0395901_0006687	3300038443	Bacteria	11654
317	Ga0395901_0006880	3300038443	Bacteria	11486
318	Ga0395901_0007011	3300038443	Bacteria	11388
319	Ga0395901_0009606	3300038443	Bacteria	9813
320	Ga0395901_0010946	3300038443	Bacteria	9190
321	Ga0395901_0014113	3300038443	Bacteria	8133
322	Ga0395901_0062804	3300038443	Bacteria	3865
323	Ga0395901_0083377	3300038443	Bacteria	3341
324	Ga0395901_0091333	3300038443	Bacteria	3187
325	Ga0395901_0201460	3300038443	Bacteria	2086
326	Ga0395901_0803298	3300038443	Bacteria	929
327	Ga0395901_0960720	3300038443	Bacteria	833
328	Ga0395901_0965229	3300038443	Bacteria	830
329	Ga0395901_1739659	3300038443	Bacteria	574
330	Ga0451841_0358761	3300041498	Bacteria	543
331	Ga0451853_2334412	3300041512	Unclassified	1313
332	Ga0439448_0344557	3300042005	Bacteria	531
333	Ga0450902_054345	3300042137	Bacteria	689
334	Ga0439458_0030130	3300042157	Bacteria	1290
335	Ga0466964_0260000	3300044706	Bacteria	859
336	Ga0451576_0141230	3300045051	Bacteria	2511
337	Ga0451576_0929275	3300045051	Bacteria	912
338	Ga0466958_0581741	3300045836	Bacteria	728
339	Ga0466967_0002827	3300045976	Bacteria	11011
340	Ga0466967_0024713	3300045976	Bacteria	4944
341	Ga0466967_2435112	3300045976	Bacteria	519
342	Ga0495603_0020753	3300046455	Bacteria	3978
343	Ga0495629_0480625	3300046459	Bacteria	839
344	Ga0495641_0137291	3300046461	Bacteria	1092
345	Ga0495584_0032942	3300046491	Bacteria	2621
346	Ga0495584_0694903	3300046491	Bacteria	519
347	Ga0495585_0181764	3300046492	Bacteria	1081
348	Ga0495607_0178906	3300046501	Bacteria	1065
349	Ga0495630_0066675	3300046517	Bacteria	2706
350	Ga0495644_0065249	3300046523	Bacteria	1368
351	Ga0495644_0298550	3300046523	Bacteria	630
352	Ga0495663_0109594	3300046525	Bacteria	916
353	Ga0495640_0968126	3300046533	Bacteria	502
354	Ga0495609_0086555	3300046538	Bacteria	1366
355	Ga0495621_0334529	3300046539	Bacteria	633
356	Ga0495656_0036766	3300046615	Bacteria	2019
357	Ga0495656_0142669	3300046615	Bacteria	1150
358	Ga0495656_0203095	3300046615	Bacteria	984
359	Ga0495668_0155186	3300046616	Bacteria	1254
360	Ga0495634_0314098	3300046642	Bacteria	945
361	Ga0495659_0114789	3300046664	Unclassified	1055
362	Ga0495588_0068145	3300046674	Bacteria	1848
363	Ga0495588_0101504	3300046674	Bacteria	1512
364	Ga0495599_0272248	3300046678	Bacteria	1027
365	Ga0495658_0460824	3300046683	Bacteria	812
366	Ga0495613_0116364	3300046689	Bacteria	1923
367	Ga0495613_0521227	3300046689	Bacteria	798
368	Ga0495670_0407678	3300046691	Bacteria	735
369	Ga0495604_0087098	3300047317	Bacteria	2327
370	Ga0495636_0683062	3300047318	Unclassified	506
371	Ga0495674_0193811	3300047319	Bacteria	1688
372	Ga0495684_0811237	3300047471	Bacteria	610
373	Ga0496100_0006266	3300048903	Bacteria	6477
374	Ga0496100_0030385	3300048903	Bacteria	3351
375	Ga0496100_0631042	3300048903	Bacteria	833
376	Ga0496101_0038959	3300048904	Bacteria	3377
377	Ga0496101_0066284	3300048904	Bacteria	2633
378	Ga0496101_0086241	3300048904	Bacteria	2328
379	Ga0496101_0258371	3300048904	Bacteria	1358
380	Ga0496101_0261141	3300048904	Bacteria	1351
381	Ga0496101_0445333	3300048904	Bacteria	1022
382	Ga0496101_0648305	3300048904	Unclassified	834
383	Ga0496101_0768712	3300048904	Bacteria	760
384	Ga0496102_0060096	3300048905	Bacteria	3477
385	Ga0496102_0207291	3300048905	Bacteria	1848
386	Ga0496102_0208503	3300048905	Bacteria	1842
387	Ga0496102_0533754	3300048905	Bacteria	1096
388	Ga0496102_0896099	3300048905	Bacteria	809
389	Ga0496102_1060943	3300048905	Unclassified	730
390	Ga0496102_1437857	3300048905	Bacteria	608
391	Ga0496103_0019401	3300048906	Bacteria	4083
392	Ga0496103_0034234	3300048906	Bacteria	3106
393	Ga0496103_0061184	3300048906	Bacteria	2341
394	Ga0496103_0217327	3300048906	Bacteria	1229
395	Ga0496104_0007376	3300048907	Bacteria	9717
396	Ga0496104_0007445	3300048907	Bacteria	9673
397	Ga0496104_0029759	3300048907	Bacteria	5068
398	Ga0496104_0036445	3300048907	Bacteria	4599
399	Ga0496104_0084667	3300048907	Bacteria	3026
400	Ga0496104_0384645	3300048907	Bacteria	1316
401	Ga0496104_0474056	3300048907	Bacteria	1163
402	Ga0496105_0000234	3300048908	Bacteria	37704
403	Ga0496105_0006841	3300048908	Bacteria	8772
404	Ga0496105_0009868	3300048908	Bacteria	7487
405	Ga0496105_0014191	3300048908	Bacteria	6341
406	Ga0496105_0238028	3300048908	Bacteria	1478
407	Ga0496105_0401042	3300048908	Bacteria	1089
408	Ga0496106_0011442	3300048909	Bacteria	6563
409	Ga0496106_0014651	3300048909	Bacteria	5794
410	Ga0496106_0029929	3300048909	Bacteria	4059
411	Ga0496106_0171199	3300048909	Bacteria	1721
412	Ga0496106_0401923	3300048909	Bacteria	1101
413	Ga0496107_0001675	3300048910	Bacteria	13867
414	Ga0496107_0015500	3300048910	Bacteria	5345
415	Ga0496107_0084894	3300048910	Bacteria	2310
416	Ga0496107_0125265	3300048910	Bacteria	1894
417	Ga0496107_0194495	3300048910	Bacteria	1507
418	Ga0496107_0897033	3300048910	Unclassified	646
419	Ga0496108_0000716	3300048911	Bacteria	25781
420	Ga0496108_0024256	3300048911	Bacteria	4994
421	Ga0496108_0025310	3300048911	Bacteria	4890
422	Ga0496108_0090856	3300048911	Bacteria	2595
423	Ga0496108_0095431	3300048911	Bacteria	2532
424	Ga0496108_0508071	3300048911	Bacteria	1052
425	Ga0496109_0004184	3300048912	Bacteria	12038
426	Ga0496109_0005753	3300048912	Bacteria	10371
427	Ga0496109_0014484	3300048912	Bacteria	6860
428	Ga0496109_0045464	3300048912	Bacteria	3985
429	Ga0496109_0110302	3300048912	Bacteria	2558
430	Ga0496109_0125356	3300048912	Bacteria	2394
431	Ga0496109_0671994	3300048912	Bacteria	973
432	Ga0496109_1421188	3300048912	Bacteria	629
433	Ga0496110_0001327	3300048913	Bacteria	17778
434	Ga0496110_0008959	3300048913	Bacteria	8071
435	Ga0496110_0018520	3300048913	Bacteria	5838
436	Ga0496110_0022444	3300048913	Bacteria	5359
437	Ga0496110_0027213	3300048913	Bacteria	4900
438	Ga0496110_0380960	3300048913	Unclassified	1285
439	Ga0496110_0531894	3300048913	Bacteria	1069
440	Ga0496110_0532561	3300048913	Bacteria	1068
441	Ga0496111_0003808	3300048914	Bacteria	9410
442	Ga0496111_0030292	3300048914	Bacteria	3848
443	Ga0496111_0084287	3300048914	Bacteria	2323
444	Ga0496111_0097472	3300048914	Bacteria	2158
445	Ga0496112_0008702	3300048915	Bacteria	9101
446	Ga0496112_0038230	3300048915	Bacteria	4686
447	Ga0496112_0040046	3300048915	Bacteria	4580
448	Ga0496112_0056335	3300048915	Bacteria	3868
449	Ga0496112_0253900	3300048915	Bacteria	1709
450	Ga0496113_0013931	3300048916	Bacteria	5467
451	Ga0496113_0106654	3300048916	Bacteria	2176
452	Ga0496114_0004230	3300048917	Bacteria	11122
453	Ga0496114_0055547	3300048917	Bacteria	3302
454	Ga0496114_0109916	3300048917	Bacteria	2361
455	Ga0496114_0112466	3300048917	Bacteria	2334
456	Ga0496114_0330879	3300048917	Bacteria	1347
457	Ga0496114_0378959	3300048917	Bacteria	1252
458	Ga0496114_0728081	3300048917	Bacteria	868
459	Ga0496114_0856800	3300048917	Unclassified	789
460	Ga0496115_0015824	3300048918	Bacteria	5729
461	Ga0496115_0026196	3300048918	Bacteria	4548
462	Ga0496115_0175312	3300048918	Bacteria	1773
463	Ga0496115_0281799	3300048918	Bacteria	1364
464	Ga0496115_0888560	3300048918	Bacteria	688
465	Ga0496126_0141797	3300048929	Bacteria	2067
466	Ga0501031_0008073	3300049568	Bacteria	6856
467	Ga0501031_0167561	3300049568	Bacteria	1435
468	Ga0501032_0013033	3300049569	Bacteria	5920
469	Ga0501032_0794651	3300049569	Bacteria	598
470	Ga0501033_0024851	3300049570	Bacteria	4517
471	Ga0501033_0980358	3300049570	Bacteria	566
472	Ga0501034_0114797	3300049571	Bacteria	2682
473	Ga0501036_0016771	3300049572	Bacteria	6118
474	Ga0501036_0217273	3300049572	Bacteria	1605
475	Ga0501037_0069642	3300049573	Bacteria	2560
476	Ga0501037_0553026	3300049573	Bacteria	776
477	Ga0501038_0002818	3300049574	Bacteria	16183
478	Ga0501038_0029682	3300049574	Bacteria	4843
479	Ga0501039_0001716	3300049575	Bacteria	16153
480	Ga0501039_0031798	3300049575	Bacteria	4069
481	Ga0501040_0075806	3300049576	Bacteria	2325
482	Ga0501040_0398146	3300049576	Bacteria	989
483	Ga0501041_0005433	3300049577	Bacteria	7463
484	Ga0501041_0156015	3300049577	Bacteria	1426
485	Ga0501041_0184801	3300049577	Bacteria	1305
486	Ga0501042_0007202	3300049578	Bacteria	7278
487	Ga0501042_0017626	3300049578	Bacteria	4929
488	Ga0501042_0075007	3300049578	Bacteria	2420
489	Ga0501042_0093649	3300049578	Bacteria	2157
490	Ga0501043_0015868	3300049579	Bacteria	5904
491	Ga0501043_0179753	3300049579	Bacteria	1648
492	Ga0501043_0451321	3300049579	Bacteria	966
493	Ga0501046_0003476	3300049580	Bacteria	14447
494	Ga0501046_0188973	3300049580	Bacteria	1537
495	Ga0501047_0189313	3300049581	Bacteria	1922
496	Ga0501047_0325434	3300049581	Bacteria	1376
497	Ga0501047_0792678	3300049581	Bacteria	762
498	Ga0501048_0039124	3300049582	Bacteria	3403
499	Ga0501048_0104230	3300049582	Bacteria	2001
500	Ga0501048_0917592	3300049582	Bacteria	630
501	Ga0501067_0010282	3300049583	Bacteria	5177
502	Ga0501067_0047760	3300049583	Bacteria	2374
503	Ga0501067_0051889	3300049583	Bacteria	2272
504	Ga0501067_0064450	3300049583	Bacteria	2029
505	Ga0501067_0254186	3300049583	Bacteria	978
506	Ga0501067_0440927	3300049583	Bacteria	727
507	Ga0501067_0449046	3300049583	Unclassified	720
508	Ga0501068_0012239	3300049584	Bacteria	4854
509	Ga0501068_0301462	3300049584	Bacteria	1026
510	Ga0501068_0435221	3300049584	Bacteria	848
511	Ga0501068_1002196	3300049584	Bacteria	551
512	Ga0501069_0010996	3300049585	Bacteria	4800
513	Ga0501069_0146964	3300049585	Bacteria	1353
514	Ga0501069_0216349	3300049585	Bacteria	1113
515	Ga0501069_0225414	3300049585	Bacteria	1090
516	Ga0501070_0005530	3300049586	Bacteria	10775
517	Ga0501070_0723617	3300049586	Bacteria	786
518	Ga0501071_0061328	3300049587	Bacteria	2723
519	Ga0501071_1108846	3300049587	Bacteria	611
520	Ga0501072_0070036	3300049588	Bacteria	2770
521	Ga0501072_0126825	3300049588	Bacteria	2033
522	Ga0501072_0130663	3300049588	Bacteria	2001
523	Ga0501073_0002648	3300049589	Bacteria	13419
524	Ga0501074_0004068	3300049590	Bacteria	10432
525	Ga0501074_0021111	3300049590	Bacteria	4729
526	Ga0501074_0039891	3300049590	Bacteria	3400
527	Ga0501074_0333051	3300049590	Bacteria	1077
528	Ga0501074_0386919	3300049590	Bacteria	992
529	Ga0501075_0086382	3300049591	Bacteria	2376
530	Ga0501075_0087349	3300049591	Bacteria	2363
531	Ga0501076_0038950	3300049592	Bacteria	3731
532	Ga0501076_0053285	3300049592	Bacteria	3205
533	Ga0501076_0168249	3300049592	Bacteria	1786
534	Ga0501076_0302063	3300049592	Bacteria	1312
535	Ga0501077_0026234	3300049593	Bacteria	3697
536	Ga0501077_0090154	3300049593	Bacteria	1943
537	Ga0501077_0192973	3300049593	Bacteria	1294
538	Ga0501079_0046397	3300049741	Bacteria	3352
539	Ga0501079_0134496	3300049741	Bacteria	1925
540	Ga0501079_0824148	3300049741	Bacteria	731
541	Ga0501080_0004540	3300049742	Bacteria	12375
542	Ga0501080_0052923	3300049742	Bacteria	3779
543	Ga0501080_0091673	3300049742	Bacteria	2822
544	Ga0501080_0315531	3300049742	Bacteria	1416
545	Ga0501080_0349959	3300049742	Bacteria	1334
546	Ga0501081_0033315	3300049743	Bacteria	3500
547	Ga0501081_0059576	3300049743	Bacteria	2644
548	Ga0501081_0092379	3300049743	Bacteria	2129
549	Ga0501081_0114627	3300049743	Bacteria	1915
550	Ga0501083_0002388	3300049744	Bacteria	12862
551	Ga0501083_0353349	3300049744	Bacteria	955
552	Ga0501035_0008221	3300049822	Bacteria	9722
553	Ga0501035_0055346	3300049822	Bacteria	3542
554	Ga0501035_0581489	3300049822	Bacteria	915
555	Ga0501044_1045724	3300049823	Bacteria	687
556	Ga0501045_0010103	3300049824	Bacteria	6605
557	Ga0501045_0024245	3300049824	Bacteria	4354
558	Ga0501045_0093502	3300049824	Bacteria	2224
559	nmdc:mga05p37_402611_c1	3300050507	Bacteria	1598
560	nmdc:mga05p37_718976_c1	3300050507	Bacteria	1106
561	nmdc:mga08y16_313001_c1	3300050511	Bacteria	1617
562	nmdc:mga0n895_123790_c1	3300050512	Bacteria	2608
563	nmdc:mga0n895_1258584_c1	3300050512	Bacteria	712
564	nmdc:mga0n895_1441060_c1	3300050512	Bacteria	656
565	nmdc:mga0n895_16329_c1	3300050512	Bacteria	6809
566	nmdc:mga0n895_275443_c1	3300050512	Bacteria	1706
567	nmdc:mga0rr50_377053_c1	3300050513	Bacteria	1196
568	nmdc:mga0rr50_469690_c1	3300050513	Bacteria	1068
569	nmdc:mga08x19_184774_c1	3300050514	Bacteria	1424
570	nmdc:mga08x19_199438_c1	3300050514	Bacteria	1371
571	nmdc:mga08x19_2634_c1	3300050514	Bacteria	10851
572	nmdc:mga0a205_21902_c2	3300050515	Bacteria	5297
573	nmdc:mga0a205_227926_c1	3300050515	Bacteria	1747
574	nmdc:mga0a205_48974_c1	3300050515	Bacteria	4078
575	Ga0501084_0016991	3300054114	Bacteria	6045
576	Ga0501084_0197038	3300054114	Bacteria	1699
577	Ga0501084_0329946	3300054114	Bacteria	1289
578	Ga0590077_028310	3300059426	Bacteria	1217
579	Ga0501082_0018691	3300060353	Bacteria	5970
580	Ga0501082_0992144	3300060353	Bacteria	734
581	Ga0501082_1006713	3300060353	Bacteria	729
582	Ga0501082_1153620	3300060353	Bacteria	677
583	Ga0501082_1525322	3300060353	Bacteria	583
584	Ga0501082_1693002	3300060353	Bacteria	552
585	Ga0530510_0068253	3300061734	Bacteria	2579
586	Ga0530510_0167752	3300061734	Bacteria	1626
587	Ga0530510_0265139	3300061734	Bacteria	1281
588	Ga0530510_1142488	3300061734	Bacteria	597

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

	Sample	Scaffold	Protein	Protein Length
1	3300006028	Ga0070717_10166705	Ga0070717_101667053	115
2	3300049741	Ga0501079_0824148	Ga0501079_0824148_104_544	120
3	3300049581	Ga0501047_0325434	Ga0501047_0325434_26_460	123
4	3300049742	Ga0501080_0052923	Ga0501080_0052923_1644_2078	123
5	3300049823	Ga0501044_1045724	Ga0501044_1045724_26_460	123
6	3300042137	Ga0450902_054345	Ga0450902_054345_11_409	126
7	3300038443	Ga0395901_0960720	Ga0395901_0960720_344_760	128
8	3300045976	Ga0466967_2435112	Ga0466967_2435112_17_433	128
9	3300009147	Ga0114129_11153090	Ga0114129_111530902	129
10	3300046615	Ga0495656_0036766	Ga0495656_0036766_1381_1785	129
11	3300009098	Ga0105245_10806577	Ga0105245_108065772	132
12	3300048912	Ga0496109_1421188	Ga0496109_1421188_82_519	132
13	3300049581	Ga0501047_0792678	Ga0501047_0792678_34_504	134
14	3300049742	Ga0501080_0315531	Ga0501080_0315531_407_829	134
15	3300003373	JGI25407J50210_10001551	JGI25407J50210_100015515	135
16	3300005937	Ga0081455_10038352	Ga0081455_100383526	135
17	3300005981	Ga0081538_10012842	Ga0081538_100128428	135
18	3300049568	Ga0501031_0008073	Ga0501031_0008073_2593_3012	135
19	3300049569	Ga0501032_0013033	Ga0501032_0013033_1106_1525	135
20	3300049569	Ga0501032_0794651	Ga0501032_0794651_106_540	135
21	3300049570	Ga0501033_0024851	Ga0501033_0024851_1670_2089	135
22	3300049571	Ga0501034_0114797	Ga0501034_0114797_1296_1730	135
23	3300049572	Ga0501036_0016771	Ga0501036_0016771_168_587	135
24	3300049573	Ga0501037_0069642	Ga0501037_0069642_1619_2038	135
25	3300049574	Ga0501038_0002818	Ga0501038_0002818_4048_4467	135
26	3300049575	Ga0501039_0001716	Ga0501039_0001716_2806_3225	135
27	3300049577	Ga0501041_0005433	Ga0501041_0005433_4291_4710	135
28	3300049578	Ga0501042_0007202	Ga0501042_0007202_2467_2886	135
29	3300049579	Ga0501043_0015868	Ga0501043_0015868_4385_4804	135
30	3300049579	Ga0501043_0451321	Ga0501043_0451321_153_587	135
31	3300049580	Ga0501046_0003476	Ga0501046_0003476_1948_2367	135
32	3300049581	Ga0501047_0189313	Ga0501047_0189313_633_1052	135
33	3300049582	Ga0501048_0104230	Ga0501048_0104230_168_587	135
34	3300049583	Ga0501067_0440927	Ga0501067_0440927_124_558	135
35	3300049584	Ga0501068_0012239	Ga0501068_0012239_3677_4096	135
36	3300049585	Ga0501069_0010996	Ga0501069_0010996_1755_2174	135
37	3300049586	Ga0501070_0005530	Ga0501070_0005530_6488_6907	135
38	3300049588	Ga0501072_0130663	Ga0501072_0130663_168_587	135
39	3300049589	Ga0501073_0002648	Ga0501073_0002648_8120_8539	135
40	3300049590	Ga0501074_0004068	Ga0501074_0004068_8599_9018	135
41	3300049590	Ga0501074_0386919	Ga0501074_0386919_427_861	135
42	3300049592	Ga0501076_0053285	Ga0501076_0053285_759_1178	135
43	3300049593	Ga0501077_0026234	Ga0501077_0026234_1864_2283	135
44	3300049741	Ga0501079_0046397	Ga0501079_0046397_1387_1806	135
45	3300049742	Ga0501080_0004540	Ga0501080_0004540_9398_9817	135
46	3300049743	Ga0501081_0092379	Ga0501081_0092379_296_715	135
47	3300049744	Ga0501083_0002388	Ga0501083_0002388_11534_11953	135
48	3300049822	Ga0501035_0008221	Ga0501035_0008221_2311_2730	135
49	3300049824	Ga0501045_0010103	Ga0501045_0010103_1836_2255	135
50	3300054114	Ga0501084_0016991	Ga0501084_0016991_1404_1823	135
51	3300060353	Ga0501082_0018691	Ga0501082_0018691_1329_1748	135
52	3300005983	Ga0081540_1004870	Ga0081540_10048706	136
53	3300042157	Ga0439458_0030130	Ga0439458_0030130_538_966	136
54	3300044706	Ga0466964_0260000	Ga0466964_0260000_408_839	136
55	3300045051	Ga0451576_0141230	Ga0451576_0141230_1395_1823	136
56	3300045836	Ga0466958_0581741	Ga0466958_0581741_265_696	136
57	3300045976	Ga0466967_0002827	Ga0466967_0002827_2732_3163	136
58	3300048907	Ga0496104_0384645	Ga0496104_0384645_112_552	136
59	3300049576	Ga0501040_0075806	Ga0501040_0075806_524_943	136
60	3300049583	Ga0501067_0449046	Ga0501067_0449046_265_693	136
61	3300049743	Ga0501081_0033315	Ga0501081_0033315_2843_3262	136
62	3300054114	Ga0501084_0329946	Ga0501084_0329946_821_1240	136
63	3300005336	Ga0070680_100155581	Ga0070680_1001555812	137
64	3300005336	Ga0070680_101179467	Ga0070680_1011794671	137
65	3300005339	Ga0070660_100616365	Ga0070660_1006163652	137
66	3300005344	Ga0070661_100192737	Ga0070661_1001927372	137
67	3300005364	Ga0070673_101552646	Ga0070673_1015526461	137
68	3300005366	Ga0070659_100391594	Ga0070659_1003915942	137
69	3300005434	Ga0070709_10526246	Ga0070709_105262462	137
70	3300005436	Ga0070713_100654305	Ga0070713_1006543052	137
71	3300005437	Ga0070710_10065946	Ga0070710_100659463	137
72	3300005438	Ga0070701_10434825	Ga0070701_104348252	137
73	3300005445	Ga0070708_100122751	Ga0070708_1001227513	137
74	3300005458	Ga0070681_10208563	Ga0070681_102085631	137
75	3300005466	Ga0070685_10472125	Ga0070685_104721252	137
76	3300005468	Ga0070707_100172959	Ga0070707_1001729593	137
77	3300005530	Ga0070679_100163103	Ga0070679_1001631034	137
78	3300005530	Ga0070679_101077275	Ga0070679_1010772751	137
79	3300005535	Ga0070684_100598990	Ga0070684_1005989902	137
80	3300005539	Ga0068853_100112857	Ga0068853_1001128574	137
81	3300005544	Ga0070686_100434470	Ga0070686_1004344702	137
82	3300005545	Ga0070695_100066131	Ga0070695_1000661313	137
83	3300005546	Ga0070696_100407040	Ga0070696_1004070402	137
84	3300005547	Ga0070693_100135875	Ga0070693_1001358753	137
85	3300005563	Ga0068855_100028863	Ga0068855_1000288634	137
86	3300005577	Ga0068857_100445189	Ga0068857_1004451892	137
87	3300005578	Ga0068854_100171028	Ga0068854_1001710282	137
88	3300005614	Ga0068856_100117842	Ga0068856_1001178423	137
89	3300005615	Ga0070702_100939310	Ga0070702_1009393101	137
90	3300005718	Ga0068866_10070370	Ga0068866_100703703	137
91	3300005842	Ga0068858_100234515	Ga0068858_1002345152	137
92	3300005843	Ga0068860_100216212	Ga0068860_1002162123	137
93	3300005937	Ga0081455_10470710	Ga0081455_104707101	137
94	3300006175	Ga0070712_100006134	Ga0070712_1000061343	137
95	3300006175	Ga0070712_100727960	Ga0070712_1007279601	137
96	3300006852	Ga0075433_10236886	Ga0075433_102368863	137
97	3300006871	Ga0075434_100021464	Ga0075434_1000214647	137
98	3300006914	Ga0075436_100930806	Ga0075436_1009308062	137
99	3300007076	Ga0075435_100032294	Ga0075435_1000322944	137
100	3300009093	Ga0105240_10013548	Ga0105240_100135484	137
101	3300009148	Ga0105243_10284770	Ga0105243_102847702	137
102	3300009148	Ga0105243_10607725	Ga0105243_106077251	137
103	3300009176	Ga0105242_10593081	Ga0105242_105930812	137
104	3300009176	Ga0105242_12183027	Ga0105242_121830272	137
105	3300009177	Ga0105248_10080058	Ga0105248_100800587	137
106	3300009545	Ga0105237_10377236	Ga0105237_103772363	137
107	3300009551	Ga0105238_10439362	Ga0105238_104393622	137
108	3300009553	Ga0105249_10200077	Ga0105249_102000773	137
109	3300010375	Ga0105239_10293154	Ga0105239_102931542	137
110	3300010375	Ga0105239_10319917	Ga0105239_103199171	137
111	3300010375	Ga0105239_10389956	Ga0105239_103899563	137
112	3300010375	Ga0105239_11800563	Ga0105239_118005632	137
113	3300011119	Ga0105246_10561953	Ga0105246_105619532	137
114	3300013104	Ga0157370_10191549	Ga0157370_101915492	137
115	3300013105	Ga0157369_10015785	Ga0157369_100157852	137
116	3300013297	Ga0157378_11436600	Ga0157378_114366002	137
117	3300013308	Ga0157375_10032018	Ga0157375_100320188	137
118	3300013308	Ga0157375_10228589	Ga0157375_102285893	137
119	3300014325	Ga0163163_11257229	Ga0163163_112572292	137
120	3300014497	Ga0182008_10209559	Ga0182008_102095592	137
121	3300014969	Ga0157376_10401493	Ga0157376_104014933	137
122	3300020069	Ga0197907_11132538	Ga0197907_111325382	137
123	3300020070	Ga0206356_11069274	Ga0206356_110692742	137
124	3300025899	Ga0207642_10177140	Ga0207642_101771402	137
125	3300025906	Ga0207699_10151719	Ga0207699_101517193	137
126	3300025912	Ga0207707_10050465	Ga0207707_100504653	137
127	3300025913	Ga0207695_10010135	Ga0207695_100101358	137
128	3300025914	Ga0207671_10067103	Ga0207671_100671033	137
129	3300025915	Ga0207693_10009379	Ga0207693_100093794	137
130	3300025916	Ga0207663_10037430	Ga0207663_100374304	137
131	3300025917	Ga0207660_10013230	Ga0207660_100132304	137
132	3300025921	Ga0207652_10258960	Ga0207652_102589602	137
133	3300025921	Ga0207652_10645392	Ga0207652_106453921	137
134	3300025927	Ga0207687_10372389	Ga0207687_103723892	137
135	3300025928	Ga0207700_10289991	Ga0207700_102899913	137
136	3300025932	Ga0207690_10598866	Ga0207690_105988662	137
137	3300025934	Ga0207686_10357783	Ga0207686_103577832	137
138	3300025934	Ga0207686_10952458	Ga0207686_109524582	137
139	3300025935	Ga0207709_10088511	Ga0207709_100885113	137
140	3300025935	Ga0207709_10145533	Ga0207709_101455331	137
141	3300025944	Ga0207661_10291534	Ga0207661_102915342	137
142	3300025949	Ga0207667_10026536	Ga0207667_100265364	137
143	3300025981	Ga0207640_10257409	Ga0207640_102574091	137
144	3300026023	Ga0207677_11148619	Ga0207677_111486191	137
145	3300026035	Ga0207703_10219000	Ga0207703_102190003	137
146	3300026041	Ga0207639_10050505	Ga0207639_100505054	137
147	3300026078	Ga0207702_10090866	Ga0207702_100908663	137
148	3300026088	Ga0207641_10408558	Ga0207641_104085583	137
149	3300026116	Ga0207674_10627774	Ga0207674_106277741	137
150	3300026121	Ga0207683_10036224	Ga0207683_100362242	137
151	3300031824	Ga0307413_10136053	Ga0307413_101360532	137
152	3300032002	Ga0307416_100348920	Ga0307416_1003489203	137
153	3300032126	Ga0307415_101124634	Ga0307415_1011246342	137
154	3300035691	Ga0373931_0615669	Ga0373931_0615669_84_518	137
155	3300037466	Ga0395898_1618189	Ga0395898_1618189_73_516	137
156	3300046459	Ga0495629_0480625	Ga0495629_0480625_237_746	137
157	3300046501	Ga0495607_0178906	Ga0495607_0178906_143_583	137
158	3300046616	Ga0495668_0155186	Ga0495668_0155186_663_1094	137
159	3300046678	Ga0495599_0272248	Ga0495599_0272248_569_1000	137
160	3300046683	Ga0495658_0460824	Ga0495658_0460824_68_577	137
161	3300046689	Ga0495613_0116364	Ga0495613_0116364_378_887	137
162	3300048903	Ga0496100_0030385	Ga0496100_0030385_867_1295	137
163	3300048904	Ga0496101_0066284	Ga0496101_0066284_1314_1742	137
164	3300048904	Ga0496101_0768712	Ga0496101_0768712_317_739	137
165	3300048905	Ga0496102_0207291	Ga0496102_0207291_124_552	137
166	3300048905	Ga0496102_0896099	Ga0496102_0896099_272_694	137
167	3300048906	Ga0496103_0061184	Ga0496103_0061184_873_1301	137
168	3300048906	Ga0496103_0217327	Ga0496103_0217327_636_1070	137
169	3300048907	Ga0496104_0007445	Ga0496104_0007445_4565_4993	137
170	3300048907	Ga0496104_0474056	Ga0496104_0474056_10_444	137
171	3300048908	Ga0496105_0014191	Ga0496105_0014191_1386_1814	137
172	3300048908	Ga0496105_0238028	Ga0496105_0238028_826_1260	137
173	3300048908	Ga0496105_0401042	Ga0496105_0401042_122_544	137
174	3300048909	Ga0496106_0014651	Ga0496106_0014651_4978_5406	137
175	3300048909	Ga0496106_0029929	Ga0496106_0029929_3424_3858	137
176	3300048910	Ga0496107_0015500	Ga0496107_0015500_197_631	137
177	3300048910	Ga0496107_0125265	Ga0496107_0125265_942_1370	137
178	3300048911	Ga0496108_0000716	Ga0496108_0000716_15840_16268	137
179	3300048911	Ga0496108_0025310	Ga0496108_0025310_4070_4492	137
180	3300048912	Ga0496109_0004184	Ga0496109_0004184_8026_8454	137
181	3300048912	Ga0496109_0014484	Ga0496109_0014484_948_1370	137
182	3300048913	Ga0496110_0008959	Ga0496110_0008959_5339_5773	137
183	3300048913	Ga0496110_0022444	Ga0496110_0022444_795_1217	137
184	3300048913	Ga0496110_0532561	Ga0496110_0532561_188_610	137
185	3300048914	Ga0496111_0003808	Ga0496111_0003808_5880_6308	137
186	3300048914	Ga0496111_0030292	Ga0496111_0030292_2994_3416	137
187	3300048915	Ga0496112_0008702	Ga0496112_0008702_3469_3897	137
188	3300048916	Ga0496113_0013931	Ga0496113_0013931_3864_4292	137
189	3300048917	Ga0496114_0378959	Ga0496114_0378959_435_863	137
190	3300048917	Ga0496114_0728081	Ga0496114_0728081_29_463	137
191	3300048917	Ga0496114_0856800	Ga0496114_0856800_183_605	137
192	3300048918	Ga0496115_0026196	Ga0496115_0026196_3811_4245	137
193	3300048918	Ga0496115_0888560	Ga0496115_0888560_217_648	137
194	3300049583	Ga0501067_0010282	Ga0501067_0010282_2123_2557	137
195	3300049586	Ga0501070_0723617	Ga0501070_0723617_277_711	137
196	3300050512	nmdc:mga0n895_16329_c1	nmdc:mga0n895_16329_c1_2343_2777	137
197	3300050513	nmdc:mga0rr50_377053_c1	nmdc:mga0rr50_377053_c1_454_888	137
198	3300050514	nmdc:mga08x19_2634_c1	nmdc:mga08x19_2634_c1_6415_6849	137
199	3300050515	nmdc:mga0a205_48974_c1	nmdc:mga0a205_48974_c1_330_764	137
200	3300060353	Ga0501082_1693002	Ga0501082_1693002_34_468	137
201	3300061734	Ga0530510_1142488	Ga0530510_1142488_10_444	137
202	3300002077	JGI24744J21845_10031979	JGI24744J21845_100319791	138
203	3300005327	Ga0070658_10101414	Ga0070658_101014143	138
204	3300005327	Ga0070658_10323059	Ga0070658_103230592	138
205	3300005329	Ga0070683_100351532	Ga0070683_1003515321	138
206	3300005330	Ga0070690_101531917	Ga0070690_1015319171	138
207	3300005334	Ga0068869_100667398	Ga0068869_1006673982	138
208	3300005336	Ga0070680_100438660	Ga0070680_1004386602	138
209	3300005339	Ga0070660_100026712	Ga0070660_1000267123	138
210	3300005339	Ga0070660_100157440	Ga0070660_1001574403	138
211	3300005340	Ga0070689_100832344	Ga0070689_1008323442	138
212	3300005347	Ga0070668_100349386	Ga0070668_1003493861	138
213	3300005353	Ga0070669_100654201	Ga0070669_1006542011	138
214	3300005356	Ga0070674_100171373	Ga0070674_1001713733	138
215	3300005434	Ga0070709_10565556	Ga0070709_105655562	138
216	3300005436	Ga0070713_100063324	Ga0070713_1000633245	138
217	3300005438	Ga0070701_10115900	Ga0070701_101159001	138
218	3300005440	Ga0070705_100006228	Ga0070705_1000062284	138
219	3300005440	Ga0070705_100132005	Ga0070705_1001320053	138
220	3300005441	Ga0070700_100231624	Ga0070700_1002316242	138
221	3300005445	Ga0070708_100040693	Ga0070708_1000406937	138
222	3300005458	Ga0070681_10017927	Ga0070681_100179277	138
223	3300005458	Ga0070681_10043215	Ga0070681_100432153	138
224	3300005459	Ga0068867_100862948	Ga0068867_1008629482	138
225	3300005467	Ga0070706_100292186	Ga0070706_1002921862	138
226	3300005467	Ga0070706_101616939	Ga0070706_1016169391	138
227	3300005468	Ga0070707_100004044	Ga0070707_1000040448	138
228	3300005468	Ga0070707_100020070	Ga0070707_1000200705	138
229	3300005471	Ga0070698_100076954	Ga0070698_1000769543	138
230	3300005471	Ga0070698_100121382	Ga0070698_1001213824	138
231	3300005471	Ga0070698_100758200	Ga0070698_1007582002	138
232	3300005518	Ga0070699_100112867	Ga0070699_1001128675	138
233	3300005518	Ga0070699_100153052	Ga0070699_1001530523	138
234	3300005518	Ga0070699_101570705	Ga0070699_1015707051	138
235	3300005530	Ga0070679_100004218	Ga0070679_1000042182	138
236	3300005530	Ga0070679_100089785	Ga0070679_1000897852	138
237	3300005530	Ga0070679_100499841	Ga0070679_1004998412	138
238	3300005535	Ga0070684_100024211	Ga0070684_1000242115	138
239	3300005535	Ga0070684_100366669	Ga0070684_1003666692	138
240	3300005536	Ga0070697_100045689	Ga0070697_1000456895	138
241	3300005536	Ga0070697_100248456	Ga0070697_1002484563	138
242	3300005543	Ga0070672_100280728	Ga0070672_1002807283	138
243	3300005545	Ga0070695_101363822	Ga0070695_1013638221	138
244	3300005546	Ga0070696_100051204	Ga0070696_1000512043	138
245	3300005546	Ga0070696_100360158	Ga0070696_1003601582	138
246	3300005547	Ga0070693_100062472	Ga0070693_1000624723	138
247	3300005549	Ga0070704_101210016	Ga0070704_1012100161	138
248	3300005563	Ga0068855_100560094	Ga0068855_1005600942	138
249	3300005615	Ga0070702_100346339	Ga0070702_1003463391	138
250	3300005615	Ga0070702_100509152	Ga0070702_1005091522	138
251	3300005719	Ga0068861_100206101	Ga0068861_1002061013	138
252	3300005840	Ga0068870_10143741	Ga0068870_101437411	138
253	3300005937	Ga0081455_10041668	Ga0081455_100416682	138
254	3300006028	Ga0070717_10040173	Ga0070717_100401735	138
255	3300006173	Ga0070716_100020050	Ga0070716_1000200506	138
256	3300006173	Ga0070716_101494216	Ga0070716_1014942161	138
257	3300006175	Ga0070712_100042267	Ga0070712_1000422673	138
258	3300006237	Ga0097621_100491826	Ga0097621_1004918262	138
259	3300006844	Ga0075428_102374116	Ga0075428_1023741162	138
260	3300006847	Ga0075431_101340736	Ga0075431_1013407361	138
261	3300006871	Ga0075434_100069864	Ga0075434_1000698644	138
262	3300006881	Ga0068865_100253902	Ga0068865_1002539022	138
263	3300006881	Ga0068865_100970131	Ga0068865_1009701312	138
264	3300006914	Ga0075436_100128256	Ga0075436_1001282563	138
265	3300007076	Ga0075435_100399722	Ga0075435_1003997222	138
266	3300009094	Ga0111539_10092531	Ga0111539_100925313	138
267	3300009098	Ga0105245_10182663	Ga0105245_101826633	138
268	3300009098	Ga0105245_10970812	Ga0105245_109708122	138
269	3300009147	Ga0114129_10273467	Ga0114129_102734674	138
270	3300009147	Ga0114129_10349364	Ga0114129_103493643	138
271	3300009147	Ga0114129_11576079	Ga0114129_115760792	138
272	3300009148	Ga0105243_10934878	Ga0105243_109348782	138
273	3300009148	Ga0105243_11399151	Ga0105243_113991512	138
274	3300009174	Ga0105241_10916417	Ga0105241_109164172	138
275	3300009174	Ga0105241_12501718	Ga0105241_125017181	138
276	3300009176	Ga0105242_10177124	Ga0105242_101771242	138
277	3300009176	Ga0105242_10472457	Ga0105242_104724572	138
278	3300009176	Ga0105242_10859889	Ga0105242_108598892	138
279	3300009177	Ga0105248_10538156	Ga0105248_105381562	138
280	3300009177	Ga0105248_12274585	Ga0105248_122745852	138
281	3300009551	Ga0105238_12221387	Ga0105238_122213871	138
282	3300009553	Ga0105249_10968282	Ga0105249_109682822	138
283	3300010375	Ga0105239_10182190	Ga0105239_101821903	138
284	3300011119	Ga0105246_10473408	Ga0105246_104734082	138
285	3300012494	Ga0157341_1035212	Ga0157341_10352121	138
286	3300013104	Ga0157370_10422798	Ga0157370_104227982	138
287	3300013105	Ga0157369_10600651	Ga0157369_106006511	138
288	3300013296	Ga0157374_10396188	Ga0157374_103961882	138
289	3300013296	Ga0157374_12124185	Ga0157374_121241851	138
290	3300013297	Ga0157378_10158575	Ga0157378_101585753	138
291	3300013306	Ga0163162_10894082	Ga0163162_108940822	138
292	3300013306	Ga0163162_13183133	Ga0163162_131831331	138
293	3300013307	Ga0157372_10453299	Ga0157372_104532992	138
294	3300013307	Ga0157372_10894454	Ga0157372_108944542	138
295	3300013308	Ga0157375_10244252	Ga0157375_102442523	138
296	3300013308	Ga0157375_10250081	Ga0157375_102500813	138
297	3300013308	Ga0157375_11582726	Ga0157375_115827261	138
298	3300013308	Ga0157375_12279799	Ga0157375_122797991	138
299	3300014325	Ga0163163_10293856	Ga0163163_102938562	138
300	3300014326	Ga0157380_11097869	Ga0157380_110978692	138
301	3300014969	Ga0157376_10695275	Ga0157376_106952752	138
302	3300020070	Ga0206356_10765740	Ga0206356_107657405	138
303	3300020082	Ga0206353_10757095	Ga0206353_107570952	138
304	3300025899	Ga0207642_10566617	Ga0207642_105666171	138
305	3300025906	Ga0207699_10014854	Ga0207699_100148545	138
306	3300025908	Ga0207643_10071287	Ga0207643_100712873	138
307	3300025909	Ga0207705_10077440	Ga0207705_100774403	138
308	3300025909	Ga0207705_10178426	Ga0207705_101784262	138
309	3300025910	Ga0207684_10366114	Ga0207684_103661142	138
310	3300025911	Ga0207654_10208493	Ga0207654_102084933	138
311	3300025912	Ga0207707_10049232	Ga0207707_100492323	138
312	3300025915	Ga0207693_10053990	Ga0207693_100539903	138
313	3300025916	Ga0207663_11168927	Ga0207663_111689272	138
314	3300025917	Ga0207660_10096041	Ga0207660_100960413	138
315	3300025919	Ga0207657_10169114	Ga0207657_101691142	138
316	3300025919	Ga0207657_10188555	Ga0207657_101885553	138
317	3300025921	Ga0207652_10041495	Ga0207652_100414952	138
318	3300025921	Ga0207652_10394473	Ga0207652_103944731	138
319	3300025922	Ga0207646_10006249	Ga0207646_100062494	138
320	3300025922	Ga0207646_10026800	Ga0207646_100268004	138
321	3300025922	Ga0207646_10194152	Ga0207646_101941524	138
322	3300025923	Ga0207681_10277808	Ga0207681_102778082	138
323	3300025928	Ga0207700_10000002	Ga0207700_1000000248	138
324	3300025929	Ga0207664_10078950	Ga0207664_100789502	138
325	3300025933	Ga0207706_10364196	Ga0207706_103641962	138
326	3300025934	Ga0207686_10172231	Ga0207686_101722312	138
327	3300025935	Ga0207709_10122200	Ga0207709_101222003	138
328	3300025937	Ga0207669_10465848	Ga0207669_104658482	138
329	3300025937	Ga0207669_10970748	Ga0207669_109707481	138
330	3300025938	Ga0207704_10187837	Ga0207704_101878372	138
331	3300025938	Ga0207704_10634451	Ga0207704_106344512	138
332	3300025939	Ga0207665_10337606	Ga0207665_103376062	138
333	3300025940	Ga0207691_10128356	Ga0207691_101283564	138
334	3300025941	Ga0207711_10444892	Ga0207711_104448922	138
335	3300025949	Ga0207667_10384260	Ga0207667_103842601	138
336	3300025961	Ga0207712_10017831	Ga0207712_100178312	138
337	3300025972	Ga0207668_10236452	Ga0207668_102364522	138
338	3300025981	Ga0207640_11191528	Ga0207640_111915281	138
339	3300026023	Ga0207677_11518478	Ga0207677_115184782	138
340	3300026075	Ga0207708_10237060	Ga0207708_102370602	138
341	3300026075	Ga0207708_10687811	Ga0207708_106878112	138
342	3300026089	Ga0207648_10085571	Ga0207648_100855711	138
343	3300026089	Ga0207648_11830462	Ga0207648_118304621	138
344	3300026118	Ga0207675_100333922	Ga0207675_1003339222	138
345	3300026121	Ga0207683_10008984	Ga0207683_100089849	138
346	3300026121	Ga0207683_11589397	Ga0207683_115893972	138
347	3300026142	Ga0207698_10721071	Ga0207698_107210712	138
348	3300027907	Ga0207428_10396905	Ga0207428_103969052	138
349	3300028379	Ga0268266_10414582	Ga0268266_104145822	138
350	3300028379	Ga0268266_10545191	Ga0268266_105451912	138
351	3300031665	Ga0316575_10039497	Ga0316575_100394973	138
352	3300031691	Ga0316579_10034002	Ga0316579_100340022	138
353	3300031727	Ga0316576_10555873	Ga0316576_105558732	138
354	3300031728	Ga0316578_10045634	Ga0316578_100456343	138
355	3300031733	Ga0316577_10011008	Ga0316577_100110084	138
356	3300031852	Ga0307410_10046296	Ga0307410_100462964	138
357	3300031901	Ga0307406_11711322	Ga0307406_117113221	138
358	3300031903	Ga0307407_10035570	Ga0307407_100355701	138
359	3300032002	Ga0307416_100053935	Ga0307416_1000539353	138
360	3300032002	Ga0307416_100476010	Ga0307416_1004760102	138
361	3300032126	Ga0307415_100562272	Ga0307415_1005622722	138
362	3300032137	Ga0316585_10033830	Ga0316585_100338303	138
363	3300035114	Ga0373939_0187593	Ga0373939_0187593_162_587	138
364	3300035171	Ga0373946_0448556	Ga0373946_0448556_51_488	138
365	3300035398	Ga0316574_0031022	Ga0316574_0031022_469_909	138
366	3300035691	Ga0373931_0188709	Ga0373931_0188709_706_1182	138
367	3300036647	Ga0316582_0001763	Ga0316582_0001763_5240_5680	138
368	3300036712	Ga0316584_0003336	Ga0316584_0003336_5273_5713	138
369	3300037312	Ga0395899_0005040	Ga0395899_0005040_6540_6980	138
370	3300037312	Ga0395899_0005078	Ga0395899_0005078_2859_3308	138
371	3300037312	Ga0395899_0016760	Ga0395899_0016760_2239_2673	138
372	3300037312	Ga0395899_0022740	Ga0395899_0022740_3513_3950	138
373	3300037312	Ga0395899_0024162	Ga0395899_0024162_1429_1908	138
374	3300037312	Ga0395899_0038109	Ga0395899_0038109_2500_2985	138
375	3300037312	Ga0395899_0181585	Ga0395899_0181585_104_538	138
376	3300037418	Ga0395900_0002302	Ga0395900_0002302_7889_8368	138
377	3300037418	Ga0395900_0005938	Ga0395900_0005938_3137_3586	138
378	3300037418	Ga0395900_0005954	Ga0395900_0005954_5603_6040	138
379	3300037418	Ga0395900_0019484	Ga0395900_0019484_3456_3890	138
380	3300037418	Ga0395900_0020752	Ga0395900_0020752_4645_5082	138
381	3300037418	Ga0395900_0046517	Ga0395900_0046517_1647_2087	138
382	3300037418	Ga0395900_0063359	Ga0395900_0063359_434_868	138
383	3300037418	Ga0395900_0083864	Ga0395900_0083864_1626_2111	138
384	3300037418	Ga0395900_0110784	Ga0395900_0110784_1915_2346	138
385	3300037418	Ga0395900_0161948	Ga0395900_0161948_875_1306	138
386	3300037418	Ga0395900_0229450	Ga0395900_0229450_490_924	138
387	3300037418	Ga0395900_0279948	Ga0395900_0279948_294_728	138
388	3300037418	Ga0395900_0308709	Ga0395900_0308709_998_1432	138
389	3300037418	Ga0395900_0365091	Ga0395900_0365091_750_1184	138
390	3300037418	Ga0395900_0421225	Ga0395900_0421225_679_1104	138
391	3300037418	Ga0395900_1134239	Ga0395900_1134239_151_585	138
392	3300037418	Ga0395900_1289705	Ga0395900_1289705_52_486	138
393	3300037466	Ga0395898_0000723	Ga0395898_0000723_28359_28808	138
394	3300037466	Ga0395898_0082668	Ga0395898_0082668_1392_1832	138
395	3300037466	Ga0395898_0138716	Ga0395898_0138716_1843_2280	138
396	3300037466	Ga0395898_0150696	Ga0395898_0150696_264_689	138
397	3300037466	Ga0395898_0185761	Ga0395898_0185761_524_1009	138
398	3300037466	Ga0395898_0375778	Ga0395898_0375778_779_1213	138
399	3300037466	Ga0395898_0398336	Ga0395898_0398336_429_860	138
400	3300037466	Ga0395898_0497025	Ga0395898_0497025_198_632	138
401	3300037466	Ga0395898_1257488	Ga0395898_1257488_205_639	138
402	3300037471	Ga0395905_0002667	Ga0395905_0002667_14407_14856	138
403	3300037471	Ga0395905_0017677	Ga0395905_0017677_2816_3250	138
404	3300037471	Ga0395905_0052268	Ga0395905_0052268_144_569	138
405	3300037471	Ga0395905_0096177	Ga0395905_0096177_1267_1707	138
406	3300037471	Ga0395905_0105699	Ga0395905_0105699_1449_1880	138
407	3300037471	Ga0395905_0107418	Ga0395905_0107418_646_1083	138
408	3300037471	Ga0395905_0107479	Ga0395905_0107479_1574_2008	138
409	3300037471	Ga0395905_0126536	Ga0395905_0126536_586_1017	138
410	3300037471	Ga0395905_0143028	Ga0395905_0143028_643_1077	138
411	3300037471	Ga0395905_0146092	Ga0395905_0146092_536_970	138
412	3300037471	Ga0395905_1152868	Ga0395905_1152868_28_462	138
413	3300037471	Ga0395905_1299699	Ga0395905_1299699_116_550	138
414	3300037471	Ga0395905_1465317	Ga0395905_1465317_39_473	138
415	3300038443	Ga0395901_0002832	Ga0395901_0002832_2500_2925	138
416	3300038443	Ga0395901_0002996	Ga0395901_0002996_10370_10804	138
417	3300038443	Ga0395901_0006687	Ga0395901_0006687_5109_5549	138
418	3300038443	Ga0395901_0006880	Ga0395901_0006880_388_822	138
419	3300038443	Ga0395901_0007011	Ga0395901_0007011_7671_8108	138
420	3300038443	Ga0395901_0009606	Ga0395901_0009606_5780_6229	138
421	3300038443	Ga0395901_0010946	Ga0395901_0010946_693_1127	138
422	3300038443	Ga0395901_0014113	Ga0395901_0014113_6197_6631	138
423	3300038443	Ga0395901_0062804	Ga0395901_0062804_2800_3234	138
424	3300038443	Ga0395901_0083377	Ga0395901_0083377_634_1119	138
425	3300038443	Ga0395901_0091333	Ga0395901_0091333_388_822	138
426	3300038443	Ga0395901_0201460	Ga0395901_0201460_1444_1881	138
427	3300038443	Ga0395901_0803298	Ga0395901_0803298_70_501	138
428	3300038443	Ga0395901_0965229	Ga0395901_0965229_298_735	138
429	3300038443	Ga0395901_1739659	Ga0395901_1739659_53_478	138
430	3300041498	Ga0451841_0358761	Ga0451841_0358761_81_524	138
431	3300041512	Ga0451853_2334412	Ga0451853_2334412_622_1074	138
432	3300042005	Ga0439448_0344557	Ga0439448_0344557_32_466	138
433	3300045051	Ga0451576_0929275	Ga0451576_0929275_218_655	138
434	3300045976	Ga0466967_0024713	Ga0466967_0024713_1915_2349	138
435	3300046455	Ga0495603_0020753	Ga0495603_0020753_2179_2604	138
436	3300046461	Ga0495641_0137291	Ga0495641_0137291_572_994	138
437	3300046491	Ga0495584_0032942	Ga0495584_0032942_834_1265	138
438	3300046491	Ga0495584_0694903	Ga0495584_0694903_18_470	138
439	3300046492	Ga0495585_0181764	Ga0495585_0181764_31_465	138
440	3300046517	Ga0495630_0066675	Ga0495630_0066675_24_446	138
441	3300046523	Ga0495644_0065249	Ga0495644_0065249_530_967	138
442	3300046523	Ga0495644_0298550	Ga0495644_0298550_92_523	138
443	3300046525	Ga0495663_0109594	Ga0495663_0109594_445_876	138
444	3300046533	Ga0495640_0968126	Ga0495640_0968126_14_478	138
445	3300046538	Ga0495609_0086555	Ga0495609_0086555_370_801	138
446	3300046539	Ga0495621_0334529	Ga0495621_0334529_23_457	138
447	3300046615	Ga0495656_0142669	Ga0495656_0142669_16_453	138
448	3300046615	Ga0495656_0203095	Ga0495656_0203095_15_449	138
449	3300046642	Ga0495634_0314098	Ga0495634_0314098_193_657	138
450	3300046664	Ga0495659_0114789	Ga0495659_0114789_45_479	138
451	3300046674	Ga0495588_0068145	Ga0495588_0068145_961_1386	138
452	3300046674	Ga0495588_0101504	Ga0495588_0101504_886_1308	138
453	3300046689	Ga0495613_0521227	Ga0495613_0521227_200_664	138
454	3300046691	Ga0495670_0407678	Ga0495670_0407678_241_672	138
455	3300047317	Ga0495604_0087098	Ga0495604_0087098_483_947	138
456	3300047318	Ga0495636_0683062	Ga0495636_0683062_21_455	138
457	3300047319	Ga0495674_0193811	Ga0495674_0193811_191_655	138
458	3300047471	Ga0495684_0811237	Ga0495684_0811237_32_496	138
459	3300048903	Ga0496100_0006266	Ga0496100_0006266_2889_3323	138
460	3300048903	Ga0496100_0631042	Ga0496100_0631042_180_596	138
461	3300048904	Ga0496101_0038959	Ga0496101_0038959_1519_1935	138
462	3300048904	Ga0496101_0086241	Ga0496101_0086241_1076_1507	138
463	3300048904	Ga0496101_0258371	Ga0496101_0258371_677_1153	138
464	3300048904	Ga0496101_0261141	Ga0496101_0261141_428_871	138
465	3300048904	Ga0496101_0445333	Ga0496101_0445333_385_819	138
466	3300048904	Ga0496101_0648305	Ga0496101_0648305_87_503	138
467	3300048905	Ga0496102_0060096	Ga0496102_0060096_332_766	138
468	3300048905	Ga0496102_0208503	Ga0496102_0208503_1061_1477	138
469	3300048905	Ga0496102_0533754	Ga0496102_0533754_324_740	138
470	3300048905	Ga0496102_1060943	Ga0496102_1060943_53_469	138
471	3300048905	Ga0496102_1437857	Ga0496102_1437857_116_568	138
472	3300048906	Ga0496103_0019401	Ga0496103_0019401_3206_3640	138
473	3300048906	Ga0496103_0034234	Ga0496103_0034234_967_1383	138
474	3300048907	Ga0496104_0007376	Ga0496104_0007376_2172_2606	138
475	3300048907	Ga0496104_0029759	Ga0496104_0029759_1738_2169	138
476	3300048907	Ga0496104_0036445	Ga0496104_0036445_2475_2891	138
477	3300048907	Ga0496104_0084667	Ga0496104_0084667_343_765	138
478	3300048908	Ga0496105_0000234	Ga0496105_0000234_6202_6636	138
479	3300048908	Ga0496105_0006841	Ga0496105_0006841_5407_5823	138
480	3300048908	Ga0496105_0009868	Ga0496105_0009868_6606_7037	138
481	3300048909	Ga0496106_0011442	Ga0496106_0011442_5434_5850	138
482	3300048909	Ga0496106_0171199	Ga0496106_0171199_820_1254	138
483	3300048909	Ga0496106_0401923	Ga0496106_0401923_166_609	138
484	3300048910	Ga0496107_0001675	Ga0496107_0001675_3535_3951	138
485	3300048910	Ga0496107_0084894	Ga0496107_0084894_522_953	138
486	3300048910	Ga0496107_0194495	Ga0496107_0194495_216_650	138
487	3300048910	Ga0496107_0897033	Ga0496107_0897033_203_619	138
488	3300048911	Ga0496108_0024256	Ga0496108_0024256_3978_4412	138
489	3300048911	Ga0496108_0090856	Ga0496108_0090856_841_1272	138
490	3300048911	Ga0496108_0095431	Ga0496108_0095431_1248_1691	138
491	3300048911	Ga0496108_0508071	Ga0496108_0508071_38_454	138
492	3300048912	Ga0496109_0005753	Ga0496109_0005753_6251_6685	138
493	3300048912	Ga0496109_0045464	Ga0496109_0045464_1746_2204	138
494	3300048912	Ga0496109_0110302	Ga0496109_0110302_1673_2089	138
495	3300048912	Ga0496109_0125356	Ga0496109_0125356_20_451	138
496	3300048912	Ga0496109_0671994	Ga0496109_0671994_182_613	138
497	3300048913	Ga0496110_0001327	Ga0496110_0001327_15099_15533	138
498	3300048913	Ga0496110_0018520	Ga0496110_0018520_3508_3939	138
499	3300048913	Ga0496110_0027213	Ga0496110_0027213_2325_2759	138
500	3300048913	Ga0496110_0380960	Ga0496110_0380960_643_1101	138
501	3300048913	Ga0496110_0531894	Ga0496110_0531894_263_679	138
502	3300048914	Ga0496111_0084287	Ga0496111_0084287_1460_1891	138
503	3300048914	Ga0496111_0097472	Ga0496111_0097472_71_505	138
504	3300048915	Ga0496112_0038230	Ga0496112_0038230_1417_1848	138
505	3300048915	Ga0496112_0040046	Ga0496112_0040046_2220_2654	138
506	3300048915	Ga0496112_0056335	Ga0496112_0056335_693_1127	138
507	3300048915	Ga0496112_0253900	Ga0496112_0253900_257_715	138
508	3300048916	Ga0496113_0106654	Ga0496113_0106654_596_1030	138
509	3300048917	Ga0496114_0004230	Ga0496114_0004230_7074_7508	138
510	3300048917	Ga0496114_0055547	Ga0496114_0055547_1818_2234	138
511	3300048917	Ga0496114_0109916	Ga0496114_0109916_1062_1538	138
512	3300048917	Ga0496114_0112466	Ga0496114_0112466_193_609	138
513	3300048917	Ga0496114_0330879	Ga0496114_0330879_790_1218	138
514	3300048918	Ga0496115_0015824	Ga0496115_0015824_3325_3756	138
515	3300048918	Ga0496115_0175312	Ga0496115_0175312_1311_1745	138
516	3300048918	Ga0496115_0281799	Ga0496115_0281799_361_801	138
517	3300048929	Ga0496126_0141797	Ga0496126_0141797_257_697	138
518	3300049568	Ga0501031_0167561	Ga0501031_0167561_242_679	138
519	3300049570	Ga0501033_0980358	Ga0501033_0980358_32_466	138
520	3300049572	Ga0501036_0217273	Ga0501036_0217273_399_833	138
521	3300049573	Ga0501037_0553026	Ga0501037_0553026_138_572	138
522	3300049574	Ga0501038_0029682	Ga0501038_0029682_2855_3289	138
523	3300049575	Ga0501039_0031798	Ga0501039_0031798_3566_4000	138
524	3300049576	Ga0501040_0398146	Ga0501040_0398146_335_769	138
525	3300049577	Ga0501041_0156015	Ga0501041_0156015_309_746	138
526	3300049577	Ga0501041_0184801	Ga0501041_0184801_136_570	138
527	3300049578	Ga0501042_0017626	Ga0501042_0017626_2043_2480	138
528	3300049578	Ga0501042_0075007	Ga0501042_0075007_1944_2378	138
529	3300049578	Ga0501042_0093649	Ga0501042_0093649_89_523	138
530	3300049579	Ga0501043_0179753	Ga0501043_0179753_1111_1545	138
531	3300049580	Ga0501046_0188973	Ga0501046_0188973_882_1316	138
532	3300049582	Ga0501048_0039124	Ga0501048_0039124_2586_3023	138
533	3300049582	Ga0501048_0917592	Ga0501048_0917592_105_542	138
534	3300049583	Ga0501067_0047760	Ga0501067_0047760_1752_2174	138
535	3300049583	Ga0501067_0051889	Ga0501067_0051889_853_1275	138
536	3300049583	Ga0501067_0064450	Ga0501067_0064450_1367_1846	138
537	3300049583	Ga0501067_0254186	Ga0501067_0254186_102_518	138
538	3300049584	Ga0501068_0301462	Ga0501068_0301462_301_735	138
539	3300049584	Ga0501068_0435221	Ga0501068_0435221_251_700	138
540	3300049584	Ga0501068_1002196	Ga0501068_1002196_101_538	138
541	3300049585	Ga0501069_0146964	Ga0501069_0146964_303_725	138
542	3300049585	Ga0501069_0216349	Ga0501069_0216349_244_681	138
543	3300049585	Ga0501069_0225414	Ga0501069_0225414_325_759	138
544	3300049587	Ga0501071_0061328	Ga0501071_0061328_2109_2543	138
545	3300049587	Ga0501071_1108846	Ga0501071_1108846_139_561	138
546	3300049588	Ga0501072_0070036	Ga0501072_0070036_175_609	138
547	3300049588	Ga0501072_0126825	Ga0501072_0126825_677_1114	138
548	3300049590	Ga0501074_0021111	Ga0501074_0021111_2404_2838	138
549	3300049590	Ga0501074_0039891	Ga0501074_0039891_2300_2737	138
550	3300049590	Ga0501074_0333051	Ga0501074_0333051_573_1007	138
551	3300049591	Ga0501075_0086382	Ga0501075_0086382_1726_2160	138
552	3300049591	Ga0501075_0087349	Ga0501075_0087349_1012_1449	138
553	3300049592	Ga0501076_0038950	Ga0501076_0038950_844_1281	138
554	3300049592	Ga0501076_0168249	Ga0501076_0168249_531_965	138
555	3300049592	Ga0501076_0302063	Ga0501076_0302063_104_538	138
556	3300049593	Ga0501077_0090154	Ga0501077_0090154_490_927	138
557	3300049593	Ga0501077_0192973	Ga0501077_0192973_87_533	138
558	3300049741	Ga0501079_0134496	Ga0501079_0134496_1307_1759	138
559	3300049742	Ga0501080_0091673	Ga0501080_0091673_58_492	138
560	3300049742	Ga0501080_0349959	Ga0501080_0349959_112_546	138
561	3300049743	Ga0501081_0059576	Ga0501081_0059576_806_1240	138
562	3300049743	Ga0501081_0114627	Ga0501081_0114627_972_1409	138
563	3300049744	Ga0501083_0353349	Ga0501083_0353349_75_509	138
564	3300049822	Ga0501035_0055346	Ga0501035_0055346_2764_3198	138
565	3300049822	Ga0501035_0581489	Ga0501035_0581489_101_547	138
566	3300049824	Ga0501045_0024245	Ga0501045_0024245_3460_3894	138
567	3300049824	Ga0501045_0093502	Ga0501045_0093502_29_466	138
568	3300050507	nmdc:mga05p37_402611_c1	nmdc:mga05p37_402611_c1_358_807	138
569	3300050507	nmdc:mga05p37_718976_c1	nmdc:mga05p37_718976_c1_651_1082	138
570	3300050511	nmdc:mga08y16_313001_c1	nmdc:mga08y16_313001_c1_464_898	138
571	3300050512	nmdc:mga0n895_123790_c1	nmdc:mga0n895_123790_c1_1419_1850	138
572	3300050512	nmdc:mga0n895_1258584_c1	nmdc:mga0n895_1258584_c1_198_674	138
573	3300050512	nmdc:mga0n895_1441060_c1	nmdc:mga0n895_1441060_c1_29_445	138
574	3300050512	nmdc:mga0n895_275443_c1	nmdc:mga0n895_275443_c1_1212_1646	138
575	3300050513	nmdc:mga0rr50_469690_c1	nmdc:mga0rr50_469690_c1_279_755	138
576	3300050514	nmdc:mga08x19_184774_c1	nmdc:mga08x19_184774_c1_525_1001	138
577	3300050514	nmdc:mga08x19_199438_c1	nmdc:mga08x19_199438_c1_110_556	138
578	3300050515	nmdc:mga0a205_21902_c2	nmdc:mga0a205_21902_c2_3005_3481	138
579	3300050515	nmdc:mga0a205_227926_c1	nmdc:mga0a205_227926_c1_1085_1519	138
580	3300054114	Ga0501084_0197038	Ga0501084_0197038_935_1369	138
581	3300059426	Ga0590077_028310	Ga0590077_028310_297_731	138
582	3300060353	Ga0501082_0992144	Ga0501082_0992144_125_559	138
583	3300060353	Ga0501082_1006713	Ga0501082_1006713_122_559	138
584	3300060353	Ga0501082_1153620	Ga0501082_1153620_228_662	138
585	3300060353	Ga0501082_1525322	Ga0501082_1525322_93_557	138
586	3300061734	Ga0530510_0068253	Ga0530510_0068253_1868_2332	138
587	3300061734	Ga0530510_0167752	Ga0530510_0167752_257_694	138
588	3300061734	Ga0530510_0265139	Ga0530510_0265139_296_730	138

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF12833

HTH_18

Helix-turn-helix domain

21

100

0.98 PF00165

HTH_AraC

Bacterial regulatory helix-turn-helix proteins, AraC family

60

99

0.96 PF00165

HTH_AraC

Bacterial regulatory helix-turn-helix proteins, AraC family

11

49

0.91 Structural Annotation

Top 5 Hits

ID	Description	Score	Start	End
7w5w-assembly1.cif.gz_J	cryo-em structure of soxs-dependent transcription activation complex with micf promoter dna	0.9056	7	107
7w5x-assembly1.cif.gz_K	cryo-em structure of soxs-dependent transcription activation complex with zwf promoter dna	0.8965	7	108
7w5y-assembly1.cif.gz_K	cryo-em structure of soxs-dependent transcription activation complex with fpr promoter dna	0.8758	7	108
3mn2-assembly2.cif.gz_B	the crystal structure of a probable arac family transcriptional regulator from rhodopseudomonas palustris cga009	0.8592	8	110
7w5w-assembly1.cif.gz_J	cryo-em structure of soxs-dependent transcription activation complex with micf promoter dna	0.8517	7	107

ID	Description	Score	Start	End	Superfamily
af_P32677_219_275_1.10.10.60	Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like	0.9922	61	110	1.10.10.60
1d5yD02	Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like	0.9905	61	108	1.10.10.60
3lsgA02	Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like	0.9791	63	107	1.10.10.60
5suwA03	Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like	0.957	56	110	1.10.10.60
1bl0A02	Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like	0.9528	64	107	1.10.10.60

ID	Description	Score	Start	End	GO Terms
AF-A0A7X7QXI8-F1-model_v4	AraC family transcriptional regulator	0.9653	9	110	GO:0003700 GO:0043565
AF-A0A1G0ZQ40-F1-model_v4	HTH araC/xylS-type domain-containing protein	0.9539	3	109	GO:0003700 GO:0043565
AF-A0A1G1A2R7-F1-model_v4	HTH araC/xylS-type domain-containing protein	0.9502	9	108	GO:0003700 GO:0043565
AF-A0A7X1P7Z7-F1-model_v4	Helix-turn-helix domain-containing protein	0.9457	6	117	GO:0003700 GO:0008270 GO:0016491 GO:0043565
AF-A0A1F5UHX7-F1-model_v4	HTH araC/xylS-type domain-containing protein	0.9436	7	109	GO:0003700 GO:0043565

Feature Viewer

pLDDT	pTM	Quality
87.34	0.72	High

Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Download PDB Download HMM

F466764

General Info

Family's Representative Sequence

Samples

Type Distribution

Biome Distribution

Taxonomy

Scaffolds

MSA Aligner

Family Sequences

Functional Annotation

PF12833

HTH_18

Helix-turn-helix domain

21

100

0.98

PF00165

HTH_AraC

Bacterial regulatory helix-turn-helix proteins, AraC family

60

99

0.96

PF00165

HTH_AraC

Bacterial regulatory helix-turn-helix proteins, AraC family

11

49

0.91

Structural Annotation

Top 5 Hits

Feature Viewer

Predicted Structure (AlphaFold2)

Skylign Viewer

Map