F466715

General Info

Members Datasets Scaffolds Average Seq Length
587 341 582 323

Family's Representative Sequence

Representative Sequence 3300050511|nmdc:mga08y16_452926_c1|nmdc:mga08y16_452926_c1_202_1290
Length 355
Sequence MSNAKIAALATARGTTMTIARRKFLHLAALPRIATAQAYPSKQLRWIVGFPPGGGADIVSRIMAPWLAERLGQSVIVENRPGASSNISVQAVVNAPPDGYTLLFLPASAAVNVSLFDNLTYNLTRDIAPVSGLIDFPLVMVANPSFPAKTVGELIAYAKANPGKVSVGSFGTGSTSHVAGELLKMMTGTSMIHVPYRGGAPMVTDLIAGQVQVGIDVLTGSLAHIRSGALRILAVAGKSRSDFLPEVPTIGETVAGYEANSWCGLGVPRGTPTEIVERLNREINAGLTNPAVKTRLADVATTPIIYTPAEFGAYVASEVDKWAKVVRTAGIRPEGVSAGTRARSAAAGSAESRAR

Samples

Sample ID Description Type Environment
1 2808606395 Achromobacter sp. SLBN-14 Isolate Unclassified
2 2855730933 Achromobacter sp. HZ28 Isolate Nodule
3 2855767633 Achromobacter sp. HZ34 Isolate Nodule
4 2881412998 Achromobacter aloeverae AVA-1 Isolate Unclassified
5 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
6 3300002073 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 Metagenome Rhizosphere
7 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
8 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
9 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
10 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
11 3300002126 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 Metagenome Rhizosphere
12 3300002155 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 Metagenome Rhizosphere
13 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
14 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
15 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
16 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
17 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
18 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
19 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
20 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
21 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
22 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
23 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
24 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
25 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
26 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
27 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
28 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
29 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
30 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
31 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
32 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
33 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
34 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
35 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
36 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
37 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
38 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
39 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
40 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
41 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
42 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
43 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
44 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
45 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
46 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
47 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
48 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
49 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
50 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
51 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
52 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
53 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
54 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
55 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
56 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
57 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
58 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
59 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
60 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
61 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
62 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
63 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
64 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
65 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
66 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
67 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
68 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
69 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
70 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
71 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
72 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
73 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
74 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
75 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
76 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
77 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
78 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
79 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
80 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
81 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
82 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
83 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
84 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
85 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
86 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
87 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
88 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
89 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
90 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
91 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
92 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
93 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
94 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
95 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
96 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
97 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
98 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
99 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
100 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
101 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
102 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
103 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
104 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
105 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
106 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
107 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
108 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
109 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
110 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
111 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
112 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
113 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
114 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
115 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
116 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
117 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
118 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
119 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
120 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
121 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
122 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
123 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
124 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
125 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
126 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
127 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
128 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
129 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
130 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
131 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
132 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
133 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
134 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
135 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
136 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
137 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
138 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
139 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
140 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
141 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
142 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
143 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
144 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
146 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
147 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
201 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
204 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
205 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
206 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
207 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
208 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
209 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
211 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
212 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
213 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
214 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
215 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
216 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
217 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
218 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
219 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
220 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
221 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
222 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
223 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
224 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
225 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
226 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
227 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
228 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
229 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
230 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
231 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
232 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
233 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
234 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
235 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
236 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
237 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
238 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
239 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
240 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
241 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
242 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
243 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
244 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
245 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
246 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
247 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
248 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
249 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
250 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
251 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
252 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
253 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
254 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
255 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
256 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
257 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
258 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
259 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
260 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
261 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
262 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
263 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
264 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
265 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
266 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
267 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
268 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
269 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
270 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
271 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
272 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
273 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
274 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
275 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
276 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
277 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
278 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
279 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
280 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
281 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
282 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
283 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
284 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
285 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
286 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
287 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
288 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
289 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
290 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
291 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
292 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
293 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
294 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
295 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
296 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
297 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
298 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
299 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
300 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
301 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
302 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
303 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
304 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
305 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
306 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
307 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
308 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
309 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
310 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
311 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
312 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
313 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
314 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
315 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
316 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
317 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
318 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
319 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
320 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
321 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
322 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
323 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
324 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
325 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
326 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
327 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
328 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
329 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
330 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
331 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
332 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
333 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
334 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
335 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
336 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
337 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
338 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
339 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
340 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
341 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.15
Metatranscriptomes 0
Isolates 0.85

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.75
Nodule 0.34
Rhizoplane 7.5
Rhizosphere 87.9
Stem 0
Stem Tuber 0
Unclassified 0.51

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24739J22299_10003110 3300001989 Bacteria 6332
2 JGI24745J21846_1001594 3300002073 Bacteria 2222
3 JGI24748J21848_1000577 3300002074 Bacteria 3947
4 JGI24738J21930_10000272 3300002075 Bacteria 14121
5 JGI24749J21850_1000351 3300002076 Bacteria 6864
6 JGI24744J21845_10007470 3300002077 Bacteria 2259
7 JGI24035J26624_1000417 3300002126 Bacteria 4027
8 JGI24033J26618_1000610 3300002155 Bacteria 3440
9 JGI24034J26672_10000190 3300002239 Bacteria 8244
10 JGI25151J46595_10000159 3300003187 Bacteria 87280
11 Ga0065712_10082160 3300005290 Bacteria 2942
12 Ga0065715_10000395 3300005293 Bacteria 16132
13 Ga0070676_10000128 3300005328 Bacteria 28446
14 Ga0070683_100003185 3300005329 Bacteria 13240
15 Ga0070690_100000302 3300005330 Bacteria 25387
16 Ga0070670_100010951 3300005331 Bacteria 7747
17 Ga0070670_100019884 3300005331 Bacteria 5765
18 Ga0070670_100429425 3300005331 Bacteria 1169
19 Ga0070677_10000043 3300005333 Bacteria 39363
20 Ga0070677_10003290 3300005333 Bacteria 5203
21 Ga0070677_10023785 3300005333 Bacteria 2271
22 Ga0068869_100000289 3300005334 Bacteria 26851
23 Ga0070666_10001787 3300005335 Bacteria 13097
24 Ga0070666_10113655 3300005335 Bacteria 1874
25 Ga0070666_10132143 3300005335 Bacteria 1735
26 Ga0070680_100001826 3300005336 Bacteria 15639
27 Ga0070682_100000988 3300005337 Bacteria 16490
28 Ga0068868_100000408 3300005338 Bacteria 29034
29 Ga0068868_100000731 3300005338 Bacteria 22214
30 Ga0070660_100000182 3300005339 Bacteria 41532
31 Ga0070689_100000224 3300005340 Bacteria 33883
32 Ga0070689_100150873 3300005340 Bacteria 1874
33 Ga0070687_100000656 3300005343 Bacteria 11499
34 Ga0070661_100002755 3300005344 Bacteria 12054
35 Ga0070661_100006036 3300005344 Bacteria 8334
36 Ga0070692_10000614 3300005345 Bacteria 11219
37 Ga0070668_100000564 3300005347 Bacteria 24760
38 Ga0070668_100042787 3300005347 Bacteria 3472
39 Ga0070669_100001946 3300005353 Bacteria 14914
40 Ga0070675_100018334 3300005354 Bacteria 5570
41 Ga0070675_100056208 3300005354 Bacteria 3242
42 Ga0070675_100244560 3300005354 Bacteria 1568
43 Ga0070671_100000598 3300005355 Bacteria 25820
44 Ga0070671_100006361 3300005355 Bacteria 9428
45 Ga0070671_100234145 3300005355 Bacteria 1558
46 Ga0070674_100002568 3300005356 Bacteria 10047
47 Ga0070674_100102342 3300005356 Bacteria 2089
48 Ga0070674_100210291 3300005356 Bacteria 1507
49 Ga0070673_100000198 3300005364 Bacteria 29614
50 Ga0070673_100044911 3300005364 Bacteria 3423
51 Ga0070673_100194330 3300005364 Bacteria 1744
52 Ga0070688_100000189 3300005365 Bacteria 32631
53 Ga0070688_100264488 3300005365 Bacteria 1230
54 Ga0070659_100000677 3300005366 Bacteria 24818
55 Ga0070667_100000436 3300005367 Bacteria 43897
56 Ga0070667_100078873 3300005367 Bacteria 2814
57 Ga0070667_100116992 3300005367 Bacteria 2315
58 Ga0070667_100174158 3300005367 Bacteria 1901
59 Ga0070703_10008818 3300005406 Bacteria 2840
60 Ga0070709_10047224 3300005434 Bacteria 2681
61 Ga0070709_10265370 3300005434 Unclassified 1242
62 Ga0070714_100037938 3300005435 Bacteria 4051
63 Ga0070714_100153759 3300005435 Bacteria 2075
64 Ga0070714_100433803 3300005435 Unclassified 1246
65 Ga0070713_100230610 3300005436 Bacteria 1683
66 Ga0070710_10026425 3300005437 Bacteria 3084
67 Ga0070701_10000052 3300005438 Bacteria 29983
68 Ga0070711_100128305 3300005439 Bacteria 1885
69 Ga0070705_100000973 3300005440 Bacteria 16061
70 Ga0070705_100013435 3300005440 Bacteria 4189
71 Ga0070700_100000330 3300005441 Bacteria 24645
72 Ga0070700_100030685 3300005441 Bacteria 3215
73 Ga0070694_100000352 3300005444 Bacteria 24645
74 Ga0070694_100009893 3300005444 Bacteria 5861
75 Ga0070694_100028037 3300005444 Bacteria 3661
76 Ga0070708_100012248 3300005445 Bacteria 6994
77 Ga0070708_100158391 3300005445 Bacteria 2109
78 Ga0070663_100000331 3300005455 Bacteria 24645
79 Ga0070678_100000087 3300005456 Bacteria 34818
80 Ga0070678_100013375 3300005456 Bacteria 5142
81 Ga0070681_10000593 3300005458 Bacteria 29740
82 Ga0070681_10001245 3300005458 Bacteria 22156
83 Ga0070681_10001610 3300005458 Bacteria 20098
84 Ga0068867_100000942 3300005459 Bacteria 19791
85 Ga0068867_100090845 3300005459 Bacteria 2317
86 Ga0070685_10011732 3300005466 Bacteria 4592
87 Ga0070685_10054569 3300005466 Bacteria 2319
88 Ga0070706_100047939 3300005467 Bacteria 3943
89 Ga0070698_100056349 3300005471 Bacteria 3984
90 Ga0070698_100271261 3300005471 Bacteria 1628
91 Ga0070699_100024861 3300005518 Bacteria 5162
92 Ga0070699_100260207 3300005518 Bacteria 1552
93 Ga0070699_100412707 3300005518 Bacteria 1222
94 Ga0070679_100003219 3300005530 Bacteria 14920
95 Ga0070679_100006873 3300005530 Bacteria 10610
96 Ga0070684_100000687 3300005535 Bacteria 23266
97 Ga0070684_100036551 3300005535 Bacteria 4209
98 Ga0070697_100022533 3300005536 Bacteria 5001
99 Ga0070697_100023172 3300005536 Bacteria 4937
100 Ga0070697_100062012 3300005536 Bacteria 3050
101 Ga0070697_100237921 3300005536 Bacteria 1554
102 Ga0070697_100290534 3300005536 Bacteria 1404
103 Ga0070697_100393346 3300005536 Bacteria 1202
104 Ga0068853_100000417 3300005539 Bacteria 29141
105 Ga0068853_100085153 3300005539 Bacteria 2770
106 Ga0070672_100000155 3300005543 Bacteria 37829
107 Ga0070672_100000623 3300005543 Bacteria 20781
108 Ga0070686_100002393 3300005544 Bacteria 10338
109 Ga0070686_100137983 3300005544 Bacteria 1694
110 Ga0070695_100004241 3300005545 Bacteria 8389
111 Ga0070695_100004325 3300005545 Bacteria 8317
112 Ga0070695_100351153 3300005545 Bacteria 1105
113 Ga0070696_100002225 3300005546 Bacteria 12786
114 Ga0070696_100009047 3300005546 Bacteria 6669
115 Ga0070696_100024753 3300005546 Bacteria 4079
116 Ga0070693_100000771 3300005547 Bacteria 14121
117 Ga0070665_100013381 3300005548 Bacteria 8258
118 Ga0070665_100406213 3300005548 Bacteria 1370
119 Ga0070704_100001277 3300005549 Bacteria 13292
120 Ga0070704_100131087 3300005549 Bacteria 1943
121 Ga0068855_100040730 3300005563 Bacteria 5512
122 Ga0070664_100000147 3300005564 Bacteria 48438
123 Ga0070664_100010901 3300005564 Bacteria 7370
124 Ga0068857_100000047 3300005577 Bacteria 67784
125 Ga0068854_100002758 3300005578 Bacteria 10913
126 Ga0068856_100001905 3300005614 Bacteria 21761
127 Ga0070702_100000495 3300005615 Bacteria 14121
128 Ga0068852_100000390 3300005616 Bacteria 29418
129 Ga0068852_100001248 3300005616 Bacteria 16950
130 Ga0068852_100231138 3300005616 Bacteria 1763
131 Ga0068859_100001380 3300005617 Bacteria 24699
132 Ga0068859_100082345 3300005617 Bacteria 3261
133 Ga0068864_100002657 3300005618 Bacteria 14761
134 Ga0068864_100046279 3300005618 Bacteria 3733
135 Ga0068864_100048750 3300005618 Bacteria 3642
136 Ga0068864_100231120 3300005618 Bacteria 1710
137 Ga0068861_100000336 3300005719 Bacteria 26625
138 Ga0068851_10030261 3300005834 Bacteria 2685
139 Ga0068870_10000037 3300005840 Bacteria 42069
140 Ga0068863_100000906 3300005841 Bacteria 29855
141 Ga0068863_100015226 3300005841 Bacteria 7390
142 Ga0068863_100032281 3300005841 Bacteria 4991
143 Ga0068863_100087192 3300005841 Bacteria 2957
144 Ga0068863_100128399 3300005841 Bacteria 2419
145 Ga0068858_100004037 3300005842 Bacteria 14483
146 Ga0068858_100431875 3300005842 Bacteria 1267
147 Ga0068860_100002585 3300005843 Bacteria 18944
148 Ga0068862_100000763 3300005844 Bacteria 32104
149 Ga0068862_100177701 3300005844 Bacteria 1909
150 Ga0081455_10007625 3300005937 Bacteria 11370
151 Ga0081455_10020340 3300005937 Bacteria 6254
152 Ga0081455_10033900 3300005937 Bacteria 4581
153 Ga0081455_10155530 3300005937 Bacteria 1758
154 Ga0081540_1009813 3300005983 Bacteria 6550
155 Ga0081539_10002158 3300005985 Bacteria 28978
156 Ga0081539_10018612 3300005985 Bacteria 4809
157 Ga0070717_10021945 3300006028 Bacteria 5037
158 Ga0070717_10154454 3300006028 Bacteria 1987
159 Ga0075365_10013968 3300006038 Bacteria 4820
160 Ga0075365_10038850 3300006038 Bacteria 3096
161 Ga0075364_10040151 3300006051 Bacteria 3035
162 Ga0070716_100055731 3300006173 Bacteria 2264
163 Ga0070716_100281939 3300006173 Bacteria 1147
164 Ga0070712_100000600 3300006175 Bacteria 21109
165 Ga0070712_100055492 3300006175 Bacteria 2775
166 Ga0075362_10065204 3300006177 Bacteria 1653
167 Ga0075367_10081339 3300006178 Bacteria 1960
168 Ga0075369_10002981 3300006186 Bacteria 6118
169 Ga0075369_10021143 3300006186 Bacteria 2670
170 Ga0075366_10129436 3300006195 Bacteria 1523
171 Ga0097621_100000416 3300006237 Bacteria 29698
172 Ga0097621_100019765 3300006237 Bacteria 5178
173 Ga0097621_100038659 3300006237 Bacteria 3829
174 Ga0097621_100098318 3300006237 Bacteria 2458
175 Ga0097621_100216780 3300006237 Bacteria 1666
176 Ga0068871_100001611 3300006358 Bacteria 15188
177 Ga0068871_100010906 3300006358 Bacteria 6653
178 Ga0068871_100021473 3300006358 Bacteria 4963
179 Ga0068871_100079951 3300006358 Bacteria 2706
180 Ga0068871_100136999 3300006358 Bacteria 2079
181 Ga0075428_100038062 3300006844 Bacteria 5294
182 Ga0075428_100272494 3300006844 Bacteria 1821
183 Ga0075430_100066961 3300006846 Bacteria 3016
184 Ga0075431_100027286 3300006847 Bacteria 5858
185 Ga0075431_100082437 3300006847 Bacteria 3319
186 Ga0075433_10009247 3300006852 Bacteria 7875
187 Ga0075434_100002322 3300006871 Bacteria 16662
188 Ga0075434_100086191 3300006871 Bacteria 3140
189 Ga0075429_100039664 3300006880 Bacteria 4098
190 Ga0075429_100060554 3300006880 Bacteria 3297
191 Ga0068865_100000340 3300006881 Bacteria 25937
192 Ga0068865_100062902 3300006881 Bacteria 2607
193 Ga0075436_100000458 3300006914 Bacteria 26344
194 Ga0075436_100089876 3300006914 Bacteria 2134
195 Ga0075436_100106895 3300006914 Bacteria 1952
196 Ga0097620_100001380 3300006931 Bacteria 24699
197 Ga0097620_100082342 3300006931 Bacteria 3261
198 Ga0075435_100146526 3300007076 Bacteria 1983
199 Ga0075435_100181228 3300007076 Bacteria 1780
200 Ga0099794_10019068 3300007265 Bacteria 3085
201 Ga0099795_10009473 3300007788 Bacteria 2828
202 Ga0105251_10079935 3300009011 Bacteria 1512
203 Ga0105250_10087595 3300009092 Bacteria 1264
204 Ga0105240_10099178 3300009093 Plasmid 3546
205 Ga0111539_10061808 3300009094 Bacteria 4436
206 Ga0111539_10192195 3300009094 Bacteria 2381
207 Ga0111539_10387064 3300009094 Bacteria 1628
208 Ga0105245_10001087 3300009098 Bacteria 24648
209 Ga0105245_10034958 3300009098 Bacteria 4459
210 Ga0105245_10114248 3300009098 Bacteria 2514
211 Ga0105247_10001882 3300009101 Bacteria 14697
212 Ga0114129_10960345 3300009147 Bacteria 1079
213 Ga0105243_10001705 3300009148 Bacteria 18936
214 Ga0105241_10001794 3300009174 Bacteria 16301
215 Ga0105242_10004457 3300009176 Bacteria 10884
216 Ga0105242_10015886 3300009176 Bacteria 5849
217 Ga0105248_10003875 3300009177 Bacteria 16536
218 Ga0105248_10069178 3300009177 Bacteria 3964
219 Ga0105248_10218597 3300009177 Bacteria 2145
220 Ga0105248_10667111 3300009177 Bacteria 1173
221 Ga0105237_10004455 3300009545 Bacteria 16193
222 Ga0105249_10001030 3300009553 Bacteria 24648
223 Ga0099796_10082585 3300010159 Bacteria 1181
224 Ga0105239_10002253 3300010375 Bacteria 24648
225 Ga0105246_10000057 3300011119 Bacteria 44951
226 Ga0105246_10241640 3300011119 Bacteria 1428
227 Ga0157373_10015723 3300013100 Bacteria 5526
228 Ga0157371_10005939 3300013102 Bacteria 10190
229 Ga0157369_10300663 3300013105 Bacteria 1669
230 Ga0157374_10003737 3300013296 Bacteria 12796
231 Ga0157374_10004173 3300013296 Bacteria 12133
232 Ga0157374_10131227 3300013296 Bacteria 2425
233 Ga0157378_10002661 3300013297 Bacteria 15895
234 Ga0157378_10027450 3300013297 Bacteria 5024
235 Ga0157378_10112465 3300013297 Bacteria 2498
236 Ga0163162_10019074 3300013306 Bacteria 6727
237 Ga0163162_10037442 3300013306 Bacteria 4841
238 Ga0163162_10346107 3300013306 Bacteria 1619
239 Ga0157372_10008410 3300013307 Bacteria 10962
240 Ga0157375_10000482 3300013308 Bacteria 36307
241 Ga0157375_10000983 3300013308 Bacteria 24671
242 Ga0157375_10099140 3300013308 Bacteria 2992
243 Ga0157375_10299922 3300013308 Bacteria 1770
244 Ga0163163_10002371 3300014325 Bacteria 15940
245 Ga0163163_10045074 3300014325 Bacteria 4328
246 Ga0157380_10000226 3300014326 Bacteria 33709
247 Ga0157380_10140021 3300014326 Bacteria 2077
248 Ga0157377_10000681 3300014745 Bacteria 14056
249 Ga0157379_10000779 3300014968 Bacteria 25895
250 Ga0157379_10277446 3300014968 Bacteria 1525
251 Ga0157376_10002318 3300014969 Bacteria 12860
252 Ga0157376_10026218 3300014969 Bacteria 4603
253 Ga0157376_10059083 3300014969 Bacteria 3215
254 Ga0157376_10079413 3300014969 Bacteria 2813
255 Ga0157376_10152733 3300014969 Bacteria 2084
256 Ga0163161_10000209 3300017792 Bacteria 53534
257 Ga0163161_10039200 3300017792 Bacteria 3400
258 Ga0213872_10059877 3300021361 Bacteria 1723
259 Ga0207666_1000011 3300025271 Bacteria 46553
260 Ga0207673_1000047 3300025290 Bacteria 9811
261 Ga0209025_1000026 3300025294 Bacteria 519850
262 Ga0207697_10000392 3300025315 Bacteria 24624
263 Ga0207697_10063378 3300025315 Bacteria 1541
264 Ga0207656_10000974 3300025321 Bacteria 9361
265 Ga0207696_1050358 3300025711 Bacteria 1192
266 Ga0207653_10012297 3300025885 Bacteria 2672
267 Ga0207682_10000004 3300025893 Bacteria 104760
268 Ga0207692_10034581 3300025898 Bacteria 2448
269 Ga0207642_10002298 3300025899 Bacteria 5954
270 Ga0207710_10001729 3300025900 Bacteria 10564
271 Ga0207688_10000152 3300025901 Bacteria 29719
272 Ga0207688_10064037 3300025901 Bacteria 2075
273 Ga0207680_10001184 3300025903 Bacteria 12321
274 Ga0207647_10003824 3300025904 Bacteria 11263
275 Ga0207685_10033134 3300025905 Bacteria 1865
276 Ga0207645_10000281 3300025907 Bacteria 42381
277 Ga0207645_10041219 3300025907 Bacteria 2956
278 Ga0207645_10228611 3300025907 Bacteria 1228
279 Ga0207643_10000012 3300025908 Bacteria 133318
280 Ga0207643_10040971 3300025908 Bacteria 2609
281 Ga0207643_10108440 3300025908 Bacteria 1634
282 Ga0207684_10071925 3300025910 Bacteria 2938
283 Ga0207684_10142437 3300025910 Bacteria 2061
284 Ga0207654_10004367 3300025911 Bacteria 7126
285 Ga0207707_10000551 3300025912 Bacteria 38020
286 Ga0207707_10008705 3300025912 Bacteria 8806
287 Ga0207695_10147984 3300025913 Unclassified 2290
288 Ga0207671_10004326 3300025914 Bacteria 13645
289 Ga0207693_10007457 3300025915 Bacteria 8997
290 Ga0207693_10033249 3300025915 Bacteria 4070
291 Ga0207693_10047090 3300025915 Bacteria 3389
292 Ga0207660_10000008 3300025917 Bacteria 98521
293 Ga0207662_10000123 3300025918 Bacteria 37327
294 Ga0207657_10000358 3300025919 Bacteria 48238
295 Ga0207649_10000545 3300025920 Bacteria 26032
296 Ga0207649_10019079 3300025920 Bacteria 3915
297 Ga0207652_10004952 3300025921 Bacteria 10786
298 Ga0207652_10011583 3300025921 Bacteria 7113
299 Ga0207646_10158904 3300025922 Bacteria 2039
300 Ga0207681_10000286 3300025923 Bacteria 37397
301 Ga0207650_10003465 3300025925 Bacteria 10841
302 Ga0207650_10005306 3300025925 Bacteria 8794
303 Ga0207650_10056652 3300025925 Bacteria 2913
304 Ga0207650_10069450 3300025925 Bacteria 2647
305 Ga0207650_10105363 3300025925 Bacteria 2177
306 Ga0207659_10000023 3300025926 Bacteria 142947
307 Ga0207659_10004672 3300025926 Bacteria 8295
308 Ga0207659_10039818 3300025926 Bacteria 3282
309 Ga0207659_10065015 3300025926 Bacteria 2642
310 Ga0207659_10186376 3300025926 Bacteria 1648
311 Ga0207687_10000149 3300025927 Bacteria 46713
312 Ga0207687_10031311 3300025927 Bacteria 3594
313 Ga0207687_10378180 3300025927 Unclassified 1160
314 Ga0207700_10041333 3300025928 Bacteria 3372
315 Ga0207700_10070497 3300025928 Bacteria 2687
316 Ga0207700_10357550 3300025928 Bacteria 1273
317 Ga0207644_10000418 3300025931 Bacteria 27576
318 Ga0207644_10000724 3300025931 Bacteria 20908
319 Ga0207644_10161055 3300025931 Bacteria 1744
320 Ga0207690_10000203 3300025932 Bacteria 46451
321 Ga0207706_10001339 3300025933 Bacteria 24624
322 Ga0207686_10000995 3300025934 Bacteria 16847
323 Ga0207686_10080516 3300025934 Bacteria 2123
324 Ga0207709_10000607 3300025935 Bacteria 29669
325 Ga0207670_10000125 3300025936 Bacteria 50796
326 Ga0207669_10000122 3300025937 Bacteria 39107
327 Ga0207669_10100030 3300025937 Bacteria 1914
328 Ga0207669_10152080 3300025937 Bacteria 1622
329 Ga0207704_10062124 3300025938 Bacteria 2321
330 Ga0207704_10078187 3300025938 Bacteria 2127
331 Ga0207704_10091789 3300025938 Bacteria 1997
332 Ga0207665_10001932 3300025939 Bacteria 13940
333 Ga0207665_10263746 3300025939 Bacteria 1277
334 Ga0207691_10000319 3300025940 Bacteria 47784
335 Ga0207691_10001334 3300025940 Bacteria 24624
336 Ga0207691_10034426 3300025940 Bacteria 4709
337 Ga0207691_10061514 3300025940 Bacteria 3410
338 Ga0207691_10062575 3300025940 Bacteria 3376
339 Ga0207711_10000590 3300025941 Bacteria 36793
340 Ga0207711_10036587 3300025941 Bacteria 4165
341 Ga0207711_10157597 3300025941 Bacteria 2053
342 Ga0207689_10000008 3300025942 Bacteria 127942
343 Ga0207689_10024775 3300025942 Bacteria 5031
344 Ga0207689_10245064 3300025942 Bacteria 1482
345 Ga0207661_10000104 3300025944 Bacteria 53977
346 Ga0207661_10024178 3300025944 Bacteria 4600
347 Ga0207679_10000053 3300025945 Bacteria 109038
348 Ga0207679_10133286 3300025945 Bacteria 1996
349 Ga0207667_10010178 3300025949 Bacteria 11014
350 Ga0207651_10001418 3300025960 Bacteria 10896
351 Ga0207651_10009405 3300025960 Bacteria 5348
352 Ga0207712_10000156 3300025961 Bacteria 70300
353 Ga0207668_10000251 3300025972 Bacteria 35861
354 Ga0207668_10030232 3300025972 Bacteria 3558
355 Ga0207668_10083754 3300025972 Bacteria 2322
356 Ga0207668_10159317 3300025972 Bacteria 1757
357 Ga0207640_10000157 3300025981 Bacteria 49126
358 Ga0207640_10002548 3300025981 Bacteria 9773
359 Ga0207658_10001085 3300025986 Bacteria 22019
360 Ga0207658_10127209 3300025986 Bacteria 2041
361 Ga0207677_10000609 3300026023 Bacteria 22003
362 Ga0207703_10007370 3300026035 Bacteria 8740
363 Ga0207639_10001949 3300026041 Bacteria 13856
364 Ga0207678_10001114 3300026067 Bacteria 24624
365 Ga0207678_10041948 3300026067 Bacteria 3966
366 Ga0207678_10259902 3300026067 Bacteria 1488
367 Ga0207708_10000734 3300026075 Bacteria 24624
368 Ga0207708_10005760 3300026075 Bacteria 9156
369 Ga0207708_10007249 3300026075 Bacteria 8199
370 Ga0207702_10027811 3300026078 Bacteria 4698
371 Ga0207641_10000794 3300026088 Bacteria 33696
372 Ga0207641_10040421 3300026088 Bacteria 3905
373 Ga0207648_10001602 3300026089 Bacteria 24780
374 Ga0207648_10036740 3300026089 Bacteria 4316
375 Ga0207648_10342430 3300026089 Bacteria 1347
376 Ga0207676_10000934 3300026095 Bacteria 22596
377 Ga0207676_10034633 3300026095 Bacteria 3824
378 Ga0207676_10043250 3300026095 Bacteria 3467
379 Ga0207674_10009261 3300026116 Bacteria 11286
380 Ga0207675_100000604 3300026118 Bacteria 35079
381 Ga0207675_100024855 3300026118 Bacteria 5574
382 Ga0207675_100098647 3300026118 Bacteria 2751
383 Ga0207675_100416043 3300026118 Bacteria 1327
384 Ga0207683_10000006 3300026121 Bacteria 181260
385 Ga0207683_10002093 3300026121 Bacteria 17577
386 Ga0207683_10043032 3300026121 Bacteria 3944
387 Ga0207698_10000378 3300026142 Bacteria 25887
388 Ga0207698_10055322 3300026142 Bacteria 3057
389 Ga0207698_10223161 3300026142 Bacteria 1705
390 Ga0209998_10000622 3300027717 Bacteria 9498
391 Ga0209813_10042793 3300027866 Bacteria 1385
392 Ga0207428_10000112 3300027907 Bacteria 110733
393 Ga0207428_10186529 3300027907 Bacteria 1565
394 Ga0268266_10008074 3300028379 Bacteria 9402
395 Ga0268266_10353002 3300028379 Bacteria 1382
396 Ga0268265_10002652 3300028380 Bacteria 13283
397 Ga0268264_10002426 3300028381 Bacteria 16403
398 Ga0265320_10047327 3300031240 Unclassified 2103
399 Ga0265320_10060247 3300031240 Bacteria 1813
400 Ga0265325_10057347 3300031241 Bacteria 1986
401 Ga0265325_10089275 3300031241 Bacteria 1522
402 Ga0265329_10039525 3300031242 Bacteria 1515
403 Ga0265340_10020800 3300031247 Bacteria 3367
404 Ga0265316_10271693 3300031344 Bacteria 1240
405 Ga0265342_10100839 3300031712 Bacteria 1644
406 Ga0307412_10448488 3300031911 Bacteria 1062
407 Ga0373938_0001311 3300034957 Bacteria 3996
408 Ga0373938_0036576 3300034957 Bacteria 1075
409 Ga0373926_0074336 3300035083 Bacteria 1251
410 Ga0373940_0020414 3300035088 Bacteria 1683
411 Ga0373944_0079045 3300035089 Bacteria 1083
412 Ga0373951_0050269 3300035091 Bacteria 1024
413 Ga0373952_0002039 3300035092 Bacteria 3640
414 Ga0373952_0007354 3300035092 Bacteria 2063
415 Ga0373923_0093067 3300035111 Bacteria 1321
416 Ga0373932_0002972 3300035112 Bacteria 4169
417 Ga0373936_0008843 3300035113 Bacteria 3795
418 Ga0373936_0139712 3300035113 Bacteria 1045
419 Ga0373939_0002339 3300035114 Bacteria 4484
420 Ga0373941_0002973 3300035115 Bacteria 3792
421 Ga0373945_0022048 3300035116 Bacteria 2191
422 Ga0373945_0029923 3300035116 Bacteria 1916
423 Ga0373960_0003207 3300035121 Bacteria 3700
424 Ga0373960_0008610 3300035121 Bacteria 2449
425 Ga0373943_0016423 3300035170 Bacteria 3375
426 Ga0373946_0008578 3300035171 Bacteria 3751
427 Ga0373946_0036312 3300035171 Bacteria 1997
428 Ga0373961_0003015 3300035241 Bacteria 4249
429 Ga0373931_0000687 3300035691 Bacteria 14022
430 Ga0373931_0154449 3300035691 Bacteria 1340
431 Ga0373935_0224245 3300035692 Bacteria 1306
432 Ga0373927_0019879 3300035695 Bacteria 4403
433 Ga0373937_0339714 3300036401 Bacteria 1422
434 Ga0373925_0117115 3300037068 Bacteria 2064
435 Ga0395905_0234489 3300037471 Bacteria 1715
436 Ga0451807_0915961 3300041486 Bacteria 3266
437 Ga0439443_001336 3300042003 Bacteria 2673
438 Ga0439449_0001455 3300042007 Bacteria 9260
439 Ga0439444_0000062 3300042437 Bacteria 7951
440 Ga0439459_0030550 3300042438 Bacteria 1094
441 Ga0466963_0114475 3300044694 Bacteria 1853
442 Ga0466957_0047924 3300044842 Bacteria 2597
443 Ga0451576_0075590 3300045051 Bacteria 3505
444 Ga0451576_0305773 3300045051 Bacteria 1663
445 Ga0495603_0006198 3300046455 Bacteria 7152
446 Ga0495629_0076154 3300046459 Bacteria 2343
447 Ga0495629_0093952 3300046459 Bacteria 2093
448 Ga0495641_0094294 3300046461 Unclassified 1337
449 Ga0495580_0048052 3300046472 Bacteria 3024
450 Ga0495605_0087756 3300046474 Bacteria 1446
451 Ga0495662_0004855 3300046476 Bacteria 6735
452 Ga0495662_0022103 3300046476 Bacteria 3074
453 Ga0495584_0099783 3300046491 Bacteria 1467
454 Ga0495584_0109536 3300046491 Bacteria 1397
455 Ga0495585_0011090 3300046492 Bacteria 5348
456 Ga0495585_0011501 3300046492 Bacteria 5237
457 Ga0495594_0034622 3300046499 Bacteria 2748
458 Ga0495594_0060654 3300046499 Bacteria 2092
459 Ga0495596_0032329 3300046500 Bacteria 2087
460 Ga0495618_0105173 3300046514 Bacteria 1807
461 Ga0495630_0283672 3300046517 Bacteria 1265
462 Ga0495631_0045847 3300046518 Bacteria 1924
463 Ga0495637_0032095 3300046520 Bacteria 2316
464 Ga0495644_0041417 3300046523 Bacteria 1734
465 Ga0495666_0042521 3300046526 Bacteria 2197
466 Ga0495642_0038703 3300046528 Bacteria 1933
467 Ga0495642_0046939 3300046528 Bacteria 1767
468 Ga0495665_0117482 3300046531 Bacteria 1393
469 Ga0495640_0142343 3300046533 Bacteria 1545
470 Ga0495586_0114431 3300046535 Bacteria 1503
471 Ga0495598_0001385 3300046537 Bacteria 4779
472 Ga0495598_0005558 3300046537 Bacteria 2803
473 Ga0495609_0117289 3300046538 Bacteria 1146
474 Ga0495621_0016539 3300046539 Bacteria 2370
475 Ga0495621_0119999 3300046539 Bacteria 1015
476 Ga0495622_0126358 3300046557 Bacteria 1166
477 Ga0495656_0035242 3300046615 Bacteria 2055
478 Ga0495659_0002522 3300046664 Bacteria 5913
479 Ga0495659_0048688 3300046664 Bacteria 1537
480 Ga0495661_0068856 3300046665 Bacteria 2075
481 Ga0495588_0015185 3300046674 Bacteria 3700
482 Ga0495647_0083520 3300046681 Bacteria 1298
483 Ga0495658_0038858 3300046683 Bacteria 2637
484 Ga0495658_0303825 3300046683 Bacteria 1009
485 Ga0495669_0057031 3300046684 Bacteria 1762
486 Ga0495669_0079165 3300046684 Bacteria 1506
487 Ga0495613_0060112 3300046689 Bacteria 2784
488 Ga0495613_0071365 3300046689 Bacteria 2532
489 Ga0495613_0074491 3300046689 Bacteria 2472
490 Ga0495624_0081146 3300046690 Bacteria 2009
491 Ga0495670_0021075 3300046691 Bacteria 3214
492 Ga0495671_0052045 3300046692 Bacteria 2035
493 Ga0495589_0027290 3300046794 Bacteria 2887
494 Ga0495581_0070007 3300047315 Bacteria 2029
495 Ga0495581_0142952 3300047315 Bacteria 1396
496 Ga0495636_0095613 3300047318 Bacteria 1294
497 Ga0495674_0050581 3300047319 Bacteria 3667
498 Ga0495676_0295553 3300047321 Bacteria 1093
499 Ga0495677_0017535 3300047445 Bacteria 2596
500 Ga0495679_019841 3300047446 Bacteria 2353
501 Ga0495684_0220573 3300047471 Bacteria 1390
502 Ga0495686_0068703 3300047472 Bacteria 2186
503 Ga0496100_0001037 3300048903 Bacteria 13421
504 Ga0496101_0002660 3300048904 Bacteria 10971
505 Ga0496101_0328069 3300048904 Bacteria 1201
506 Ga0496102_0001120 3300048905 Bacteria 24582
507 Ga0496103_0000611 3300048906 Bacteria 27883
508 Ga0496104_0000383 3300048907 Bacteria 38697
509 Ga0496104_0000434 3300048907 Bacteria 36228
510 Ga0496104_0002239 3300048907 Bacteria 16693
511 Ga0496104_0003487 3300048907 Bacteria 13567
512 Ga0496104_0050654 3300048907 Bacteria 3918
513 Ga0496105_0011456 3300048908 Bacteria 7006
514 Ga0496105_0082458 3300048908 Bacteria 2656
515 Ga0496105_0090171 3300048908 Bacteria 2532
516 Ga0496105_0107377 3300048908 Bacteria 2304
517 Ga0496106_0000541 3300048909 Bacteria 26824
518 Ga0496106_0040908 3300048909 Bacteria 3473
519 Ga0496106_0093286 3300048909 Bacteria 2326
520 Ga0496106_0125638 3300048909 Bacteria 2008
521 Ga0496107_0000493 3300048910 Bacteria 21794
522 Ga0496107_0056207 3300048910 Bacteria 2843
523 Ga0496108_0093195 3300048911 Bacteria 2562
524 Ga0496108_0135015 3300048911 Bacteria 2122
525 Ga0496108_0165285 3300048911 Bacteria 1913
526 Ga0496108_0203635 3300048911 Bacteria 1717
527 Ga0496109_0002920 3300048912 Bacteria 14286
528 Ga0496109_0026898 3300048912 Bacteria 5131
529 Ga0496109_0077652 3300048912 Bacteria 3056
530 Ga0496109_0174833 3300048912 Bacteria 2015
531 Ga0496110_0001712 3300048913 Bacteria 16146
532 Ga0496110_0097606 3300048913 Bacteria 2633
533 Ga0496110_0208981 3300048913 Bacteria 1774
534 Ga0496110_0442417 3300048913 Bacteria 1185
535 Ga0496111_0131812 3300048914 Bacteria 1850
536 Ga0496112_0051062 3300048915 Bacteria 4056
537 Ga0496113_0036261 3300048916 Bacteria 3612
538 Ga0496113_0068971 3300048916 Bacteria 2684
539 Ga0496113_0219126 3300048916 Bacteria 1516
540 Ga0496114_0003043 3300048917 Bacteria 12845
541 Ga0496114_0030598 3300048917 Bacteria 4430
542 Ga0496114_0143795 3300048917 Bacteria 2067
543 Ga0496115_0003177 3300048918 Bacteria 11804
544 Ga0496115_0025764 3300048918 Bacteria 4583
545 Ga0496115_0048785 3300048918 Bacteria 3387
546 Ga0501034_0605646 3300049571 Bacteria 1001
547 Ga0501040_0143140 3300049576 Bacteria 1685
548 Ga0501043_0000053 3300049579 Bacteria 106085
549 Ga0501046_0206920 3300049580 Bacteria 1458
550 Ga0501071_0107856 3300049587 Bacteria 2057
551 Ga0501035_0064120 3300049822 Bacteria 3266
552 Ga0501044_0036008 3300049823 Bacteria 5179
553 nmdc:mga03683_27101_c1 3300050489 Bacteria 2266
554 nmdc:mga00v17_79253_c1 3300050491 Bacteria 2048
555 nmdc:mga0yw44_132323_c1 3300050492 Bacteria 1616
556 nmdc:mga0yw44_3893_c2 3300050492 Bacteria 4777
557 nmdc:mga0k408_203369_c1 3300050493 Bacteria 1182
558 nmdc:mga0k408_67553_c1 3300050493 Bacteria 2083
559 nmdc:mga06z11_25983_c1 3300050494 Bacteria 2782
560 nmdc:mga04h51_49486_c1 3300050495 Bacteria 1404
561 nmdc:mga05p37_14797_c1 3300050507 Bacteria 9370
562 nmdc:mga05p37_297552_c1 3300050507 Bacteria 1919
563 nmdc:mga09592_277806_c1 3300050508 Bacteria 1452
564 nmdc:mga09592_44526_c1 3300050508 Bacteria 3737
565 nmdc:mga09592_70118_c1 3300050508 Bacteria 2974
566 nmdc:mga0qj67_114385_c1 3300050509 Bacteria 2179
567 nmdc:mga0qj67_30949_c1 3300050509 Bacteria 4167
568 nmdc:mga06r32_139195_c1 3300050510 Bacteria 2403
569 nmdc:mga06r32_44581_c1 3300050510 Bacteria 4224
570 nmdc:mga08y16_452926_c1 3300050511 Bacteria 1308
571 nmdc:mga08y16_802_c1 3300050511 Bacteria 30082
572 nmdc:mga0n895_291_c1 3300050512 Bacteria 33000
573 nmdc:mga0rr50_157380_c1 3300050513 Bacteria 1841
574 nmdc:mga08x19_4594_c1 3300050514 Bacteria 8198
575 nmdc:mga08x19_97857_c1 3300050514 Bacteria 1943
576 nmdc:mga0a205_1940_c1 3300050515 Bacteria 17960
577 nmdc:mga0sz30_44033_c1 3300050516 Bacteria 1879
578 Ga0495601_0036988 3300053077 Bacteria 3051
579 Ga0495619_0123904 3300053085 Bacteria 1773
580 Ga0500616_0002206 3300053153 Bacteria 16693
581 Ga0500619_000039 3300053154 Bacteria 40533
582 Ga0530510_0169060 3300061734 Bacteria 1619

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046689 Ga0495613_0060112 Ga0495613_0060112_1484_2488 272
2 3300046665 Ga0495661_0068856 Ga0495661_0068856_1053_1880 275
3 3300046683 Ga0495658_0303825 Ga0495658_0303825_149_976 275
4 3300047321 Ga0495676_0295553 Ga0495676_0295553_236_1063 275
5 3300031911 Ga0307412_10448488 Ga0307412_104484881 276
6 3300042438 Ga0439459_0030550 Ga0439459_0030550_13_975 282
7 3300049587 Ga0501071_0107856 Ga0501071_0107856_343_1209 288
8 3300050493 nmdc:mga0k408_67553_c1 nmdc:mga0k408_67553_c1_29_898 288
9 3300035091 Ga0373951_0050269 Ga0373951_0050269_22_900 290
10 iso_pu_bacteria 2855730933 2855732471 294
11 iso_pu_bacteria 2855767633 2855769179 294
12 3300005937 Ga0081455_10155530 Ga0081455_101555302 295
13 3300053154 Ga0500619_000039 Ga0500619_000039_5097_6071 299
14 3300053085 Ga0495619_0123904 Ga0495619_0123904_424_1329 301
15 3300006844 Ga0075428_100038062 Ga0075428_1000380626 302
16 3300006880 Ga0075429_100060554 Ga0075429_1000605542 302
17 3300042003 Ga0439443_001336 Ga0439443_001336_84_1040 302
18 3300042437 Ga0439444_0000062 Ga0439444_0000062_91_1047 302
19 3300050508 nmdc:mga09592_44526_c1 nmdc:mga09592_44526_c1_693_1649 302
20 3300048913 Ga0496110_0097606 Ga0496110_0097606_947_1918 305
21 3300048911 Ga0496108_0165285 Ga0496108_0165285_11_943 308
22 iso_pu_bacteria 2881412998 2881414940 308
23 iso_pu_bacteria 2881412998 2881414941 308
24 3300046664 Ga0495659_0002522 Ga0495659_0002522_4918_5853 309
25 3300047472 Ga0495686_0068703 Ga0495686_0068703_1131_2123 310
26 3300049571 Ga0501034_0605646 Ga0501034_0605646_42_974 310
27 3300050513 nmdc:mga0rr50_157380_c1 nmdc:mga0rr50_157380_c1_297_1241 310
28 iso_pu_bacteria 2808606395 2809033025 311
29 3300005467 Ga0070706_100047939 Ga0070706_1000479392 312
30 3300005518 Ga0070699_100412707 Ga0070699_1004127071 312
31 3300005536 Ga0070697_100022533 Ga0070697_1000225332 312
32 3300005545 Ga0070695_100004325 Ga0070695_1000043258 312
33 3300005546 Ga0070696_100009047 Ga0070696_1000090476 312
34 3300005549 Ga0070704_100131087 Ga0070704_1001310872 312
35 3300006914 Ga0075436_100106895 Ga0075436_1001068952 312
36 3300009094 Ga0111539_10061808 Ga0111539_100618084 312
37 3300044694 Ga0466963_0114475 Ga0466963_0114475_827_1783 312
38 3300044842 Ga0466957_0047924 Ga0466957_0047924_617_1573 312
39 3300005434 Ga0070709_10265370 Ga0070709_102653701 313
40 3300005435 Ga0070714_100433803 Ga0070714_1004338031 313
41 3300005436 Ga0070713_100230610 Ga0070713_1002306102 313
42 3300005458 Ga0070681_10001610 Ga0070681_1000161022 313
43 3300005536 Ga0070697_100290534 Ga0070697_1002905342 313
44 3300006028 Ga0070717_10154454 Ga0070717_101544542 313
45 3300009147 Ga0114129_10960345 Ga0114129_109603452 313
46 3300050514 nmdc:mga08x19_4594_c1 nmdc:mga08x19_4594_c1_2537_3484 313
47 3300006237 Ga0097621_100216780 Ga0097621_1002167802 314
48 3300006358 Ga0068871_100010906 Ga0068871_1000109062 314
49 3300006881 Ga0068865_100062902 Ga0068865_1000629023 314
50 3300009098 Ga0105245_10034958 Ga0105245_100349585 314
51 3300009176 Ga0105242_10015886 Ga0105242_100158867 314
52 3300013308 Ga0157375_10099140 Ga0157375_100991404 314
53 3300014969 Ga0157376_10079413 Ga0157376_100794133 314
54 3300025927 Ga0207687_10031311 Ga0207687_100313114 314
55 3300025934 Ga0207686_10080516 Ga0207686_100805162 314
56 3300025938 Ga0207704_10078187 Ga0207704_100781872 314
57 3300026067 Ga0207678_10259902 Ga0207678_102599022 314
58 3300005435 Ga0070714_100037938 Ga0070714_1000379382 315
59 3300005440 Ga0070705_100013435 Ga0070705_1000134352 315
60 3300005444 Ga0070694_100009893 Ga0070694_1000098932 315
61 3300005444 Ga0070694_100028037 Ga0070694_1000280373 315
62 3300005458 Ga0070681_10001245 Ga0070681_1000124535 315
63 3300005518 Ga0070699_100024861 Ga0070699_1000248612 315
64 3300005518 Ga0070699_100260207 Ga0070699_1002602071 315
65 3300005530 Ga0070679_100006873 Ga0070679_1000068732 315
66 3300005536 Ga0070697_100023172 Ga0070697_1000231722 315
67 3300005536 Ga0070697_100062012 Ga0070697_1000620123 315
68 3300005536 Ga0070697_100393346 Ga0070697_1003933461 315
69 3300005545 Ga0070695_100004241 Ga0070695_1000042413 315
70 3300005546 Ga0070696_100024753 Ga0070696_1000247532 315
71 3300005985 Ga0081539_10002158 Ga0081539_1000215822 315
72 3300006173 Ga0070716_100281939 Ga0070716_1002819392 315
73 3300006914 Ga0075436_100000458 Ga0075436_1000004587 315
74 3300006914 Ga0075436_100089876 Ga0075436_1000898761 315
75 3300025912 Ga0207707_10008705 Ga0207707_100087052 315
76 3300025921 Ga0207652_10004952 Ga0207652_100049522 315
77 3300025939 Ga0207665_10263746 Ga0207665_102637462 315
78 3300034957 Ga0373938_0036576 Ga0373938_0036576_39_995 315
79 3300035092 Ga0373952_0007354 Ga0373952_0007354_660_1616 315
80 3300035121 Ga0373960_0003207 Ga0373960_0003207_1399_2355 315
81 3300035691 Ga0373931_0154449 Ga0373931_0154449_17_973 315
82 3300045051 Ga0451576_0075590 Ga0451576_0075590_1739_2695 315
83 3300045051 Ga0451576_0305773 Ga0451576_0305773_39_995 315
84 3300046476 Ga0495662_0004855 Ga0495662_0004855_5757_6713 315
85 3300046533 Ga0495640_0142343 Ga0495640_0142343_23_979 315
86 3300046535 Ga0495586_0114431 Ga0495586_0114431_532_1488 315
87 3300046684 Ga0495669_0079165 Ga0495669_0079165_17_973 315
88 3300046690 Ga0495624_0081146 Ga0495624_0081146_903_1859 315
89 3300047315 Ga0495581_0142952 Ga0495581_0142952_285_1241 315
90 3300047319 Ga0495674_0050581 Ga0495674_0050581_22_978 315
91 3300050514 nmdc:mga08x19_97857_c1 nmdc:mga08x19_97857_c1_539_1495 315
92 3300003187 JGI25151J46595_10000159 JGI25151J46595_1000015921 316
93 3300005844 Ga0068862_100177701 Ga0068862_1001777012 316
94 3300025294 Ga0209025_1000026 Ga0209025_1000026416 316
95 3300049579 Ga0501043_0000053 Ga0501043_0000053_93388_94365 316
96 3300005331 Ga0070670_100429425 Ga0070670_1004294252 317
97 3300005335 Ga0070666_10132143 Ga0070666_101321432 317
98 3300005347 Ga0070668_100042787 Ga0070668_1000427873 317
99 3300005354 Ga0070675_100018334 Ga0070675_1000183342 317
100 3300005367 Ga0070667_100174158 Ga0070667_1001741581 317
101 3300005617 Ga0068859_100082345 Ga0068859_1000823452 317
102 3300006931 Ga0097620_100082342 Ga0097620_1000823423 317
103 3300025315 Ga0207697_10063378 Ga0207697_100633782 317
104 3300025907 Ga0207645_10228611 Ga0207645_102286112 317
105 3300025925 Ga0207650_10105363 Ga0207650_101053632 317
106 3300025926 Ga0207659_10039818 Ga0207659_100398183 317
107 3300025940 Ga0207691_10034426 Ga0207691_100344262 317
108 3300025940 Ga0207691_10061514 Ga0207691_100615144 317
109 3300025972 Ga0207668_10030232 Ga0207668_100302323 317
110 3300025986 Ga0207658_10127209 Ga0207658_101272091 317
111 3300026067 Ga0207678_10041948 Ga0207678_100419486 317
112 3300026118 Ga0207675_100416043 Ga0207675_1004160432 317
113 3300005329 Ga0070683_100003185 Ga0070683_1000031851 318
114 3300005331 Ga0070670_100010951 Ga0070670_1000109518 318
115 3300005333 Ga0070677_10003290 Ga0070677_100032906 318
116 3300005333 Ga0070677_10023785 Ga0070677_100237852 318
117 3300005335 Ga0070666_10113655 Ga0070666_101136552 318
118 3300005338 Ga0068868_100000731 Ga0068868_10000073112 318
119 3300005340 Ga0070689_100150873 Ga0070689_1001508732 318
120 3300005344 Ga0070661_100006036 Ga0070661_10000603610 318
121 3300005354 Ga0070675_100056208 Ga0070675_1000562082 318
122 3300005354 Ga0070675_100244560 Ga0070675_1002445601 318
123 3300005355 Ga0070671_100006361 Ga0070671_1000063612 318
124 3300005355 Ga0070671_100234145 Ga0070671_1002341452 318
125 3300005356 Ga0070674_100210291 Ga0070674_1002102911 318
126 3300005364 Ga0070673_100044911 Ga0070673_1000449112 318
127 3300005364 Ga0070673_100194330 Ga0070673_1001943302 318
128 3300005365 Ga0070688_100264488 Ga0070688_1002644882 318
129 3300005367 Ga0070667_100078873 Ga0070667_1000788732 318
130 3300005367 Ga0070667_100116992 Ga0070667_1001169921 318
131 3300005441 Ga0070700_100030685 Ga0070700_1000306852 318
132 3300005456 Ga0070678_100013375 Ga0070678_1000133752 318
133 3300005459 Ga0068867_100090845 Ga0068867_1000908452 318
134 3300005535 Ga0070684_100036551 Ga0070684_1000365512 318
135 3300005543 Ga0070672_100000155 Ga0070672_1000001552 318
136 3300005548 Ga0070665_100406213 Ga0070665_1004062131 318
137 3300005564 Ga0070664_100000147 Ga0070664_10000014755 318
138 3300005578 Ga0068854_100002758 Ga0068854_10000275813 318
139 3300005616 Ga0068852_100000390 Ga0068852_10000039032 318
140 3300005616 Ga0068852_100231138 Ga0068852_1002311382 318
141 3300005618 Ga0068864_100046279 Ga0068864_1000462794 318
142 3300005618 Ga0068864_100048750 Ga0068864_1000487504 318
143 3300005834 Ga0068851_10030261 Ga0068851_100302613 318
144 3300005841 Ga0068863_100015226 Ga0068863_1000152262 318
145 3300005841 Ga0068863_100032281 Ga0068863_1000322812 318
146 3300005841 Ga0068863_100087192 Ga0068863_1000871924 318
147 3300005842 Ga0068858_100431875 Ga0068858_1004318751 318
148 3300006038 Ga0075365_10013968 Ga0075365_100139682 318
149 3300006186 Ga0075369_10002981 Ga0075369_100029812 318
150 3300006186 Ga0075369_10021143 Ga0075369_100211431 318
151 3300006195 Ga0075366_10129436 Ga0075366_101294362 318
152 3300006237 Ga0097621_100019765 Ga0097621_1000197656 318
153 3300006237 Ga0097621_100038659 Ga0097621_1000386593 318
154 3300006358 Ga0068871_100021473 Ga0068871_1000214732 318
155 3300006358 Ga0068871_100079951 Ga0068871_1000799513 318
156 3300009098 Ga0105245_10114248 Ga0105245_101142482 318
157 3300009177 Ga0105248_10069178 Ga0105248_100691782 318
158 3300009177 Ga0105248_10218597 Ga0105248_102185972 318
159 3300009177 Ga0105248_10667111 Ga0105248_106671111 318
160 3300011119 Ga0105246_10241640 Ga0105246_102416402 318
161 3300013296 Ga0157374_10004173 Ga0157374_1000417312 318
162 3300013296 Ga0157374_10131227 Ga0157374_101312273 318
163 3300013297 Ga0157378_10027450 Ga0157378_100274503 318
164 3300013297 Ga0157378_10112465 Ga0157378_101124652 318
165 3300013306 Ga0163162_10019074 Ga0163162_100190741 318
166 3300013308 Ga0157375_10000482 Ga0157375_100004822 318
167 3300014325 Ga0163163_10045074 Ga0163163_100450743 318
168 3300014969 Ga0157376_10026218 Ga0157376_100262185 318
169 3300014969 Ga0157376_10059083 Ga0157376_100590834 318
170 3300017792 Ga0163161_10039200 Ga0163161_100392004 318
171 3300025321 Ga0207656_10000974 Ga0207656_100009742 318
172 3300025907 Ga0207645_10041219 Ga0207645_100412194 318
173 3300025908 Ga0207643_10040971 Ga0207643_100409713 318
174 3300025908 Ga0207643_10108440 Ga0207643_101084402 318
175 3300025920 Ga0207649_10019079 Ga0207649_100190792 318
176 3300025925 Ga0207650_10003465 Ga0207650_1000346511 318
177 3300025925 Ga0207650_10056652 Ga0207650_100566522 318
178 3300025926 Ga0207659_10004672 Ga0207659_100046726 318
179 3300025927 Ga0207687_10378180 Ga0207687_103781801 318
180 3300025931 Ga0207644_10000418 Ga0207644_1000041812 318
181 3300025931 Ga0207644_10161055 Ga0207644_101610553 318
182 3300025937 Ga0207669_10152080 Ga0207669_101520802 318
183 3300025938 Ga0207704_10062124 Ga0207704_100621241 318
184 3300025940 Ga0207691_10000319 Ga0207691_100003192 318
185 3300025941 Ga0207711_10157597 Ga0207711_101575971 318
186 3300025942 Ga0207689_10024775 Ga0207689_100247753 318
187 3300025942 Ga0207689_10245064 Ga0207689_102450642 318
188 3300025944 Ga0207661_10024178 Ga0207661_100241782 318
189 3300025945 Ga0207679_10133286 Ga0207679_101332862 318
190 3300025960 Ga0207651_10001418 Ga0207651_100014188 318
191 3300025972 Ga0207668_10083754 Ga0207668_100837541 318
192 3300025981 Ga0207640_10002548 Ga0207640_1000254810 318
193 3300026075 Ga0207708_10005760 Ga0207708_100057606 318
194 3300026075 Ga0207708_10007249 Ga0207708_100072496 318
195 3300026089 Ga0207648_10036740 Ga0207648_100367404 318
196 3300026095 Ga0207676_10034633 Ga0207676_100346331 318
197 3300026095 Ga0207676_10043250 Ga0207676_100432504 318
198 3300026118 Ga0207675_100024855 Ga0207675_1000248552 318
199 3300026118 Ga0207675_100098647 Ga0207675_1000986472 318
200 3300026121 Ga0207683_10002093 Ga0207683_1000209318 318
201 3300026121 Ga0207683_10043032 Ga0207683_100430321 318
202 3300026142 Ga0207698_10055322 Ga0207698_100553224 318
203 3300026142 Ga0207698_10223161 Ga0207698_102231612 318
204 3300027907 Ga0207428_10186529 Ga0207428_101865292 318
205 3300028379 Ga0268266_10353002 Ga0268266_103530021 318
206 3300041486 Ga0451807_0915961 Ga0451807_0915961_1003_1971 318
207 3300046459 Ga0495629_0076154 Ga0495629_0076154_1256_2224 318
208 3300046528 Ga0495642_0038703 Ga0495642_0038703_905_1870 318
209 3300046539 Ga0495621_0016539 Ga0495621_0016539_815_1783 318
210 3300046683 Ga0495658_0038858 Ga0495658_0038858_1639_2604 318
211 3300048907 Ga0496104_0000434 Ga0496104_0000434_1787_2764 318
212 3300048907 Ga0496104_0003487 Ga0496104_0003487_11719_12696 318
213 3300048908 Ga0496105_0090171 Ga0496105_0090171_316_1284 318
214 3300048908 Ga0496105_0107377 Ga0496105_0107377_470_1447 318
215 3300048911 Ga0496108_0203635 Ga0496108_0203635_133_1101 318
216 3300048912 Ga0496109_0026898 Ga0496109_0026898_153_1121 318
217 3300048913 Ga0496110_0001712 Ga0496110_0001712_136_1104 318
218 3300048913 Ga0496110_0442417 Ga0496110_0442417_35_1003 318
219 3300048916 Ga0496113_0219126 Ga0496113_0219126_501_1478 318
220 3300048917 Ga0496114_0030598 Ga0496114_0030598_160_1128 318
221 3300048917 Ga0496114_0143795 Ga0496114_0143795_1087_2055 318
222 3300050492 nmdc:mga0yw44_3893_c2 nmdc:mga0yw44_3893_c2_551_1522 318
223 3300050493 nmdc:mga0k408_203369_c1 nmdc:mga0k408_203369_c1_110_1081 318
224 3300050511 nmdc:mga08y16_452926_c1 nmdc:mga08y16_452926_c1_202_1290 318
225 3300050516 nmdc:mga0sz30_44033_c1 nmdc:mga0sz30_44033_c1_692_1663 318
226 3300053153 Ga0500616_0002206 Ga0500616_0002206_8710_9681 318
227 3300005544 Ga0070686_100137983 Ga0070686_1001379832 319
228 3300005539 Ga0068853_100085153 Ga0068853_1000851532 320
229 3300005937 Ga0081455_10007625 Ga0081455_100076259 320
230 3300037471 Ga0395905_0234489 Ga0395905_0234489_101_1078 320
231 3300042007 Ga0439449_0001455 Ga0439449_0001455_6599_7576 320
232 3300005445 Ga0070708_100158391 Ga0070708_1001583912 321
233 3300007076 Ga0075435_100181228 Ga0075435_1001812281 321
234 3300048909 Ga0496106_0093286 Ga0496106_0093286_779_1765 321
235 3300005471 Ga0070698_100056349 Ga0070698_1000563492 322
236 3300005618 Ga0068864_100231120 Ga0068864_1002311201 322
237 3300005841 Ga0068863_100128399 Ga0068863_1001283991 322
238 3300006237 Ga0097621_100098318 Ga0097621_1000983181 322
239 3300006358 Ga0068871_100136999 Ga0068871_1001369992 322
240 3300006880 Ga0075429_100039664 Ga0075429_1000396643 322
241 3300014968 Ga0157379_10277446 Ga0157379_102774461 322
242 3300025925 Ga0207650_10069450 Ga0207650_100694503 322
243 3300025926 Ga0207659_10186376 Ga0207659_101863761 322
244 3300025940 Ga0207691_10062575 Ga0207691_100625752 322
245 3300026088 Ga0207641_10040421 Ga0207641_100404212 322
246 3300026089 Ga0207648_10342430 Ga0207648_103424301 322
247 3300046664 Ga0495659_0048688 Ga0495659_0048688_76_1056 322
248 3300048904 Ga0496101_0328069 Ga0496101_0328069_104_1084 322
249 3300048907 Ga0496104_0002239 Ga0496104_0002239_4037_5017 322
250 3300048907 Ga0496104_0050654 Ga0496104_0050654_2925_3905 322
251 3300048908 Ga0496105_0011456 Ga0496105_0011456_1802_2782 322
252 3300048908 Ga0496105_0082458 Ga0496105_0082458_1424_2404 322
253 3300048909 Ga0496106_0125638 Ga0496106_0125638_980_1960 322
254 3300048911 Ga0496108_0135015 Ga0496108_0135015_44_1024 322
255 3300048912 Ga0496109_0174833 Ga0496109_0174833_753_1733 322
256 3300048918 Ga0496115_0025764 Ga0496115_0025764_143_1123 322
257 3300050508 nmdc:mga09592_70118_c1 nmdc:mga09592_70118_c1_1454_2434 322
258 3300050509 nmdc:mga0qj67_30949_c1 nmdc:mga0qj67_30949_c1_1209_2189 322
259 3300050510 nmdc:mga06r32_44581_c1 nmdc:mga06r32_44581_c1_380_1360 322
260 3300035116 Ga0373945_0022048 Ga0373945_0022048_960_1994 323
261 3300035171 Ga0373946_0036312 Ga0373946_0036312_236_1270 323
262 3300046459 Ga0495629_0093952 Ga0495629_0093952_997_2013 323
263 3300047315 Ga0495581_0070007 Ga0495581_0070007_748_1782 323
264 3300005937 Ga0081455_10033900 Ga0081455_100339004 324
265 3300006844 Ga0075428_100272494 Ga0075428_1002724942 324
266 3300006846 Ga0075430_100066961 Ga0075430_1000669612 324
267 3300006847 Ga0075431_100082437 Ga0075431_1000824373 324
268 3300009094 Ga0111539_10192195 Ga0111539_101921952 324
269 3300031240 Ga0265320_10047327 Ga0265320_100473272 324
270 3300031240 Ga0265320_10060247 Ga0265320_100602472 324
271 3300031241 Ga0265325_10057347 Ga0265325_100573472 324
272 3300031241 Ga0265325_10089275 Ga0265325_100892752 324
273 3300031242 Ga0265329_10039525 Ga0265329_100395251 324
274 3300031247 Ga0265340_10020800 Ga0265340_100208003 324
275 3300031344 Ga0265316_10271693 Ga0265316_102716932 324
276 3300031712 Ga0265342_10100839 Ga0265342_101008391 324
277 3300035083 Ga0373926_0074336 Ga0373926_0074336_184_1158 324
278 3300035089 Ga0373944_0079045 Ga0373944_0079045_11_985 324
279 3300035111 Ga0373923_0093067 Ga0373923_0093067_306_1280 324
280 3300035113 Ga0373936_0139712 Ga0373936_0139712_60_1034 324
281 3300035116 Ga0373945_0029923 Ga0373945_0029923_196_1170 324
282 3300035170 Ga0373943_0016423 Ga0373943_0016423_236_1210 324
283 3300035171 Ga0373946_0008578 Ga0373946_0008578_177_1151 324
284 3300035692 Ga0373935_0224245 Ga0373935_0224245_250_1224 324
285 3300035695 Ga0373927_0019879 Ga0373927_0019879_1334_2308 324
286 3300037068 Ga0373925_0117115 Ga0373925_0117115_786_1760 324
287 3300046472 Ga0495580_0048052 Ga0495580_0048052_14_988 324
288 3300046474 Ga0495605_0087756 Ga0495605_0087756_111_1088 324
289 3300046491 Ga0495584_0109536 Ga0495584_0109536_165_1151 324
290 3300046492 Ga0495585_0011501 Ga0495585_0011501_2894_3871 324
291 3300046499 Ga0495594_0060654 Ga0495594_0060654_961_1935 324
292 3300046517 Ga0495630_0283672 Ga0495630_0283672_234_1208 324
293 3300046520 Ga0495637_0032095 Ga0495637_0032095_235_1209 324
294 3300046523 Ga0495644_0041417 Ga0495644_0041417_30_1004 324
295 3300046526 Ga0495666_0042521 Ga0495666_0042521_1127_2101 324
296 3300046528 Ga0495642_0046939 Ga0495642_0046939_724_1701 324
297 3300046531 Ga0495665_0117482 Ga0495665_0117482_181_1155 324
298 3300046537 Ga0495598_0005558 Ga0495598_0005558_444_1421 324
299 3300046539 Ga0495621_0119999 Ga0495621_0119999_27_1001 324
300 3300046557 Ga0495622_0126358 Ga0495622_0126358_15_989 324
301 3300046615 Ga0495656_0035242 Ga0495656_0035242_1042_2019 324
302 3300046674 Ga0495588_0015185 Ga0495588_0015185_214_1188 324
303 3300046681 Ga0495647_0083520 Ga0495647_0083520_239_1213 324
304 3300046689 Ga0495613_0071365 Ga0495613_0071365_1086_2072 324
305 3300046689 Ga0495613_0074491 Ga0495613_0074491_208_1182 324
306 3300046794 Ga0495589_0027290 Ga0495589_0027290_829_1803 324
307 3300047318 Ga0495636_0095613 Ga0495636_0095613_226_1218 324
308 3300047445 Ga0495677_0017535 Ga0495677_0017535_118_1092 324
309 3300050507 nmdc:mga05p37_14797_c1 nmdc:mga05p37_14797_c1_224_1198 324
310 3300050509 nmdc:mga0qj67_114385_c1 nmdc:mga0qj67_114385_c1_1000_1974 324
311 3300001989 JGI24739J22299_10003110 JGI24739J22299_100031106 325
312 3300002073 JGI24745J21846_1001594 JGI24745J21846_10015942 325
313 3300002074 JGI24748J21848_1000577 JGI24748J21848_10005775 325
314 3300002075 JGI24738J21930_10000272 JGI24738J21930_100002721 325
315 3300002076 JGI24749J21850_1000351 JGI24749J21850_10003513 325
316 3300002077 JGI24744J21845_10007470 JGI24744J21845_100074703 325
317 3300002126 JGI24035J26624_1000417 JGI24035J26624_10004173 325
318 3300002155 JGI24033J26618_1000610 JGI24033J26618_10006103 325
319 3300002239 JGI24034J26672_10000190 JGI24034J26672_100001904 325
320 3300005290 Ga0065712_10082160 Ga0065712_100821603 325
321 3300005293 Ga0065715_10000395 Ga0065715_1000039515 325
322 3300005328 Ga0070676_10000128 Ga0070676_1000012819 325
323 3300005330 Ga0070690_100000302 Ga0070690_1000003022 325
324 3300005331 Ga0070670_100019884 Ga0070670_1000198844 325
325 3300005333 Ga0070677_10000043 Ga0070677_1000004329 325
326 3300005334 Ga0068869_100000289 Ga0068869_10000028914 325
327 3300005335 Ga0070666_10001787 Ga0070666_100017876 325
328 3300005336 Ga0070680_100001826 Ga0070680_10000182614 325
329 3300005337 Ga0070682_100000988 Ga0070682_1000009884 325
330 3300005338 Ga0068868_100000408 Ga0068868_1000004084 325
331 3300005339 Ga0070660_100000182 Ga0070660_10000018213 325
332 3300005340 Ga0070689_100000224 Ga0070689_10000022436 325
333 3300005343 Ga0070687_100000656 Ga0070687_10000065612 325
334 3300005344 Ga0070661_100002755 Ga0070661_10000275513 325
335 3300005345 Ga0070692_10000614 Ga0070692_1000061412 325
336 3300005347 Ga0070668_100000564 Ga0070668_1000005642 325
337 3300005353 Ga0070669_100001946 Ga0070669_1000019461 325
338 3300005355 Ga0070671_100000598 Ga0070671_1000005988 325
339 3300005356 Ga0070674_100002568 Ga0070674_10000256811 325
340 3300005356 Ga0070674_100102342 Ga0070674_1001023422 325
341 3300005364 Ga0070673_100000198 Ga0070673_1000001984 325
342 3300005365 Ga0070688_100000189 Ga0070688_10000018924 325
343 3300005366 Ga0070659_100000677 Ga0070659_1000006772 325
344 3300005367 Ga0070667_100000436 Ga0070667_10000043635 325
345 3300005406 Ga0070703_10008818 Ga0070703_100088183 325
346 3300005434 Ga0070709_10047224 Ga0070709_100472243 325
347 3300005435 Ga0070714_100153759 Ga0070714_1001537592 325
348 3300005437 Ga0070710_10026425 Ga0070710_100264252 325
349 3300005438 Ga0070701_10000052 Ga0070701_100000522 325
350 3300005439 Ga0070711_100128305 Ga0070711_1001283052 325
351 3300005440 Ga0070705_100000973 Ga0070705_1000009732 325
352 3300005441 Ga0070700_100000330 Ga0070700_10000033025 325
353 3300005444 Ga0070694_100000352 Ga0070694_10000035225 325
354 3300005445 Ga0070708_100012248 Ga0070708_1000122485 325
355 3300005455 Ga0070663_100000331 Ga0070663_10000033125 325
356 3300005456 Ga0070678_100000087 Ga0070678_10000008735 325
357 3300005458 Ga0070681_10000593 Ga0070681_100005931 325
358 3300005459 Ga0068867_100000942 Ga0068867_10000094218 325
359 3300005466 Ga0070685_10011732 Ga0070685_100117321 325
360 3300005466 Ga0070685_10054569 Ga0070685_100545692 325
361 3300005471 Ga0070698_100271261 Ga0070698_1002712612 325
362 3300005530 Ga0070679_100003219 Ga0070679_10000321914 325
363 3300005535 Ga0070684_100000687 Ga0070684_1000006879 325
364 3300005536 Ga0070697_100237921 Ga0070697_1002379211 325
365 3300005539 Ga0068853_100000417 Ga0068853_10000041725 325
366 3300005543 Ga0070672_100000623 Ga0070672_10000062320 325
367 3300005544 Ga0070686_100002393 Ga0070686_1000023935 325
368 3300005545 Ga0070695_100351153 Ga0070695_1003511531 325
369 3300005546 Ga0070696_100002225 Ga0070696_10000222513 325
370 3300005547 Ga0070693_100000771 Ga0070693_1000007711 325
371 3300005548 Ga0070665_100013381 Ga0070665_1000133816 325
372 3300005549 Ga0070704_100001277 Ga0070704_1000012779 325
373 3300005563 Ga0068855_100040730 Ga0068855_1000407303 325
374 3300005564 Ga0070664_100010901 Ga0070664_1000109016 325
375 3300005577 Ga0068857_100000047 Ga0068857_10000004727 325
376 3300005614 Ga0068856_100001905 Ga0068856_10000190524 325
377 3300005615 Ga0070702_100000495 Ga0070702_10000049514 325
378 3300005616 Ga0068852_100001248 Ga0068852_10000124816 325
379 3300005617 Ga0068859_100001380 Ga0068859_1000013802 325
380 3300005618 Ga0068864_100002657 Ga0068864_1000026572 325
381 3300005719 Ga0068861_100000336 Ga0068861_1000003364 325
382 3300005840 Ga0068870_10000037 Ga0068870_1000003714 325
383 3300005841 Ga0068863_100000906 Ga0068863_1000009062 325
384 3300005842 Ga0068858_100004037 Ga0068858_10000403714 325
385 3300005843 Ga0068860_100002585 Ga0068860_1000025854 325
386 3300005844 Ga0068862_100000763 Ga0068862_1000007634 325
387 3300005937 Ga0081455_10020340 Ga0081455_100203402 325
388 3300005983 Ga0081540_1009813 Ga0081540_10098132 325
389 3300005985 Ga0081539_10018612 Ga0081539_100186124 325
390 3300006028 Ga0070717_10021945 Ga0070717_100219453 325
391 3300006038 Ga0075365_10038850 Ga0075365_100388501 325
392 3300006051 Ga0075364_10040151 Ga0075364_100401512 325
393 3300006173 Ga0070716_100055731 Ga0070716_1000557312 325
394 3300006175 Ga0070712_100000600 Ga0070712_1000006008 325
395 3300006175 Ga0070712_100055492 Ga0070712_1000554922 325
396 3300006177 Ga0075362_10065204 Ga0075362_100652042 325
397 3300006178 Ga0075367_10081339 Ga0075367_100813392 325
398 3300006237 Ga0097621_100000416 Ga0097621_1000004165 325
399 3300006358 Ga0068871_100001611 Ga0068871_10000161112 325
400 3300006847 Ga0075431_100027286 Ga0075431_1000272862 325
401 3300006852 Ga0075433_10009247 Ga0075433_100092475 325
402 3300006871 Ga0075434_100002322 Ga0075434_1000023224 325
403 3300006871 Ga0075434_100086191 Ga0075434_1000861913 325
404 3300006881 Ga0068865_100000340 Ga0068865_10000034025 325
405 3300006931 Ga0097620_100001380 Ga0097620_1000013802 325
406 3300007076 Ga0075435_100146526 Ga0075435_1001465262 325
407 3300007265 Ga0099794_10019068 Ga0099794_100190682 325
408 3300007788 Ga0099795_10009473 Ga0099795_100094734 325
409 3300009011 Ga0105251_10079935 Ga0105251_100799353 325
410 3300009092 Ga0105250_10087595 Ga0105250_100875951 325
411 3300009093 Ga0105240_10099178 Ga0105240_100991783 325
412 3300009094 Ga0111539_10387064 Ga0111539_103870642 325
413 3300009098 Ga0105245_10001087 Ga0105245_1000108725 325
414 3300009101 Ga0105247_10001882 Ga0105247_100018821 325
415 3300009148 Ga0105243_10001705 Ga0105243_100017053 325
416 3300009174 Ga0105241_10001794 Ga0105241_100017941 325
417 3300009176 Ga0105242_10004457 Ga0105242_100044571 325
418 3300009177 Ga0105248_10003875 Ga0105248_100038751 325
419 3300009545 Ga0105237_10004455 Ga0105237_100044551 325
420 3300009553 Ga0105249_10001030 Ga0105249_1000103025 325
421 3300010159 Ga0099796_10082585 Ga0099796_100825852 325
422 3300010375 Ga0105239_10002253 Ga0105239_1000225325 325
423 3300011119 Ga0105246_10000057 Ga0105246_1000005725 325
424 3300013100 Ga0157373_10015723 Ga0157373_100157236 325
425 3300013102 Ga0157371_10005939 Ga0157371_100059395 325
426 3300013105 Ga0157369_10300663 Ga0157369_103006632 325
427 3300013296 Ga0157374_10003737 Ga0157374_100037371 325
428 3300013297 Ga0157378_10002661 Ga0157378_100026611 325
429 3300013306 Ga0163162_10037442 Ga0163162_100374422 325
430 3300013306 Ga0163162_10346107 Ga0163162_103461072 325
431 3300013307 Ga0157372_10008410 Ga0157372_100084102 325
432 3300013308 Ga0157375_10000983 Ga0157375_1000098325 325
433 3300013308 Ga0157375_10299922 Ga0157375_102999222 325
434 3300014325 Ga0163163_10002371 Ga0163163_100023717 325
435 3300014326 Ga0157380_10000226 Ga0157380_100002261 325
436 3300014326 Ga0157380_10140021 Ga0157380_101400212 325
437 3300014745 Ga0157377_10000681 Ga0157377_100006815 325
438 3300014968 Ga0157379_10000779 Ga0157379_100007795 325
439 3300014969 Ga0157376_10002318 Ga0157376_100023181 325
440 3300014969 Ga0157376_10152733 Ga0157376_101527332 325
441 3300017792 Ga0163161_10000209 Ga0163161_1000020922 325
442 3300021361 Ga0213872_10059877 Ga0213872_100598772 325
443 3300025271 Ga0207666_1000011 Ga0207666_100001115 325
444 3300025290 Ga0207673_1000047 Ga0207673_10000472 325
445 3300025315 Ga0207697_10000392 Ga0207697_100003921 325
446 3300025711 Ga0207696_1050358 Ga0207696_10503581 325
447 3300025885 Ga0207653_10012297 Ga0207653_100122972 325
448 3300025893 Ga0207682_10000004 Ga0207682_100000041 325
449 3300025898 Ga0207692_10034581 Ga0207692_100345812 325
450 3300025899 Ga0207642_10002298 Ga0207642_100022983 325
451 3300025900 Ga0207710_10001729 Ga0207710_100017293 325
452 3300025901 Ga0207688_10000152 Ga0207688_100001521 325
453 3300025901 Ga0207688_10064037 Ga0207688_100640372 325
454 3300025903 Ga0207680_10001184 Ga0207680_100011848 325
455 3300025904 Ga0207647_10003824 Ga0207647_1000382411 325
456 3300025905 Ga0207685_10033134 Ga0207685_100331341 325
457 3300025907 Ga0207645_10000281 Ga0207645_1000028115 325
458 3300025908 Ga0207643_10000012 Ga0207643_1000001229 325
459 3300025910 Ga0207684_10071925 Ga0207684_100719253 325
460 3300025910 Ga0207684_10142437 Ga0207684_101424372 325
461 3300025911 Ga0207654_10004367 Ga0207654_100043674 325
462 3300025912 Ga0207707_10000551 Ga0207707_1000055117 325
463 3300025913 Ga0207695_10147984 Ga0207695_101479842 325
464 3300025914 Ga0207671_10004326 Ga0207671_100043268 325
465 3300025915 Ga0207693_10007457 Ga0207693_100074574 325
466 3300025915 Ga0207693_10033249 Ga0207693_100332492 325
467 3300025915 Ga0207693_10047090 Ga0207693_100470902 325
468 3300025917 Ga0207660_10000008 Ga0207660_1000000891 325
469 3300025918 Ga0207662_10000123 Ga0207662_1000012315 325
470 3300025919 Ga0207657_10000358 Ga0207657_1000035829 325
471 3300025920 Ga0207649_10000545 Ga0207649_100005455 325
472 3300025921 Ga0207652_10011583 Ga0207652_100115833 325
473 3300025922 Ga0207646_10158904 Ga0207646_101589042 325
474 3300025923 Ga0207681_10000286 Ga0207681_1000028615 325
475 3300025925 Ga0207650_10005306 Ga0207650_100053063 325
476 3300025926 Ga0207659_10000023 Ga0207659_1000002391 325
477 3300025926 Ga0207659_10065015 Ga0207659_100650152 325
478 3300025927 Ga0207687_10000149 Ga0207687_100001497 325
479 3300025928 Ga0207700_10041333 Ga0207700_100413332 325
480 3300025928 Ga0207700_10070497 Ga0207700_100704972 325
481 3300025928 Ga0207700_10357550 Ga0207700_103575501 325
482 3300025931 Ga0207644_10000724 Ga0207644_100007248 325
483 3300025932 Ga0207690_10000203 Ga0207690_1000020325 325
484 3300025933 Ga0207706_10001339 Ga0207706_100013391 325
485 3300025934 Ga0207686_10000995 Ga0207686_100009957 325
486 3300025935 Ga0207709_10000607 Ga0207709_1000060713 325
487 3300025936 Ga0207670_10000125 Ga0207670_1000012514 325
488 3300025937 Ga0207669_10000122 Ga0207669_100001224 325
489 3300025937 Ga0207669_10100030 Ga0207669_101000302 325
490 3300025938 Ga0207704_10091789 Ga0207704_100917892 325
491 3300025939 Ga0207665_10001932 Ga0207665_100019322 325
492 3300025940 Ga0207691_10001334 Ga0207691_100013341 325
493 3300025941 Ga0207711_10000590 Ga0207711_100005901 325
494 3300025941 Ga0207711_10036587 Ga0207711_100365873 325
495 3300025942 Ga0207689_10000008 Ga0207689_1000000815 325
496 3300025944 Ga0207661_10000104 Ga0207661_1000010445 325
497 3300025945 Ga0207679_10000053 Ga0207679_100000534 325
498 3300025949 Ga0207667_10010178 Ga0207667_100101783 325
499 3300025960 Ga0207651_10009405 Ga0207651_100094052 325
500 3300025961 Ga0207712_10000156 Ga0207712_1000015611 325
501 3300025972 Ga0207668_10000251 Ga0207668_1000025125 325
502 3300025972 Ga0207668_10159317 Ga0207668_101593172 325
503 3300025981 Ga0207640_10000157 Ga0207640_1000015722 325
504 3300025986 Ga0207658_10001085 Ga0207658_1000108512 325
505 3300026023 Ga0207677_10000609 Ga0207677_100006093 325
506 3300026035 Ga0207703_10007370 Ga0207703_100073702 325
507 3300026041 Ga0207639_10001949 Ga0207639_100019496 325
508 3300026067 Ga0207678_10001114 Ga0207678_1000111425 325
509 3300026075 Ga0207708_10000734 Ga0207708_1000073425 325
510 3300026078 Ga0207702_10027811 Ga0207702_100278111 325
511 3300026088 Ga0207641_10000794 Ga0207641_1000079436 325
512 3300026089 Ga0207648_10001602 Ga0207648_100016022 325
513 3300026095 Ga0207676_10000934 Ga0207676_100009341 325
514 3300026116 Ga0207674_10009261 Ga0207674_1000926111 325
515 3300026118 Ga0207675_100000604 Ga0207675_10000060425 325
516 3300026121 Ga0207683_10000006 Ga0207683_1000000694 325
517 3300026142 Ga0207698_10000378 Ga0207698_1000037813 325
518 3300027717 Ga0209998_10000622 Ga0209998_100006223 325
519 3300027866 Ga0209813_10042793 Ga0209813_100427932 325
520 3300027907 Ga0207428_10000112 Ga0207428_100001125 325
521 3300028379 Ga0268266_10008074 Ga0268266_100080747 325
522 3300028380 Ga0268265_10002652 Ga0268265_1000265213 325
523 3300028381 Ga0268264_10002426 Ga0268264_100024262 325
524 3300034957 Ga0373938_0001311 Ga0373938_0001311_1187_2164 325
525 3300035088 Ga0373940_0020414 Ga0373940_0020414_247_1224 325
526 3300035092 Ga0373952_0002039 Ga0373952_0002039_1246_2223 325
527 3300035112 Ga0373932_0002972 Ga0373932_0002972_1123_2100 325
528 3300035113 Ga0373936_0008843 Ga0373936_0008843_599_1639 325
529 3300035114 Ga0373939_0002339 Ga0373939_0002339_1608_2585 325
530 3300035115 Ga0373941_0002973 Ga0373941_0002973_1229_2206 325
531 3300035121 Ga0373960_0008610 Ga0373960_0008610_1216_2193 325
532 3300035241 Ga0373961_0003015 Ga0373961_0003015_2222_3199 325
533 3300035691 Ga0373931_0000687 Ga0373931_0000687_2389_3366 325
534 3300036401 Ga0373937_0339714 Ga0373937_0339714_236_1213 325
535 3300046455 Ga0495603_0006198 Ga0495603_0006198_191_1231 325
536 3300046461 Ga0495641_0094294 Ga0495641_0094294_48_1034 325
537 3300046476 Ga0495662_0022103 Ga0495662_0022103_1231_2271 325
538 3300046491 Ga0495584_0099783 Ga0495584_0099783_199_1176 325
539 3300046492 Ga0495585_0011090 Ga0495585_0011090_2270_3247 325
540 3300046499 Ga0495594_0034622 Ga0495594_0034622_1477_2517 325
541 3300046500 Ga0495596_0032329 Ga0495596_0032329_59_1036 325
542 3300046514 Ga0495618_0105173 Ga0495618_0105173_650_1627 325
543 3300046518 Ga0495631_0045847 Ga0495631_0045847_118_1095 325
544 3300046537 Ga0495598_0001385 Ga0495598_0001385_3533_4510 325
545 3300046538 Ga0495609_0117289 Ga0495609_0117289_38_1078 325
546 3300046684 Ga0495669_0057031 Ga0495669_0057031_470_1447 325
547 3300046691 Ga0495670_0021075 Ga0495670_0021075_2206_3183 325
548 3300046692 Ga0495671_0052045 Ga0495671_0052045_329_1306 325
549 3300047446 Ga0495679_019841 Ga0495679_019841_46_1023 325
550 3300047471 Ga0495684_0220573 Ga0495684_0220573_259_1236 325
551 3300048903 Ga0496100_0001037 Ga0496100_0001037_5683_6660 325
552 3300048904 Ga0496101_0002660 Ga0496101_0002660_1952_2929 325
553 3300048905 Ga0496102_0001120 Ga0496102_0001120_6746_7723 325
554 3300048906 Ga0496103_0000611 Ga0496103_0000611_7872_8849 325
555 3300048907 Ga0496104_0000383 Ga0496104_0000383_5174_6151 325
556 3300048909 Ga0496106_0000541 Ga0496106_0000541_19102_20079 325
557 3300048909 Ga0496106_0040908 Ga0496106_0040908_1047_2024 325
558 3300048910 Ga0496107_0000493 Ga0496107_0000493_10315_11292 325
559 3300048910 Ga0496107_0056207 Ga0496107_0056207_1587_2564 325
560 3300048911 Ga0496108_0093195 Ga0496108_0093195_872_1849 325
561 3300048912 Ga0496109_0002920 Ga0496109_0002920_13044_14021 325
562 3300048912 Ga0496109_0077652 Ga0496109_0077652_875_1852 325
563 3300048913 Ga0496110_0208981 Ga0496110_0208981_245_1222 325
564 3300048914 Ga0496111_0131812 Ga0496111_0131812_154_1131 325
565 3300048915 Ga0496112_0051062 Ga0496112_0051062_2956_3933 325
566 3300048916 Ga0496113_0036261 Ga0496113_0036261_393_1370 325
567 3300048916 Ga0496113_0068971 Ga0496113_0068971_1487_2464 325
568 3300048917 Ga0496114_0003043 Ga0496114_0003043_4443_5420 325
569 3300048918 Ga0496115_0003177 Ga0496115_0003177_6765_7742 325
570 3300048918 Ga0496115_0048785 Ga0496115_0048785_1037_2014 325
571 3300049576 Ga0501040_0143140 Ga0501040_0143140_471_1448 325
572 3300049580 Ga0501046_0206920 Ga0501046_0206920_441_1418 325
573 3300049822 Ga0501035_0064120 Ga0501035_0064120_1820_2821 325
574 3300049823 Ga0501044_0036008 Ga0501044_0036008_2630_3631 325
575 3300050489 nmdc:mga03683_27101_c1 nmdc:mga03683_27101_c1_179_1156 325
576 3300050491 nmdc:mga00v17_79253_c1 nmdc:mga00v17_79253_c1_786_1763 325
577 3300050492 nmdc:mga0yw44_132323_c1 nmdc:mga0yw44_132323_c1_139_1116 325
578 3300050494 nmdc:mga06z11_25983_c1 nmdc:mga06z11_25983_c1_301_1278 325
579 3300050495 nmdc:mga04h51_49486_c1 nmdc:mga04h51_49486_c1_303_1280 325
580 3300050507 nmdc:mga05p37_297552_c1 nmdc:mga05p37_297552_c1_823_1800 325
581 3300050508 nmdc:mga09592_277806_c1 nmdc:mga09592_277806_c1_451_1428 325
582 3300050510 nmdc:mga06r32_139195_c1 nmdc:mga06r32_139195_c1_126_1103 325
583 3300050511 nmdc:mga08y16_802_c1 nmdc:mga08y16_802_c1_4966_5943 325
584 3300050512 nmdc:mga0n895_291_c1 nmdc:mga0n895_291_c1_17768_18745 325
585 3300050515 nmdc:mga0a205_1940_c1 nmdc:mga0a205_1940_c1_14456_15433 325
586 3300053077 Ga0495601_0036988 Ga0495601_0036988_513_1493 325
587 3300061734 Ga0530510_0169060 Ga0530510_0169060_253_1230 325

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03401

TctC

Tripartite tricarboxylate transporter family receptor

59

331

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
5oku-assembly1.cif.gz_A r. palustris rpa4515 with adipate 0.9663 29 323
8hkb-assembly1.cif.gz_A tpa bound-form of periplasmic terephthalate binding protein (tbp) from ideonella sakaiensis mutant k184d 0.9598 34 325
2dvz-assembly1.cif.gz_A structure of a periplasmic transporter 0.9579 30 325
2f5x-assembly3.cif.gz_C structure of periplasmic binding protein bugd 0.9525 30 323
5oku-assembly1.cif.gz_A r. palustris rpa4515 with adipate 0.9506 29 323
ID Description Score Start End Superfamily
2dvzA02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9549 129 244 3.40.190.10
6hkeC02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9426 128 250 3.40.190.10
4x9tA02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9425 128 244 3.40.190.10
2qpqC02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.942 128 250 3.40.190.10
2qpqB01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Bordetella uptake gene, domain 1 0.9356 30 325 3.40.190.150
ID Description Score Start End GO Terms
AF-A0A537DML3-F1-model_v4 Tripartite tricarboxylate transporter substrate binding protein 0.9784 38 323
AF-A0A1J5PQ67-F1-model_v4 Tripartite tricarboxylate transporter family receptor 0.9778 67 323
AF-A0A1F4AHA8-F1-model_v4 Tripartite tricarboxylate transporter substrate binding protein 0.9764 55 322
AF-A0A5C8CF86-F1-model_v4 deleted 0.9753 41 325
AF-A0A4Q2L567-F1-model_v4 deleted 0.9695 67 220

Feature Viewer

pLDDT pTM Quality
91.02 0.86 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map