F466745

General Info

Members Datasets Scaffolds Average Seq Length
588 273 1176 181

Family's Representative Sequence

Representative Sequence 3300005435|Ga0070714_100227434|Ga0070714_1002274343
Length 219
Sequence VETIDRQDQRHSKIESPDSEIAGFAFERLRISFDPYQSITMKKSLLLAIVGFATISLMQGAETQTQSQPAAGSAAPEFSLATSDGSQVSLKDFKGKWVVLYFYPKDMTSGCTMEAKNFQRDLAQYDKTGAVILGVSVDSADSHKEFCSKEGLTFKLLADPGGKVSAQYGSTMQYQGTTMAARNTFLINPEGKIAKVYTGVKPAEHSDQVLKDLAELKKS

Samples

Sample ID Description Type Environment
1 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
2 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
3 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
4 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
5 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
6 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
7 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
8 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
9 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
10 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
14 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
15 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
16 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
17 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
18 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
19 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
20 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
21 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
22 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
23 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
24 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
25 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
26 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
27 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
28 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
29 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
30 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
31 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
32 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
33 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
34 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
35 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
36 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
37 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
38 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
39 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
40 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
41 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
42 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
43 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
44 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
45 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
46 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
47 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
48 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
49 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
50 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
51 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
52 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
53 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
54 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
55 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
56 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
57 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
58 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
59 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
60 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
61 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
62 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
63 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
64 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
65 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
66 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
67 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
68 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
69 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
70 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
71 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
72 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
73 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
74 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
75 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
76 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
77 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
78 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
79 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
80 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
81 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
82 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
83 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
84 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
85 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
86 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
87 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
88 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
89 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
90 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
91 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
92 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
93 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
94 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
95 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
96 3300019181 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZI3 metaT (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
97 3300019192 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZA3 metaT (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
98 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
99 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
100 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
101 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
102 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
103 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
104 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
105 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
106 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
107 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
108 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
165 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
169 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
170 3300030879 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
171 3300030942 Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZI5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
172 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
173 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
174 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
175 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
176 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
177 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
178 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
179 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
180 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
181 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
182 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
183 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
184 3300031814 Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
185 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
186 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
187 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
188 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
189 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
190 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
191 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
192 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
193 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
194 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
195 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
196 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
197 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
198 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
199 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
200 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
201 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
202 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
203 3300036457 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
204 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
205 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
206 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
207 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
208 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
209 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
210 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
211 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
212 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
213 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
214 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
215 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
216 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
217 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
218 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
219 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
220 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
221 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
222 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
223 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
224 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
225 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
226 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
227 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
228 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
229 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
230 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
231 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
232 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
233 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
234 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
235 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
236 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
237 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
238 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
239 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
240 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
241 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
242 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
243 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
244 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
245 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
246 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
247 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
248 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
249 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
250 3300049516 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_B_5_drought Metagenome Rhizosphere
251 3300049520 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought Metagenome Rhizosphere
252 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
253 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
254 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
255 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
256 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
257 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
258 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
259 3300049681 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_B_3_drought Metagenome Rhizosphere
260 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
261 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
262 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
263 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
264 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
265 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
266 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
267 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
268 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
269 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
270 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
271 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
272 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
273 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.94
Metatranscriptomes 3.06
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.17
Nodule 0
Rhizoplane 4.42
Rhizosphere 94.05
Stem 0
Stem Tuber 0
Unclassified 12.24

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070714_100227434 3300005435 Bacteria 1717
2 JGI24738J21930_10056696 3300002075 Bacteria 802
3 rootH2_10168798 3300003320 Bacteria 2047
4 rootL2_10087918 3300003322 Bacteria 9198
5 Ga0058862_10057807 3300004803 Unclassified 681
6 Ga0065712_10003013 3300005290 Bacteria 4860
7 Ga0065715_10003784 3300005293 Bacteria 3838
8 Ga0070658_10075613 3300005327 Bacteria 2763
9 Ga0070658_10194031 3300005327 Bacteria 1712
10 Ga0070658_10438717 3300005327 Bacteria 1124
11 Ga0070676_10031859 3300005328 Bacteria 3017
12 Ga0070683_100001021 3300005329 Bacteria 21002
13 Ga0070683_100003703 3300005329 Bacteria 12472
14 Ga0070683_100049111 3300005329 Bacteria 3902
15 Ga0070683_100082852 3300005329 Bacteria 3004
16 Ga0070670_100021720 3300005331 Bacteria 5520
17 Ga0070670_101130183 3300005331 Bacteria 715
18 Ga0068869_100018400 3300005334 Bacteria 4755
19 Ga0068869_100174292 3300005334 Bacteria 1682
20 Ga0068869_100845270 3300005334 Bacteria 789
21 Ga0070666_10066052 3300005335 Bacteria 2454
22 Ga0070666_10324127 3300005335 Bacteria 1099
23 Ga0070680_100022606 3300005336 Bacteria 5011
24 Ga0068868_100001328 3300005338 Bacteria 17048
25 Ga0068868_100006230 3300005338 Bacteria 8441
26 Ga0068868_100017875 3300005338 Bacteria 5289
27 Ga0070660_100453209 3300005339 Bacteria 1064
28 Ga0070687_100351989 3300005343 Unclassified 951
29 Ga0070661_100001378 3300005344 Bacteria 16983
30 Ga0070661_100072701 3300005344 Bacteria 2531
31 Ga0070661_100194049 3300005344 Bacteria 1549
32 Ga0070668_100103944 3300005347 Bacteria 2254
33 Ga0070669_100045923 3300005353 Unclassified 3184
34 Ga0070669_100093242 3300005353 Bacteria 2261
35 Ga0070675_100040301 3300005354 Bacteria 3812
36 Ga0070675_100244654 3300005354 Unclassified 1568
37 Ga0070671_100004759 3300005355 Bacteria 10787
38 Ga0070671_100034206 3300005355 Bacteria 4207
39 Ga0070671_100102696 3300005355 Bacteria 2399
40 Ga0070673_101311897 3300005364 Bacteria 680
41 Ga0070688_100958020 3300005365 Bacteria 678
42 Ga0070667_100027240 3300005367 Bacteria 4755
43 Ga0070667_100534713 3300005367 Bacteria 1076
44 Ga0070709_10683243 3300005434 Unclassified 797
45 Ga0070714_100005104 3300005435 Bacteria 9985
46 Ga0070714_101446665 3300005435 Bacteria 671
47 Ga0070713_100041657 3300005436 Bacteria 3743
48 Ga0070713_100437835 3300005436 Bacteria 1226
49 Ga0070710_10310412 3300005437 Bacteria 1032
50 Ga0070711_100020951 3300005439 Bacteria 4221
51 Ga0070711_100029570 3300005439 Bacteria 3617
52 Ga0070711_100088648 3300005439 Bacteria 2223
53 Ga0070711_100267983 3300005439 Bacteria 1346
54 Ga0070711_100623453 3300005439 Bacteria 902
55 Ga0070700_100026506 3300005441 Bacteria 3424
56 Ga0070708_100027244 3300005445 Bacteria 4902
57 Ga0070708_100366781 3300005445 Bacteria 1357
58 Ga0070678_100041369 3300005456 Bacteria 3266
59 Ga0070662_100034795 3300005457 Bacteria 3554
60 Ga0070662_100685512 3300005457 Unclassified 866
61 Ga0068867_100569384 3300005459 Bacteria 984
62 Ga0068867_100591920 3300005459 Bacteria 966
63 Ga0070685_10384717 3300005466 Bacteria 968
64 Ga0070706_100342287 3300005467 Bacteria 1394
65 Ga0070706_100861831 3300005467 Unclassified 837
66 Ga0070707_100099388 3300005468 Unclassified 2819
67 Ga0070707_100167518 3300005468 Bacteria 2141
68 Ga0070707_101415757 3300005468 Bacteria 662
69 Ga0070707_101719050 3300005468 Bacteria 594
70 Ga0070698_100012337 3300005471 Bacteria 9049
71 Ga0070698_100081393 3300005471 Bacteria 3232
72 Ga0070699_100297803 3300005518 Bacteria 1447
73 Ga0070684_100001524 3300005535 Bacteria 16745
74 Ga0070684_100006401 3300005535 Bacteria 9110
75 Ga0070684_100365421 3300005535 Bacteria 1328
76 Ga0070697_100004697 3300005536 Bacteria 10473
77 Ga0070697_100008913 3300005536 Bacteria 7837
78 Ga0070697_100065708 3300005536 Unclassified 2965
79 Ga0068853_100000459 3300005539 Bacteria 27826
80 Ga0068853_100144096 3300005539 Bacteria 2140
81 Ga0068853_100564849 3300005539 Bacteria 1079
82 Ga0070686_100113596 3300005544 Bacteria 1849
83 Ga0070696_100026027 3300005546 Plasmid 3980
84 Ga0070693_100030925 3300005547 Bacteria 2931
85 Ga0070693_100488640 3300005547 Bacteria 871
86 Ga0070665_100129680 3300005548 Bacteria 2524
87 Ga0070665_100325004 3300005548 Bacteria 1542
88 Ga0070665_100370710 3300005548 Bacteria 1438
89 Ga0068855_100005638 3300005563 Bacteria 15277
90 Ga0068855_100007635 3300005563 Bacteria 13081
91 Ga0068855_100008401 3300005563 Bacteria 12485
92 Ga0068855_100036215 3300005563 Bacteria 5875
93 Ga0068855_100069195 3300005563 Bacteria 4108
94 Ga0068855_100165457 3300005563 Bacteria 2508
95 Ga0070664_100225246 3300005564 Bacteria 1679
96 Ga0070664_100306437 3300005564 Bacteria 1436
97 Ga0070664_100337198 3300005564 Bacteria 1369
98 Ga0070664_100363075 3300005564 Bacteria 1319
99 Ga0068857_100000342 3300005577 Bacteria 32171
100 Ga0068857_100004532 3300005577 Bacteria 11749
101 Ga0068857_100905290 3300005577 Bacteria 846
102 Ga0068857_101075442 3300005577 Bacteria 776
103 Ga0068854_100048081 3300005578 Bacteria 3042
104 Ga0068854_100078240 3300005578 Bacteria 2436
105 Ga0068856_100003675 3300005614 Bacteria 15388
106 Ga0068856_100014690 3300005614 Bacteria 7557
107 Ga0068856_100034915 3300005614 Bacteria 4927
108 Ga0068856_100059658 3300005614 Bacteria 3769
109 Ga0068856_100079493 3300005614 Bacteria 3252
110 Ga0068856_100170590 3300005614 Bacteria 2188
111 Ga0068856_100397435 3300005614 Bacteria 1398
112 Ga0068856_100702586 3300005614 Bacteria 1031
113 Ga0068856_100712072 3300005614 Bacteria 1024
114 Ga0068856_101017184 3300005614 Bacteria 847
115 Ga0070702_100041257 3300005615 Bacteria 2587
116 Ga0068852_100000028 3300005616 Bacteria 113383
117 Ga0068852_100000279 3300005616 Bacteria 34158
118 Ga0068852_100069816 3300005616 Bacteria 3080
119 Ga0068852_100242404 3300005616 Bacteria 1723
120 Ga0068852_100638002 3300005616 Unclassified 1072
121 Ga0068859_100016489 3300005617 Bacteria 7419
122 Ga0068859_100127512 3300005617 Bacteria 2615
123 Ga0068859_100161262 3300005617 Unclassified 2321
124 Ga0068864_100001286 3300005618 Bacteria 20880
125 Ga0068866_10018412 3300005718 Bacteria 3158
126 Ga0068861_100102817 3300005719 Bacteria 2276
127 Ga0068851_10012455 3300005834 Bacteria 4010
128 Ga0068851_10027971 3300005834 Bacteria 2783
129 Ga0068851_10111622 3300005834 Bacteria 1460
130 Ga0068851_10300879 3300005834 Bacteria 922
131 Ga0068863_100005494 3300005841 Bacteria 12474
132 Ga0068863_100017068 3300005841 Bacteria 6962
133 Ga0068863_100252730 3300005841 Unclassified 1703
134 Ga0068858_100318406 3300005842 Bacteria 1486
135 Ga0068858_101366842 3300005842 Unclassified 697
136 Ga0068860_100027866 3300005843 Bacteria 5440
137 Ga0068860_100058822 3300005843 Bacteria 3655
138 Ga0068860_100122255 3300005843 Unclassified 2494
139 Ga0068860_100455192 3300005843 Bacteria 1273
140 Ga0068862_100174839 3300005844 Bacteria 1924
141 Ga0068862_100203151 3300005844 Bacteria 1788
142 Ga0081455_10266799 3300005937 Unclassified 1244
143 Ga0070717_10143510 3300006028 Bacteria 2061
144 Ga0070717_10151288 3300006028 Bacteria 2008
145 Ga0070717_10165511 3300006028 Bacteria 1921
146 Ga0070712_100137248 3300006175 Unclassified 1861
147 Ga0070712_100164252 3300006175 Bacteria 1717
148 Ga0070712_100396013 3300006175 Bacteria 1139
149 Ga0070712_100591878 3300006175 Bacteria 938
150 Ga0070712_100697107 3300006175 Bacteria 865
151 Ga0097621_100001491 3300006237 Bacteria 16046
152 Ga0097621_100007170 3300006237 Bacteria 7951
153 Ga0097621_100024661 3300006237 Bacteria 4700
154 Ga0097621_100106969 3300006237 Bacteria 2360
155 Ga0097621_101542400 3300006237 Unclassified 631
156 Ga0068871_100001657 3300006358 Bacteria 14981
157 Ga0068871_100007680 3300006358 Bacteria 7713
158 Ga0068865_100070064 3300006881 Bacteria 2483
159 Ga0097620_100016488 3300006931 Bacteria 7419
160 Ga0097620_100127508 3300006931 Bacteria 2615
161 Ga0097620_100161264 3300006931 Unclassified 2321
162 Ga0099794_10047956 3300007265 Unclassified 2050
163 Ga0099794_10072516 3300007265 Bacteria 1688
164 Ga0105240_10000455 3300009093 Bacteria 75347
165 Ga0105240_10000897 3300009093 Bacteria 53086
166 Ga0105240_10006920 3300009093 Bacteria 16566
167 Ga0105240_10008023 3300009093 Bacteria 15199
168 Ga0105240_10011558 3300009093 Bacteria 12284
169 Ga0105240_10034097 3300009093 Bacteria 6569
170 Ga0105240_10118357 3300009093 Bacteria 3192
171 Ga0105240_11056526 3300009093 Bacteria 866
172 Ga0111539_10017608 3300009094 Bacteria 8843
173 Ga0105245_10002457 3300009098 Bacteria 16755
174 Ga0105245_10029418 3300009098 Bacteria 4853
175 Ga0105247_10105922 3300009101 Bacteria 1803
176 Ga0105247_10243401 3300009101 Bacteria 1226
177 Ga0114129_10325705 3300009147 Bacteria 2042
178 Ga0105241_10000033 3300009174 Bacteria 118315
179 Ga0105241_10000162 3300009174 Bacteria 48662
180 Ga0105241_10002556 3300009174 Bacteria 13663
181 Ga0105241_10013111 3300009174 Bacteria 6081
182 Ga0105241_10035460 3300009174 Bacteria 3752
183 Ga0105241_10343541 3300009174 Bacteria 1294
184 Ga0105241_10769103 3300009174 Bacteria 884
185 Ga0105242_10074361 3300009176 Bacteria 2827
186 Ga0105242_10132231 3300009176 Bacteria 2155
187 Ga0105248_10002740 3300009177 Bacteria 19565
188 Ga0105248_10040425 3300009177 Bacteria 5227
189 Ga0105248_10048203 3300009177 Bacteria 4778
190 Ga0105248_11006776 3300009177 Bacteria 941
191 Ga0105237_10001833 3300009545 Bacteria 27378
192 Ga0105237_10009925 3300009545 Bacteria 10157
193 Ga0105237_10034617 3300009545 Bacteria 5113
194 Ga0105237_10060027 3300009545 Bacteria 3804
195 Ga0105237_10460375 3300009545 Bacteria 1278
196 Ga0105238_10000373 3300009551 Bacteria 48142
197 Ga0105238_10004827 3300009551 Bacteria 13339
198 Ga0105238_10023715 3300009551 Bacteria 6253
199 Ga0105238_10218762 3300009551 Bacteria 1880
200 Ga0105238_10236045 3300009551 Bacteria 1806
201 Ga0105238_10286272 3300009551 Bacteria 1630
202 Ga0105239_10000774 3300010375 Bacteria 45307
203 Ga0105239_10001644 3300010375 Bacteria 29466
204 Ga0105239_10009598 3300010375 Bacteria 10885
205 Ga0105239_10038961 3300010375 Bacteria 5206
206 Ga0105239_10906836 3300010375 Bacteria 1012
207 Ga0105239_11404160 3300010375 Bacteria 806
208 Ga0105239_11553156 3300010375 Unclassified 765
209 Ga0105246_10006147 3300011119 Bacteria 7326
210 Ga0105246_10008504 3300011119 Bacteria 6311
211 Ga0105246_10997252 3300011119 Bacteria 758
212 Ga0157373_10138446 3300013100 Bacteria 1712
213 Ga0157373_10233379 3300013100 Bacteria 1300
214 Ga0157370_10000003 3300013104 Bacteria 367417
215 Ga0157369_10000245 3300013105 Bacteria 75320
216 Ga0157369_10002717 3300013105 Bacteria 21119
217 Ga0157369_10002731 3300013105 Bacteria 21071
218 Ga0157369_10004263 3300013105 Bacteria 16906
219 Ga0157369_10012628 3300013105 Bacteria 9577
220 Ga0157369_10014495 3300013105 Bacteria 8895
221 Ga0157369_10066154 3300013105 Bacteria 3888
222 Ga0157369_10568032 3300013105 Bacteria 1172
223 Ga0157374_10010998 3300013296 Bacteria 7815
224 Ga0157374_10022166 3300013296 Bacteria 5664
225 Ga0157374_10146257 3300013296 Bacteria 2295
226 Ga0157374_10196741 3300013296 Bacteria 1973
227 Ga0157374_11019314 3300013296 Unclassified 847
228 Ga0157374_11486194 3300013296 Bacteria 701
229 Ga0157378_10000757 3300013297 Bacteria 30212
230 Ga0157378_10003020 3300013297 Bacteria 14952
231 Ga0157378_10006857 3300013297 Bacteria 9935
232 Ga0157378_10221245 3300013297 Bacteria 1800
233 Ga0157378_10867270 3300013297 Bacteria 932
234 Ga0163162_10000661 3300013306 Bacteria 31916
235 Ga0163162_10110152 3300013306 Bacteria 2851
236 Ga0157372_10000427 3300013307 Bacteria 46281
237 Ga0157372_10001123 3300013307 Bacteria 29091
238 Ga0157372_10010821 3300013307 Bacteria 9712
239 Ga0157372_10013899 3300013307 Bacteria 8601
240 Ga0157372_10063279 3300013307 Bacteria 4148
241 Ga0157372_10153410 3300013307 Bacteria 2659
242 Ga0157372_10205482 3300013307 Bacteria 2282
243 Ga0157375_10008384 3300013308 Bacteria 9053
244 Ga0157375_10130324 3300013308 Unclassified 2633
245 Ga0157375_10549903 3300013308 Bacteria 1316
246 Ga0157375_11919557 3300013308 Bacteria 703
247 Ga0163163_10009870 3300014325 Bacteria 8554
248 Ga0163163_10181930 3300014325 Bacteria 2149
249 Ga0163163_10380894 3300014325 Bacteria 1468
250 Ga0157380_10034872 3300014326 Unclassified 3883
251 Ga0157380_10083602 3300014326 Unclassified 2615
252 Ga0157377_10422903 3300014745 Bacteria 913
253 Ga0157379_10003616 3300014968 Bacteria 13119
254 Ga0157379_10260246 3300014968 Unclassified 1576
255 Ga0157376_10008102 3300014969 Bacteria 7552
256 Ga0157376_10044024 3300014969 Bacteria 3667
257 Ga0157376_10121199 3300014969 Bacteria 2318
258 Ga0157376_10208175 3300014969 Bacteria 1804
259 Ga0184594_104936 3300019181 Bacteria 1078
260 Ga0184603_133599 3300019192 Bacteria 713
261 Ga0197907_11105612 3300020069 Bacteria 1213
262 Ga0206355_1489919 3300020076 Bacteria 1218
263 Ga0206355_1557848 3300020076 Bacteria 924
264 Ga0206355_1641001 3300020076 Unclassified 603
265 Ga0206352_10210310 3300020078 Bacteria 1285
266 Ga0206352_10482495 3300020078 Bacteria 1207
267 Ga0206350_10077430 3300020080 Bacteria 784
268 Ga0213872_10001383 3300021361 Bacteria 15953
269 Ga0213872_10010184 3300021361 Bacteria 4482
270 Ga0213872_10019456 3300021361 Bacteria 3128
271 Ga0213872_10064065 3300021361 Unclassified 1660
272 Ga0213872_10125490 3300021361 Bacteria 1133
273 Ga0213876_10042837 3300021384 Bacteria 2392
274 Ga0213875_10004875 3300021388 Bacteria 7279
275 Ga0213875_10005299 3300021388 Bacteria 6939
276 Ga0213875_10045951 3300021388 Bacteria 2049
277 Ga0213871_10049167 3300021441 Unclassified 1151
278 Ga0213871_10052582 3300021441 Bacteria 1119
279 Ga0224712_10151767 3300022467 Unclassified 1027
280 Ga0224712_10252927 3300022467 Bacteria 814
281 Ga0207673_1026299 3300025290 Bacteria 798
282 Ga0207697_10039079 3300025315 Bacteria 1947
283 Ga0207656_10009821 3300025321 Bacteria 3561
284 Ga0207656_10036273 3300025321 Bacteria 2069
285 Ga0207656_10167461 3300025321 Bacteria 1049
286 Ga0207692_10041814 3300025898 Bacteria 2272
287 Ga0207642_10013732 3300025899 Bacteria 2965
288 Ga0207710_10149810 3300025900 Bacteria 1131
289 Ga0207680_10112063 3300025903 Bacteria 1771
290 Ga0207647_10044248 3300025904 Bacteria 2783
291 Ga0207685_10049369 3300025905 Unclassified 1616
292 Ga0207699_10077832 3300025906 Bacteria 2048
293 Ga0207699_10214903 3300025906 Unclassified 1310
294 Ga0207645_10005440 3300025907 Bacteria 9229
295 Ga0207645_10023904 3300025907 Unclassified 3966
296 Ga0207705_10077460 3300025909 Bacteria 2419
297 Ga0207705_10543053 3300025909 Bacteria 903
298 Ga0207684_10024201 3300025910 Bacteria 5178
299 Ga0207684_10056581 3300025910 Bacteria 3327
300 Ga0207654_10000702 3300025911 Bacteria 18704
301 Ga0207654_10001855 3300025911 Bacteria 10935
302 Ga0207654_10002979 3300025911 Bacteria 8589
303 Ga0207654_10015190 3300025911 Bacteria 3991
304 Ga0207695_10000119 3300025913 Bacteria 235221
305 Ga0207695_10000129 3300025913 Bacteria 225939
306 Ga0207695_10000598 3300025913 Bacteria 72240
307 Ga0207695_10001155 3300025913 Bacteria 45756
308 Ga0207695_10021197 3300025913 Bacteria 7422
309 Ga0207695_10204448 3300025913 Bacteria 1888
310 Ga0207695_10225325 3300025913 Bacteria 1781
311 Ga0207695_10276558 3300025913 Bacteria 1573
312 Ga0207671_10000047 3300025914 Bacteria 196307
313 Ga0207671_10000238 3300025914 Bacteria 82806
314 Ga0207671_10018296 3300025914 Bacteria 5378
315 Ga0207671_10076729 3300025914 Bacteria 2501
316 Ga0207671_10276354 3300025914 Unclassified 1324
317 Ga0207693_10030830 3300025915 Bacteria 4235
318 Ga0207693_10031786 3300025915 Bacteria 4171
319 Ga0207693_10172225 3300025915 Bacteria 1704
320 Ga0207663_10020078 3300025916 Bacteria 3779
321 Ga0207663_10273721 3300025916 Bacteria 1251
322 Ga0207649_10008538 3300025920 Bacteria 5587
323 Ga0207649_10027297 3300025920 Bacteria 3349
324 Ga0207649_10164937 3300025920 Bacteria 1538
325 Ga0207652_10932973 3300025921 Bacteria 765
326 Ga0207646_10116626 3300025922 Bacteria 2398
327 Ga0207646_10171838 3300025922 Bacteria 1957
328 Ga0207681_10182205 3300025923 Bacteria 1601
329 Ga0207681_10195015 3300025923 Bacteria 1552
330 Ga0207694_10000089 3300025924 Bacteria 103520
331 Ga0207694_10000198 3300025924 Bacteria 60251
332 Ga0207694_10001800 3300025924 Bacteria 17856
333 Ga0207694_10044365 3300025924 Bacteria 3434
334 Ga0207694_10323118 3300025924 Bacteria 1274
335 Ga0207650_10014314 3300025925 Bacteria 5513
336 Ga0207650_10158581 3300025925 Bacteria 1791
337 Ga0207659_10259030 3300025926 Bacteria 1414
338 Ga0207687_10003932 3300025927 Bacteria 9956
339 Ga0207687_10019681 3300025927 Bacteria 4474
340 Ga0207687_10073224 3300025927 Bacteria 2453
341 Ga0207687_10155933 3300025927 Bacteria 1747
342 Ga0207700_10023125 3300025928 Bacteria 4279
343 Ga0207700_10088311 3300025928 Bacteria 2441
344 Ga0207664_10529931 3300025929 Bacteria 1056
345 Ga0207644_10031641 3300025931 Bacteria 3687
346 Ga0207644_10035817 3300025931 Bacteria 3480
347 Ga0207644_10055294 3300025931 Bacteria 2861
348 Ga0207706_10040685 3300025933 Bacteria 4120
349 Ga0207706_10093164 3300025933 Bacteria 2649
350 Ga0207686_10237463 3300025934 Bacteria 1325
351 Ga0207686_10341471 3300025934 Bacteria 1125
352 Ga0207709_10749326 3300025935 Bacteria 785
353 Ga0207669_10337912 3300025937 Bacteria 1159
354 Ga0207704_10062596 3300025938 Bacteria 2314
355 Ga0207704_10196472 3300025938 Unclassified 1472
356 Ga0207665_10142038 3300025939 Bacteria 1713
357 Ga0207665_10318633 3300025939 Bacteria 1166
358 Ga0207665_10728219 3300025939 Bacteria 781
359 Ga0207691_10141617 3300025940 Bacteria 2119
360 Ga0207711_10196170 3300025941 Bacteria 1841
361 Ga0207689_10004438 3300025942 Bacteria 12726
362 Ga0207689_10197950 3300025942 Bacteria 1658
363 Ga0207689_10416610 3300025942 Bacteria 1120
364 Ga0207661_10000111 3300025944 Bacteria 51639
365 Ga0207661_10014635 3300025944 Bacteria 5754
366 Ga0207661_10061222 3300025944 Bacteria 3040
367 Ga0207661_10555036 3300025944 Bacteria 1052
368 Ga0207679_10312603 3300025945 Bacteria 1358
369 Ga0207679_10449006 3300025945 Bacteria 1143
370 Ga0207679_10572712 3300025945 Bacteria 1015
371 Ga0207679_11001810 3300025945 Bacteria 766
372 Ga0207667_10001612 3300025949 Bacteria 28380
373 Ga0207667_10004717 3300025949 Bacteria 16689
374 Ga0207667_10009053 3300025949 Bacteria 11772
375 Ga0207667_10061527 3300025949 Bacteria 3927
376 Ga0207667_10546535 3300025949 Bacteria 1172
377 Ga0207651_10061753 3300025960 Bacteria 2608
378 Ga0207651_10900251 3300025960 Bacteria 788
379 Ga0207668_10042098 3300025972 Bacteria 3091
380 Ga0207640_10020798 3300025981 Bacteria 3901
381 Ga0207640_10067336 3300025981 Bacteria 2396
382 Ga0207640_10396856 3300025981 Bacteria 1122
383 Ga0207658_10000076 3300025986 Bacteria 108585
384 Ga0207658_10173758 3300025986 Bacteria 1777
385 Ga0207658_10226366 3300025986 Bacteria 1576
386 Ga0207677_10000266 3300026023 Bacteria 39403
387 Ga0207677_10063181 3300026023 Bacteria 2572
388 Ga0207677_10124687 3300026023 Bacteria 1944
389 Ga0207703_10285600 3300026035 Bacteria 1500
390 Ga0207639_10000674 3300026041 Bacteria 23583
391 Ga0207639_10118265 3300026041 Bacteria 2173
392 Ga0207708_10051848 3300026075 Plasmid 3125
393 Ga0207702_10000476 3300026078 Bacteria 45021
394 Ga0207702_10004827 3300026078 Bacteria 11876
395 Ga0207702_10023750 3300026078 Bacteria 5086
396 Ga0207702_10195832 3300026078 Bacteria 1870
397 Ga0207702_10197076 3300026078 Bacteria 1865
398 Ga0207702_10378339 3300026078 Bacteria 1361
399 Ga0207702_11278349 3300026078 Bacteria 728
400 Ga0207641_10002110 3300026088 Bacteria 18798
401 Ga0207641_10194655 3300026088 Bacteria 1865
402 Ga0207676_10007866 3300026095 Bacteria 7581
403 Ga0207676_10054161 3300026095 Bacteria 3143
404 Ga0207674_10008090 3300026116 Bacteria 12190
405 Ga0207674_10011741 3300026116 Bacteria 9828
406 Ga0207674_10287577 3300026116 Bacteria 1592
407 Ga0207674_10883996 3300026116 Bacteria 861
408 Ga0207675_100122509 3300026118 Bacteria 2461
409 Ga0207683_10004009 3300026121 Bacteria 12743
410 Ga0207698_10000027 3300026142 Bacteria 119295
411 Ga0207698_10002999 3300026142 Bacteria 10131
412 Ga0207698_10260882 3300026142 Bacteria 1592
413 Ga0207698_10380597 3300026142 Unclassified 1342
414 Ga0207698_10541671 3300026142 Bacteria 1139
415 Ga0209588_1073533 3300027671 Unclassified 1104
416 Ga0207428_10189519 3300027907 Bacteria 1551
417 Ga0268266_10066878 3300028379 Bacteria 3109
418 Ga0268266_10078767 3300028379 Bacteria 2868
419 Ga0268266_10864614 3300028379 Bacteria 874
420 Ga0268265_10153340 3300028380 Bacteria 1946
421 Ga0268264_10018672 3300028381 Bacteria 5669
422 Ga0268264_10083410 3300028381 Unclassified 2738
423 Ga0268264_10593202 3300028381 Unclassified 1091
424 Ga0265334_10081275 3300028573 Unclassified 1193
425 Ga0265338_10048441 3300028800 Bacteria 3865
426 Ga0265338_10214186 3300028800 Unclassified 1444
427 Ga0265765_1011054 3300030879 Bacteria 1010
428 Ga0247549_103184 3300030942 Bacteria 600
429 Ga0265760_10110899 3300031090 Bacteria 874
430 Ga0265328_10017958 3300031239 Bacteria 2734
431 Ga0265320_10035531 3300031240 Bacteria 2526
432 Ga0265340_10028667 3300031247 Bacteria 2800
433 Ga0265340_10046168 3300031247 Bacteria 2125
434 Ga0265339_10000026 3300031249 Bacteria 165764
435 Ga0265339_10019369 3300031249 Bacteria 3997
436 Ga0265339_10023188 3300031249 Bacteria 3590
437 Ga0265331_10016652 3300031250 Bacteria 3853
438 Ga0265331_10202644 3300031250 Bacteria 894
439 Ga0265316_10035321 3300031344 Bacteria 4051
440 Ga0265316_10058311 3300031344 Bacteria 3008
441 Ga0265316_10245558 3300031344 Bacteria 1315
442 Ga0265316_10280645 3300031344 Bacteria 1217
443 Ga0265316_10329984 3300031344 Bacteria 1107
444 Ga0265316_10506823 3300031344 Bacteria 862
445 Ga0307408_100056999 3300031548 Bacteria 2835
446 Ga0307408_100876153 3300031548 Unclassified 820
447 Ga0307408_101065588 3300031548 Bacteria 748
448 Ga0265313_10026305 3300031595 Bacteria 3067
449 Ga0265313_10130985 3300031595 Bacteria 1086
450 Ga0265314_10023919 3300031711 Bacteria 4644
451 Ga0265314_10063037 3300031711 Bacteria 2516
452 Ga0265314_10107846 3300031711 Bacteria 1776
453 Ga0265314_10375507 3300031711 Bacteria 775
454 Ga0265342_10001312 3300031712 Bacteria 23334
455 Ga0265342_10001460 3300031712 Bacteria 22002
456 Ga0307405_10598492 3300031731 Bacteria 899
457 Ga0247548_101523 3300031814 Bacteria 945
458 Ga0247548_102796 3300031814 Bacteria 771
459 Ga0307410_10005777 3300031852 Bacteria 6596
460 Ga0307410_10033021 3300031852 Bacteria 3338
461 Ga0307406_10021265 3300031901 Bacteria 3836
462 Ga0307406_10329956 3300031901 Bacteria 1184
463 Ga0307412_10141655 3300031911 Bacteria 1762
464 Ga0307409_101618931 3300031995 Unclassified 676
465 Ga0307416_100011820 3300032002 Bacteria 5849
466 Ga0307411_10028784 3300032005 Bacteria 3383
467 Ga0307411_11086390 3300032005 Unclassified 720
468 Ga0373934_0004913 3300035086 Unclassified 4948
469 Ga0373953_0061375 3300035117 Bacteria 1537
470 Ga0373954_0009399 3300035118 Bacteria 4299
471 Ga0373956_0001900 3300035119 Bacteria 8617
472 Ga0373956_0335385 3300035119 Bacteria 721
473 Ga0373957_0029552 3300035120 Bacteria 2003
474 Ga0373943_0180152 3300035170 Bacteria 1161
475 Ga0373955_0002208 3300035172 Bacteria 8449
476 Ga0373924_0283585 3300035410 Bacteria 735
477 Ga0373927_0033168 3300035695 Bacteria 3362
478 Ga0373933_0014903 3300035724 Unclassified 4328
479 Ga0373933_0129170 3300035724 Bacteria 1588
480 Ga0373933_0486727 3300035724 Bacteria 808
481 Ga0373947_0336351 3300035725 Bacteria 1011
482 Ga0373937_0005347 3300036401 Bacteria 10980
483 Ga0373937_0056878 3300036401 Bacteria 3592
484 Ga0373937_0083645 3300036401 Unclassified 2952
485 Ga0373937_0557267 3300036401 Bacteria 1089
486 Ga0265778_010766 3300036457 Bacteria 1046
487 Ga0436364_0699928 3300037853 Bacteria 1210
488 Ga0395901_0325112 3300038443 Bacteria 1591
489 Ga0436360_0142957 3300039438 Unclassified 1403
490 Ga0436360_0173325 3300039438 Bacteria 8301
491 Ga0436360_1258089 3300039438 Bacteria 634
492 Ga0436361_0064205 3300039447 Bacteria 3244
493 Ga0436361_0500168 3300039447 Bacteria 41610
494 Ga0436361_0799963 3300039447 Bacteria 7837
495 Ga0436361_1202653 3300039447 Bacteria 36636
496 Ga0466963_0016153 3300044694 Bacteria 4639
497 Ga0466958_0293784 3300045836 Bacteria 1043
498 Ga0466967_0002815 3300045976 Bacteria 11035
499 Ga0466967_0823053 3300045976 Bacteria 922
500 Ga0495629_0029145 3300046459 Bacteria 3917
501 Ga0495629_0185924 3300046459 Bacteria 1439
502 Ga0495629_0280690 3300046459 Bacteria 1143
503 Ga0495651_0077546 3300046462 Unclassified 2515
504 Ga0495580_0061591 3300046472 Bacteria 2634
505 Ga0495580_0199476 3300046472 Bacteria 1379
506 Ga0495664_0136482 3300046477 Bacteria 1486
507 Ga0495664_0151899 3300046477 Bacteria 1405
508 Ga0495628_0082763 3300046516 Bacteria 2493
509 Ga0495665_0101014 3300046531 Bacteria 1514
510 Ga0495640_0359893 3300046533 Bacteria 897
511 Ga0495587_0055739 3300046536 Unclassified 2327
512 Ga0495587_0151978 3300046536 Bacteria 1319
513 Ga0495645_0008717 3300046543 Bacteria 7078
514 Ga0495667_0032320 3300046559 Unclassified 3508
515 Ga0495625_0337922 3300046660 Bacteria 955
516 Ga0495657_0043839 3300046675 Bacteria 3047
517 Ga0495623_0041844 3300046679 Bacteria 2920
518 Ga0495623_0337399 3300046679 Bacteria 824
519 Ga0495646_0112711 3300046680 Bacteria 1547
520 Ga0495613_0051237 3300046689 Bacteria 3043
521 Ga0495600_0057218 3300046809 Unclassified 2548
522 Ga0495600_0313923 3300046809 Bacteria 987
523 Ga0495581_0646778 3300047315 Bacteria 611
524 Ga0495604_0003331 3300047317 Bacteria 12806
525 Ga0495604_0066562 3300047317 Bacteria 2740
526 Ga0495604_0072019 3300047317 Bacteria 2613
527 Ga0495604_0275220 3300047317 Unclassified 1139
528 Ga0495676_0477513 3300047321 Bacteria 820
529 Ga0495684_0005170 3300047471 Bacteria 10170
530 Ga0495684_0042661 3300047471 Bacteria 3474
531 Ga0495684_0187104 3300047471 Bacteria 1533
532 Ga0495593_0335393 3300047673 Unclassified 756
533 Ga0495602_0065334 3300048088 Unclassified 3140
534 Ga0495602_0071080 3300048088 Bacteria 2974
535 Ga0496100_0390317 3300048903 Bacteria 1058
536 Ga0496101_0099491 3300048904 Bacteria 2174
537 Ga0496102_0034225 3300048905 Bacteria 4569
538 Ga0496102_0053634 3300048905 Bacteria 3675
539 Ga0496102_0698589 3300048905 Bacteria 937
540 Ga0496103_0195097 3300048906 Unclassified 1302
541 Ga0496105_0334902 3300048908 Bacteria 1211
542 Ga0496106_0064694 3300048909 Bacteria 2783
543 Ga0496107_0245620 3300048910 Bacteria 1332
544 Ga0496107_0279072 3300048910 Bacteria 1244
545 Ga0496108_0033955 3300048911 Bacteria 4237
546 Ga0496108_0078061 3300048911 Bacteria 2802
547 Ga0496109_0084963 3300048912 Bacteria 2920
548 Ga0496109_0211949 3300048912 Bacteria 1822
549 Ga0496110_0097241 3300048913 Bacteria 2638
550 Ga0496110_0514598 3300048913 Unclassified 1089
551 Ga0496111_0131248 3300048914 Bacteria 1854
552 Ga0496112_0059715 3300048915 Bacteria 3757
553 Ga0496113_0016649 3300048916 Bacteria 5082
554 Ga0496113_0057140 3300048916 Bacteria 2931
555 Ga0496114_0097856 3300048917 Bacteria 2500
556 Ga0496114_0390261 3300048917 Bacteria 1233
557 Ga0496115_0001363 3300048918 Bacteria 17438
558 Ga0496115_0055303 3300048918 Bacteria 3188
559 Ga0496115_0099216 3300048918 Bacteria 2386
560 Ga0496115_0182201 3300048918 Bacteria 1736
561 Ga0496126_0231755 3300048929 Bacteria 1547
562 Ga0501292_091164 3300049515 Unclassified 592
563 Ga0501293_010975 3300049516 Unclassified 789
564 Ga0501297_003269 3300049520 Unclassified 1604
565 Ga0501298_006797 3300049521 Unclassified 1882
566 Ga0501299_012290 3300049522 Unclassified 1458
567 Ga0501039_0804565 3300049575 Unclassified 733
568 Ga0501202_034765 3300049652 Unclassified 1066
569 Ga0501224_040542 3300049664 Unclassified 704
570 Ga0501227_151739 3300049665 Unclassified 640
571 Ga0501249_070718 3300049679 Unclassified 815
572 Ga0501251_017523 3300049681 Unclassified 921
573 Ga0501221_006843 3300049704 Unclassified 1939
574 Ga0501225_0030132 3300049705 Unclassified 1492
575 Ga0501225_0035560 3300049705 Bacteria 1372
576 Ga0501245_025115 3300049708 Unclassified 956
577 Ga0501081_0428932 3300049743 Bacteria 981
578 Ga0501083_0126409 3300049744 Bacteria 1676
579 Ga0501283_001531 3300049779 Bacteria 2998
580 Ga0501212_012448 3300049851 Unclassified 1238
581 nmdc:mga05p37_215843_c1 3300050507 Bacteria 2317
582 nmdc:mga08y16_80872_c1 3300050511 Bacteria 3388
583 nmdc:mga08x19_109300_c1 3300050514 Bacteria 1843
584 Ga0495601_0109625 3300053077 Bacteria 1787
585 Ga0495601_0347211 3300053077 Bacteria 965
586 Ga0495595_0193391 3300053084 Bacteria 1011
587 Ga0495619_0058026 3300053085 Bacteria 2569
588 Ga0500590_064433 3300053148 Unclassified 1835
589 Ga0070714_100227434
590 JGI24738J21930_10056696
591 rootH2_10168798
592 rootL2_10087918
593 Ga0058862_10057807
594 Ga0065712_10003013
595 Ga0065715_10003784
596 Ga0070658_10075613
597 Ga0070658_10194031
598 Ga0070658_10438717
599 Ga0070676_10031859
600 Ga0070683_100001021
601 Ga0070683_100003703
602 Ga0070683_100049111
603 Ga0070683_100082852
604 Ga0070670_100021720
605 Ga0070670_101130183
606 Ga0068869_100018400
607 Ga0068869_100174292
608 Ga0068869_100845270
609 Ga0070666_10066052
610 Ga0070666_10324127
611 Ga0070680_100022606
612 Ga0068868_100001328
613 Ga0068868_100006230
614 Ga0068868_100017875
615 Ga0070660_100453209
616 Ga0070687_100351989
617 Ga0070661_100001378
618 Ga0070661_100072701
619 Ga0070661_100194049
620 Ga0070668_100103944
621 Ga0070669_100045923
622 Ga0070669_100093242
623 Ga0070675_100040301
624 Ga0070675_100244654
625 Ga0070671_100004759
626 Ga0070671_100034206
627 Ga0070671_100102696
628 Ga0070673_101311897
629 Ga0070688_100958020
630 Ga0070667_100027240
631 Ga0070667_100534713
632 Ga0070709_10683243
633 Ga0070714_100005104
634 Ga0070714_101446665
635 Ga0070713_100041657
636 Ga0070713_100437835
637 Ga0070710_10310412
638 Ga0070711_100020951
639 Ga0070711_100029570
640 Ga0070711_100088648
641 Ga0070711_100267983
642 Ga0070711_100623453
643 Ga0070700_100026506
644 Ga0070708_100027244
645 Ga0070708_100366781
646 Ga0070678_100041369
647 Ga0070662_100034795
648 Ga0070662_100685512
649 Ga0068867_100569384
650 Ga0068867_100591920
651 Ga0070685_10384717
652 Ga0070706_100342287
653 Ga0070706_100861831
654 Ga0070707_100099388
655 Ga0070707_100167518
656 Ga0070707_101415757
657 Ga0070707_101719050
658 Ga0070698_100012337
659 Ga0070698_100081393
660 Ga0070699_100297803
661 Ga0070684_100001524
662 Ga0070684_100006401
663 Ga0070684_100365421
664 Ga0070697_100004697
665 Ga0070697_100008913
666 Ga0070697_100065708
667 Ga0068853_100000459
668 Ga0068853_100144096
669 Ga0068853_100564849
670 Ga0070686_100113596
671 Ga0070696_100026027
672 Ga0070693_100030925
673 Ga0070693_100488640
674 Ga0070665_100129680
675 Ga0070665_100325004
676 Ga0070665_100370710
677 Ga0068855_100005638
678 Ga0068855_100007635
679 Ga0068855_100008401
680 Ga0068855_100036215
681 Ga0068855_100069195
682 Ga0068855_100165457
683 Ga0070664_100225246
684 Ga0070664_100306437
685 Ga0070664_100337198
686 Ga0070664_100363075
687 Ga0068857_100000342
688 Ga0068857_100004532
689 Ga0068857_100905290
690 Ga0068857_101075442
691 Ga0068854_100048081
692 Ga0068854_100078240
693 Ga0068856_100003675
694 Ga0068856_100014690
695 Ga0068856_100034915
696 Ga0068856_100059658
697 Ga0068856_100079493
698 Ga0068856_100170590
699 Ga0068856_100397435
700 Ga0068856_100702586
701 Ga0068856_100712072
702 Ga0068856_101017184
703 Ga0070702_100041257
704 Ga0068852_100000028
705 Ga0068852_100000279
706 Ga0068852_100069816
707 Ga0068852_100242404
708 Ga0068852_100638002
709 Ga0068859_100016489
710 Ga0068859_100127512
711 Ga0068859_100161262
712 Ga0068864_100001286
713 Ga0068866_10018412
714 Ga0068861_100102817
715 Ga0068851_10012455
716 Ga0068851_10027971
717 Ga0068851_10111622
718 Ga0068851_10300879
719 Ga0068863_100005494
720 Ga0068863_100017068
721 Ga0068863_100252730
722 Ga0068858_100318406
723 Ga0068858_101366842
724 Ga0068860_100027866
725 Ga0068860_100058822
726 Ga0068860_100122255
727 Ga0068860_100455192
728 Ga0068862_100174839
729 Ga0068862_100203151
730 Ga0081455_10266799
731 Ga0070717_10143510
732 Ga0070717_10151288
733 Ga0070717_10165511
734 Ga0070712_100137248
735 Ga0070712_100164252
736 Ga0070712_100396013
737 Ga0070712_100591878
738 Ga0070712_100697107
739 Ga0097621_100001491
740 Ga0097621_100007170
741 Ga0097621_100024661
742 Ga0097621_100106969
743 Ga0097621_101542400
744 Ga0068871_100001657
745 Ga0068871_100007680
746 Ga0068865_100070064
747 Ga0097620_100016488
748 Ga0097620_100127508
749 Ga0097620_100161264
750 Ga0099794_10047956
751 Ga0099794_10072516
752 Ga0105240_10000455
753 Ga0105240_10000897
754 Ga0105240_10006920
755 Ga0105240_10008023
756 Ga0105240_10011558
757 Ga0105240_10034097
758 Ga0105240_10118357
759 Ga0105240_11056526
760 Ga0111539_10017608
761 Ga0105245_10002457
762 Ga0105245_10029418
763 Ga0105247_10105922
764 Ga0105247_10243401
765 Ga0114129_10325705
766 Ga0105241_10000033
767 Ga0105241_10000162
768 Ga0105241_10002556
769 Ga0105241_10013111
770 Ga0105241_10035460
771 Ga0105241_10343541
772 Ga0105241_10769103
773 Ga0105242_10074361
774 Ga0105242_10132231
775 Ga0105248_10002740
776 Ga0105248_10040425
777 Ga0105248_10048203
778 Ga0105248_11006776
779 Ga0105237_10001833
780 Ga0105237_10009925
781 Ga0105237_10034617
782 Ga0105237_10060027
783 Ga0105237_10460375
784 Ga0105238_10000373
785 Ga0105238_10004827
786 Ga0105238_10023715
787 Ga0105238_10218762
788 Ga0105238_10236045
789 Ga0105238_10286272
790 Ga0105239_10000774
791 Ga0105239_10001644
792 Ga0105239_10009598
793 Ga0105239_10038961
794 Ga0105239_10906836
795 Ga0105239_11404160
796 Ga0105239_11553156
797 Ga0105246_10006147
798 Ga0105246_10008504
799 Ga0105246_10997252
800 Ga0157373_10138446
801 Ga0157373_10233379
802 Ga0157370_10000003
803 Ga0157369_10000245
804 Ga0157369_10002717
805 Ga0157369_10002731
806 Ga0157369_10004263
807 Ga0157369_10012628
808 Ga0157369_10014495
809 Ga0157369_10066154
810 Ga0157369_10568032
811 Ga0157374_10010998
812 Ga0157374_10022166
813 Ga0157374_10146257
814 Ga0157374_10196741
815 Ga0157374_11019314
816 Ga0157374_11486194
817 Ga0157378_10000757
818 Ga0157378_10003020
819 Ga0157378_10006857
820 Ga0157378_10221245
821 Ga0157378_10867270
822 Ga0163162_10000661
823 Ga0163162_10110152
824 Ga0157372_10000427
825 Ga0157372_10001123
826 Ga0157372_10010821
827 Ga0157372_10013899
828 Ga0157372_10063279
829 Ga0157372_10153410
830 Ga0157372_10205482
831 Ga0157375_10008384
832 Ga0157375_10130324
833 Ga0157375_10549903
834 Ga0157375_11919557
835 Ga0163163_10009870
836 Ga0163163_10181930
837 Ga0163163_10380894
838 Ga0157380_10034872
839 Ga0157380_10083602
840 Ga0157377_10422903
841 Ga0157379_10003616
842 Ga0157379_10260246
843 Ga0157376_10008102
844 Ga0157376_10044024
845 Ga0157376_10121199
846 Ga0157376_10208175
847 Ga0184594_104936
848 Ga0184603_133599
849 Ga0197907_11105612
850 Ga0206355_1489919
851 Ga0206355_1557848
852 Ga0206355_1641001
853 Ga0206352_10210310
854 Ga0206352_10482495
855 Ga0206350_10077430
856 Ga0213872_10001383
857 Ga0213872_10010184
858 Ga0213872_10019456
859 Ga0213872_10064065
860 Ga0213872_10125490
861 Ga0213876_10042837
862 Ga0213875_10004875
863 Ga0213875_10005299
864 Ga0213875_10045951
865 Ga0213871_10049167
866 Ga0213871_10052582
867 Ga0224712_10151767
868 Ga0224712_10252927
869 Ga0207673_1026299
870 Ga0207697_10039079
871 Ga0207656_10009821
872 Ga0207656_10036273
873 Ga0207656_10167461
874 Ga0207692_10041814
875 Ga0207642_10013732
876 Ga0207710_10149810
877 Ga0207680_10112063
878 Ga0207647_10044248
879 Ga0207685_10049369
880 Ga0207699_10077832
881 Ga0207699_10214903
882 Ga0207645_10005440
883 Ga0207645_10023904
884 Ga0207705_10077460
885 Ga0207705_10543053
886 Ga0207684_10024201
887 Ga0207684_10056581
888 Ga0207654_10000702
889 Ga0207654_10001855
890 Ga0207654_10002979
891 Ga0207654_10015190
892 Ga0207695_10000119
893 Ga0207695_10000129
894 Ga0207695_10000598
895 Ga0207695_10001155
896 Ga0207695_10021197
897 Ga0207695_10204448
898 Ga0207695_10225325
899 Ga0207695_10276558
900 Ga0207671_10000047
901 Ga0207671_10000238
902 Ga0207671_10018296
903 Ga0207671_10076729
904 Ga0207671_10276354
905 Ga0207693_10030830
906 Ga0207693_10031786
907 Ga0207693_10172225
908 Ga0207663_10020078
909 Ga0207663_10273721
910 Ga0207649_10008538
911 Ga0207649_10027297
912 Ga0207649_10164937
913 Ga0207652_10932973
914 Ga0207646_10116626
915 Ga0207646_10171838
916 Ga0207681_10182205
917 Ga0207681_10195015
918 Ga0207694_10000089
919 Ga0207694_10000198
920 Ga0207694_10001800
921 Ga0207694_10044365
922 Ga0207694_10323118
923 Ga0207650_10014314
924 Ga0207650_10158581
925 Ga0207659_10259030
926 Ga0207687_10003932
927 Ga0207687_10019681
928 Ga0207687_10073224
929 Ga0207687_10155933
930 Ga0207700_10023125
931 Ga0207700_10088311
932 Ga0207664_10529931
933 Ga0207644_10031641
934 Ga0207644_10035817
935 Ga0207644_10055294
936 Ga0207706_10040685
937 Ga0207706_10093164
938 Ga0207686_10237463
939 Ga0207686_10341471
940 Ga0207709_10749326
941 Ga0207669_10337912
942 Ga0207704_10062596
943 Ga0207704_10196472
944 Ga0207665_10142038
945 Ga0207665_10318633
946 Ga0207665_10728219
947 Ga0207691_10141617
948 Ga0207711_10196170
949 Ga0207689_10004438
950 Ga0207689_10197950
951 Ga0207689_10416610
952 Ga0207661_10000111
953 Ga0207661_10014635
954 Ga0207661_10061222
955 Ga0207661_10555036
956 Ga0207679_10312603
957 Ga0207679_10449006
958 Ga0207679_10572712
959 Ga0207679_11001810
960 Ga0207667_10001612
961 Ga0207667_10004717
962 Ga0207667_10009053
963 Ga0207667_10061527
964 Ga0207667_10546535
965 Ga0207651_10061753
966 Ga0207651_10900251
967 Ga0207668_10042098
968 Ga0207640_10020798
969 Ga0207640_10067336
970 Ga0207640_10396856
971 Ga0207658_10000076
972 Ga0207658_10173758
973 Ga0207658_10226366
974 Ga0207677_10000266
975 Ga0207677_10063181
976 Ga0207677_10124687
977 Ga0207703_10285600
978 Ga0207639_10000674
979 Ga0207639_10118265
980 Ga0207708_10051848
981 Ga0207702_10000476
982 Ga0207702_10004827
983 Ga0207702_10023750
984 Ga0207702_10195832
985 Ga0207702_10197076
986 Ga0207702_10378339
987 Ga0207702_11278349
988 Ga0207641_10002110
989 Ga0207641_10194655
990 Ga0207676_10007866
991 Ga0207676_10054161
992 Ga0207674_10008090
993 Ga0207674_10011741
994 Ga0207674_10287577
995 Ga0207674_10883996
996 Ga0207675_100122509
997 Ga0207683_10004009
998 Ga0207698_10000027
999 Ga0207698_10002999
1000 Ga0207698_10260882
1001 Ga0207698_10380597
1002 Ga0207698_10541671
1003 Ga0209588_1073533
1004 Ga0207428_10189519
1005 Ga0268266_10066878
1006 Ga0268266_10078767
1007 Ga0268266_10864614
1008 Ga0268265_10153340
1009 Ga0268264_10018672
1010 Ga0268264_10083410
1011 Ga0268264_10593202
1012 Ga0265334_10081275
1013 Ga0265338_10048441
1014 Ga0265338_10214186
1015 Ga0265765_1011054
1016 Ga0247549_103184
1017 Ga0265760_10110899
1018 Ga0265328_10017958
1019 Ga0265320_10035531
1020 Ga0265340_10028667
1021 Ga0265340_10046168
1022 Ga0265339_10000026
1023 Ga0265339_10019369
1024 Ga0265339_10023188
1025 Ga0265331_10016652
1026 Ga0265331_10202644
1027 Ga0265316_10035321
1028 Ga0265316_10058311
1029 Ga0265316_10245558
1030 Ga0265316_10280645
1031 Ga0265316_10329984
1032 Ga0265316_10506823
1033 Ga0307408_100056999
1034 Ga0307408_100876153
1035 Ga0307408_101065588
1036 Ga0265313_10026305
1037 Ga0265313_10130985
1038 Ga0265314_10023919
1039 Ga0265314_10063037
1040 Ga0265314_10107846
1041 Ga0265314_10375507
1042 Ga0265342_10001312
1043 Ga0265342_10001460
1044 Ga0307405_10598492
1045 Ga0247548_101523
1046 Ga0247548_102796
1047 Ga0307410_10005777
1048 Ga0307410_10033021
1049 Ga0307406_10021265
1050 Ga0307406_10329956
1051 Ga0307412_10141655
1052 Ga0307409_101618931
1053 Ga0307416_100011820
1054 Ga0307411_10028784
1055 Ga0307411_11086390
1056 Ga0373934_0004913
1057 Ga0373953_0061375
1058 Ga0373954_0009399
1059 Ga0373956_0001900
1060 Ga0373956_0335385
1061 Ga0373957_0029552
1062 Ga0373943_0180152
1063 Ga0373955_0002208
1064 Ga0373924_0283585
1065 Ga0373927_0033168
1066 Ga0373933_0014903
1067 Ga0373933_0129170
1068 Ga0373933_0486727
1069 Ga0373947_0336351
1070 Ga0373937_0005347
1071 Ga0373937_0056878
1072 Ga0373937_0083645
1073 Ga0373937_0557267
1074 Ga0265778_010766
1075 Ga0436364_0699928
1076 Ga0395901_0325112
1077 Ga0436360_0142957
1078 Ga0436360_0173325
1079 Ga0436360_1258089
1080 Ga0436361_0064205
1081 Ga0436361_0500168
1082 Ga0436361_0799963
1083 Ga0436361_1202653
1084 Ga0466963_0016153
1085 Ga0466958_0293784
1086 Ga0466967_0002815
1087 Ga0466967_0823053
1088 Ga0495629_0029145
1089 Ga0495629_0185924
1090 Ga0495629_0280690
1091 Ga0495651_0077546
1092 Ga0495580_0061591
1093 Ga0495580_0199476
1094 Ga0495664_0136482
1095 Ga0495664_0151899
1096 Ga0495628_0082763
1097 Ga0495665_0101014
1098 Ga0495640_0359893
1099 Ga0495587_0055739
1100 Ga0495587_0151978
1101 Ga0495645_0008717
1102 Ga0495667_0032320
1103 Ga0495625_0337922
1104 Ga0495657_0043839
1105 Ga0495623_0041844
1106 Ga0495623_0337399
1107 Ga0495646_0112711
1108 Ga0495613_0051237
1109 Ga0495600_0057218
1110 Ga0495600_0313923
1111 Ga0495581_0646778
1112 Ga0495604_0003331
1113 Ga0495604_0066562
1114 Ga0495604_0072019
1115 Ga0495604_0275220
1116 Ga0495676_0477513
1117 Ga0495684_0005170
1118 Ga0495684_0042661
1119 Ga0495684_0187104
1120 Ga0495593_0335393
1121 Ga0495602_0065334
1122 Ga0495602_0071080
1123 Ga0496100_0390317
1124 Ga0496101_0099491
1125 Ga0496102_0034225
1126 Ga0496102_0053634
1127 Ga0496102_0698589
1128 Ga0496103_0195097
1129 Ga0496105_0334902
1130 Ga0496106_0064694
1131 Ga0496107_0245620
1132 Ga0496107_0279072
1133 Ga0496108_0033955
1134 Ga0496108_0078061
1135 Ga0496109_0084963
1136 Ga0496109_0211949
1137 Ga0496110_0097241
1138 Ga0496110_0514598
1139 Ga0496111_0131248
1140 Ga0496112_0059715
1141 Ga0496113_0016649
1142 Ga0496113_0057140
1143 Ga0496114_0097856
1144 Ga0496114_0390261
1145 Ga0496115_0001363
1146 Ga0496115_0055303
1147 Ga0496115_0099216
1148 Ga0496115_0182201
1149 Ga0496126_0231755
1150 Ga0501292_091164
1151 Ga0501293_010975
1152 Ga0501297_003269
1153 Ga0501298_006797
1154 Ga0501299_012290
1155 Ga0501039_0804565
1156 Ga0501202_034765
1157 Ga0501224_040542
1158 Ga0501227_151739
1159 Ga0501249_070718
1160 Ga0501251_017523
1161 Ga0501221_006843
1162 Ga0501225_0030132
1163 Ga0501225_0035560
1164 Ga0501245_025115
1165 Ga0501081_0428932
1166 Ga0501083_0126409
1167 Ga0501283_001531
1168 Ga0501212_012448
1169 nmdc:mga05p37_215843_c1
1170 nmdc:mga08y16_80872_c1
1171 nmdc:mga08x19_109300_c1
1172 Ga0495601_0109625
1173 Ga0495601_0347211
1174 Ga0495595_0193391
1175 Ga0495619_0058026
1176 Ga0500590_064433

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00578

AhpC-TSA

AhpC/TSA family

71

196

0.97

PF08534

Redoxin

Redoxin

70

213

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
3hjp-assembly2.cif.gz_D the crystal structure of bcp4 from sulfolobus solfataricus 0.9482 29 176
5iph-assembly1.cif.gz_A xanthomonas campestris peroxiredoxin q - c84s mutant 0.9462 39 177
3gkm-assembly1.cif.gz_A insights into the alkyl peroxide reduction activity of xanthomonas campestris bacterioferritin comigratory protein from the trapped intermediate/ligand complex structures 0.9445 39 179
5imf-assembly1.cif.gz_A xanthomonas campestris peroxiredoxin q - structure f5 0.9443 39 179
5io2-assembly1.cif.gz_A xanthomonas campestris peroxiredoxin q - c48s mutant 0.9433 39 179
ID Description Score Start End Superfamily
5iphA00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9462 39 177 3.40.30.10
af_Q2G280_3_151_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9412 31 174 3.40.30.10
af_P0AE52_4_156_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.94 32 177 3.40.30.10
af_P9WIE1_7_157_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9391 30 175 3.40.30.10
3drnB00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9342 30 178 3.40.30.10
ID Description Score Start End GO Terms
AF-A0A7Y2E4E3-F1-model_v4 thioredoxin-dependent peroxiredoxin (EC 1.11.1.24) (Thioredoxin peroxidase) 0.9841 29 178 GO:0005737
GO:0008379
GO:0009579
GO:0034599
GO:0045454
AF-A0A7Y2H0H7-F1-model_v4 thioredoxin-dependent peroxiredoxin (EC 1.11.1.24) (Thioredoxin peroxidase) 0.9826 26 113 GO:0005737
GO:0008379
GO:0009579
GO:0034599
GO:0045454
AF-A0A6G3HNR1-F1-model_v4 deleted 0.9764 27 124
AF-A0A7Z8QUA8-F1-model_v4 thioredoxin-dependent peroxiredoxin (EC 1.11.1.24) (Thioredoxin peroxidase) (Thioredoxin-dependent peroxiredoxin Bcp) 0.9757 29 178 GO:0005737
GO:0008379
GO:0009579
GO:0034599
GO:0045454
AF-Q1J2X2-F1-model_v4 thioredoxin-dependent peroxiredoxin (EC 1.11.1.24) (Thioredoxin peroxidase) 0.9745 28 176 GO:0005737
GO:0008379
GO:0034599
GO:0045454

Map