F466715
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 587 | 341 | 582 | 323 |
Family's Representative Sequence
| Representative Sequence | 3300050511|nmdc:mga08y16_452926_c1|nmdc:mga08y16_452926_c1_202_1290 |
| Length | 355 |
| Sequence | MSNAKIAALATARGTTMTIARRKFLHLAALPRIATAQAYPSKQLRWIVGFPPGGGADIVSRIMAPWLAERLGQSVIVENRPGASSNISVQAVVNAPPDGYTLLFLPASAAVNVSLFDNLTYNLTRDIAPVSGLIDFPLVMVANPSFPAKTVGELIAYAKANPGKVSVGSFGTGSTSHVAGELLKMMTGTSMIHVPYRGGAPMVTDLIAGQVQVGIDVLTGSLAHIRSGALRILAVAGKSRSDFLPEVPTIGETVAGYEANSWCGLGVPRGTPTEIVERLNREINAGLTNPAVKTRLADVATTPIIYTPAEFGAYVASEVDKWAKVVRTAGIRPEGVSAGTRARSAAAGSAESRAR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2808606395 | Achromobacter sp. SLBN-14 | Isolate | Unclassified |
| 2 | 2855730933 | Achromobacter sp. HZ28 | Isolate | Nodule |
| 3 | 2855767633 | Achromobacter sp. HZ34 | Isolate | Nodule |
| 4 | 2881412998 | Achromobacter aloeverae AVA-1 | Isolate | Unclassified |
| 5 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 6 | 3300002073 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 | Metagenome | Rhizosphere |
| 7 | 3300002074 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 | Metagenome | Rhizosphere |
| 8 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 9 | 3300002076 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 | Metagenome | Rhizosphere |
| 10 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 11 | 3300002126 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 | Metagenome | Rhizosphere |
| 12 | 3300002155 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 | Metagenome | Rhizosphere |
| 13 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 14 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 15 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 16 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 17 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 19 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 20 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 23 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 25 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 26 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 27 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 29 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 30 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 32 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 39 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 42 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 43 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 45 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 46 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 47 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 50 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 51 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 55 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 56 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 57 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 58 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 59 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 61 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 62 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 63 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 64 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 66 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 67 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 70 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 71 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 72 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 73 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 74 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 75 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 76 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 77 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 78 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 79 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 80 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 81 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 82 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 83 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 84 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 85 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 86 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 87 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 88 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 89 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 90 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 91 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 92 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 93 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 94 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 95 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 96 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 97 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 98 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 99 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 101 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 102 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 103 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 104 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 105 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 106 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 107 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 108 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 109 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 111 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 112 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 113 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 114 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 115 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 116 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 118 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 119 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 121 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 122 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 123 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 124 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 125 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 126 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 127 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 128 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 129 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 130 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 131 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 132 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 133 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 134 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 135 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 136 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 137 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 138 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 139 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 140 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 141 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 142 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 143 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 144 | 3300025271 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025290 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 147 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 213 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 214 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 218 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 219 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 220 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 221 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 222 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 223 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 224 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 225 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 226 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 227 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 228 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 229 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 230 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 231 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 232 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 233 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 234 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 235 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 236 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 237 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 238 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 239 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 240 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 241 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 242 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 243 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 244 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 245 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 246 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 247 | 3300042003 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 | Metagenome | Rhizosphere |
| 248 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 249 | 3300042437 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 | Metagenome | Rhizosphere |
| 250 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 251 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 252 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 253 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 254 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 299 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 300 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 301 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 302 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 303 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 304 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 305 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 306 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 307 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 308 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 309 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 310 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 311 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 312 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 313 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 314 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 315 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 316 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 317 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 318 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 319 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 320 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 321 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 322 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 323 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 324 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 325 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 326 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 327 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 328 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 329 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 330 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 331 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 332 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 333 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 334 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 335 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 336 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 337 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 340 | 3300053154 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere | Metagenome | Endosphere |
| 341 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.15 |
| Metatranscriptomes | 0 |
| Isolates | 0.85 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 3.75 |
| Nodule | 0.34 |
| Rhizoplane | 7.5 |
| Rhizosphere | 87.9 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.51 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24739J22299_10003110 | 3300001989 | Bacteria | 6332 |
| 2 | JGI24745J21846_1001594 | 3300002073 | Bacteria | 2222 |
| 3 | JGI24748J21848_1000577 | 3300002074 | Bacteria | 3947 |
| 4 | JGI24738J21930_10000272 | 3300002075 | Bacteria | 14121 |
| 5 | JGI24749J21850_1000351 | 3300002076 | Bacteria | 6864 |
| 6 | JGI24744J21845_10007470 | 3300002077 | Bacteria | 2259 |
| 7 | JGI24035J26624_1000417 | 3300002126 | Bacteria | 4027 |
| 8 | JGI24033J26618_1000610 | 3300002155 | Bacteria | 3440 |
| 9 | JGI24034J26672_10000190 | 3300002239 | Bacteria | 8244 |
| 10 | JGI25151J46595_10000159 | 3300003187 | Bacteria | 87280 |
| 11 | Ga0065712_10082160 | 3300005290 | Bacteria | 2942 |
| 12 | Ga0065715_10000395 | 3300005293 | Bacteria | 16132 |
| 13 | Ga0070676_10000128 | 3300005328 | Bacteria | 28446 |
| 14 | Ga0070683_100003185 | 3300005329 | Bacteria | 13240 |
| 15 | Ga0070690_100000302 | 3300005330 | Bacteria | 25387 |
| 16 | Ga0070670_100010951 | 3300005331 | Bacteria | 7747 |
| 17 | Ga0070670_100019884 | 3300005331 | Bacteria | 5765 |
| 18 | Ga0070670_100429425 | 3300005331 | Bacteria | 1169 |
| 19 | Ga0070677_10000043 | 3300005333 | Bacteria | 39363 |
| 20 | Ga0070677_10003290 | 3300005333 | Bacteria | 5203 |
| 21 | Ga0070677_10023785 | 3300005333 | Bacteria | 2271 |
| 22 | Ga0068869_100000289 | 3300005334 | Bacteria | 26851 |
| 23 | Ga0070666_10001787 | 3300005335 | Bacteria | 13097 |
| 24 | Ga0070666_10113655 | 3300005335 | Bacteria | 1874 |
| 25 | Ga0070666_10132143 | 3300005335 | Bacteria | 1735 |
| 26 | Ga0070680_100001826 | 3300005336 | Bacteria | 15639 |
| 27 | Ga0070682_100000988 | 3300005337 | Bacteria | 16490 |
| 28 | Ga0068868_100000408 | 3300005338 | Bacteria | 29034 |
| 29 | Ga0068868_100000731 | 3300005338 | Bacteria | 22214 |
| 30 | Ga0070660_100000182 | 3300005339 | Bacteria | 41532 |
| 31 | Ga0070689_100000224 | 3300005340 | Bacteria | 33883 |
| 32 | Ga0070689_100150873 | 3300005340 | Bacteria | 1874 |
| 33 | Ga0070687_100000656 | 3300005343 | Bacteria | 11499 |
| 34 | Ga0070661_100002755 | 3300005344 | Bacteria | 12054 |
| 35 | Ga0070661_100006036 | 3300005344 | Bacteria | 8334 |
| 36 | Ga0070692_10000614 | 3300005345 | Bacteria | 11219 |
| 37 | Ga0070668_100000564 | 3300005347 | Bacteria | 24760 |
| 38 | Ga0070668_100042787 | 3300005347 | Bacteria | 3472 |
| 39 | Ga0070669_100001946 | 3300005353 | Bacteria | 14914 |
| 40 | Ga0070675_100018334 | 3300005354 | Bacteria | 5570 |
| 41 | Ga0070675_100056208 | 3300005354 | Bacteria | 3242 |
| 42 | Ga0070675_100244560 | 3300005354 | Bacteria | 1568 |
| 43 | Ga0070671_100000598 | 3300005355 | Bacteria | 25820 |
| 44 | Ga0070671_100006361 | 3300005355 | Bacteria | 9428 |
| 45 | Ga0070671_100234145 | 3300005355 | Bacteria | 1558 |
| 46 | Ga0070674_100002568 | 3300005356 | Bacteria | 10047 |
| 47 | Ga0070674_100102342 | 3300005356 | Bacteria | 2089 |
| 48 | Ga0070674_100210291 | 3300005356 | Bacteria | 1507 |
| 49 | Ga0070673_100000198 | 3300005364 | Bacteria | 29614 |
| 50 | Ga0070673_100044911 | 3300005364 | Bacteria | 3423 |
| 51 | Ga0070673_100194330 | 3300005364 | Bacteria | 1744 |
| 52 | Ga0070688_100000189 | 3300005365 | Bacteria | 32631 |
| 53 | Ga0070688_100264488 | 3300005365 | Bacteria | 1230 |
| 54 | Ga0070659_100000677 | 3300005366 | Bacteria | 24818 |
| 55 | Ga0070667_100000436 | 3300005367 | Bacteria | 43897 |
| 56 | Ga0070667_100078873 | 3300005367 | Bacteria | 2814 |
| 57 | Ga0070667_100116992 | 3300005367 | Bacteria | 2315 |
| 58 | Ga0070667_100174158 | 3300005367 | Bacteria | 1901 |
| 59 | Ga0070703_10008818 | 3300005406 | Bacteria | 2840 |
| 60 | Ga0070709_10047224 | 3300005434 | Bacteria | 2681 |
| 61 | Ga0070709_10265370 | 3300005434 | Unclassified | 1242 |
| 62 | Ga0070714_100037938 | 3300005435 | Bacteria | 4051 |
| 63 | Ga0070714_100153759 | 3300005435 | Bacteria | 2075 |
| 64 | Ga0070714_100433803 | 3300005435 | Unclassified | 1246 |
| 65 | Ga0070713_100230610 | 3300005436 | Bacteria | 1683 |
| 66 | Ga0070710_10026425 | 3300005437 | Bacteria | 3084 |
| 67 | Ga0070701_10000052 | 3300005438 | Bacteria | 29983 |
| 68 | Ga0070711_100128305 | 3300005439 | Bacteria | 1885 |
| 69 | Ga0070705_100000973 | 3300005440 | Bacteria | 16061 |
| 70 | Ga0070705_100013435 | 3300005440 | Bacteria | 4189 |
| 71 | Ga0070700_100000330 | 3300005441 | Bacteria | 24645 |
| 72 | Ga0070700_100030685 | 3300005441 | Bacteria | 3215 |
| 73 | Ga0070694_100000352 | 3300005444 | Bacteria | 24645 |
| 74 | Ga0070694_100009893 | 3300005444 | Bacteria | 5861 |
| 75 | Ga0070694_100028037 | 3300005444 | Bacteria | 3661 |
| 76 | Ga0070708_100012248 | 3300005445 | Bacteria | 6994 |
| 77 | Ga0070708_100158391 | 3300005445 | Bacteria | 2109 |
| 78 | Ga0070663_100000331 | 3300005455 | Bacteria | 24645 |
| 79 | Ga0070678_100000087 | 3300005456 | Bacteria | 34818 |
| 80 | Ga0070678_100013375 | 3300005456 | Bacteria | 5142 |
| 81 | Ga0070681_10000593 | 3300005458 | Bacteria | 29740 |
| 82 | Ga0070681_10001245 | 3300005458 | Bacteria | 22156 |
| 83 | Ga0070681_10001610 | 3300005458 | Bacteria | 20098 |
| 84 | Ga0068867_100000942 | 3300005459 | Bacteria | 19791 |
| 85 | Ga0068867_100090845 | 3300005459 | Bacteria | 2317 |
| 86 | Ga0070685_10011732 | 3300005466 | Bacteria | 4592 |
| 87 | Ga0070685_10054569 | 3300005466 | Bacteria | 2319 |
| 88 | Ga0070706_100047939 | 3300005467 | Bacteria | 3943 |
| 89 | Ga0070698_100056349 | 3300005471 | Bacteria | 3984 |
| 90 | Ga0070698_100271261 | 3300005471 | Bacteria | 1628 |
| 91 | Ga0070699_100024861 | 3300005518 | Bacteria | 5162 |
| 92 | Ga0070699_100260207 | 3300005518 | Bacteria | 1552 |
| 93 | Ga0070699_100412707 | 3300005518 | Bacteria | 1222 |
| 94 | Ga0070679_100003219 | 3300005530 | Bacteria | 14920 |
| 95 | Ga0070679_100006873 | 3300005530 | Bacteria | 10610 |
| 96 | Ga0070684_100000687 | 3300005535 | Bacteria | 23266 |
| 97 | Ga0070684_100036551 | 3300005535 | Bacteria | 4209 |
| 98 | Ga0070697_100022533 | 3300005536 | Bacteria | 5001 |
| 99 | Ga0070697_100023172 | 3300005536 | Bacteria | 4937 |
| 100 | Ga0070697_100062012 | 3300005536 | Bacteria | 3050 |
| 101 | Ga0070697_100237921 | 3300005536 | Bacteria | 1554 |
| 102 | Ga0070697_100290534 | 3300005536 | Bacteria | 1404 |
| 103 | Ga0070697_100393346 | 3300005536 | Bacteria | 1202 |
| 104 | Ga0068853_100000417 | 3300005539 | Bacteria | 29141 |
| 105 | Ga0068853_100085153 | 3300005539 | Bacteria | 2770 |
| 106 | Ga0070672_100000155 | 3300005543 | Bacteria | 37829 |
| 107 | Ga0070672_100000623 | 3300005543 | Bacteria | 20781 |
| 108 | Ga0070686_100002393 | 3300005544 | Bacteria | 10338 |
| 109 | Ga0070686_100137983 | 3300005544 | Bacteria | 1694 |
| 110 | Ga0070695_100004241 | 3300005545 | Bacteria | 8389 |
| 111 | Ga0070695_100004325 | 3300005545 | Bacteria | 8317 |
| 112 | Ga0070695_100351153 | 3300005545 | Bacteria | 1105 |
| 113 | Ga0070696_100002225 | 3300005546 | Bacteria | 12786 |
| 114 | Ga0070696_100009047 | 3300005546 | Bacteria | 6669 |
| 115 | Ga0070696_100024753 | 3300005546 | Bacteria | 4079 |
| 116 | Ga0070693_100000771 | 3300005547 | Bacteria | 14121 |
| 117 | Ga0070665_100013381 | 3300005548 | Bacteria | 8258 |
| 118 | Ga0070665_100406213 | 3300005548 | Bacteria | 1370 |
| 119 | Ga0070704_100001277 | 3300005549 | Bacteria | 13292 |
| 120 | Ga0070704_100131087 | 3300005549 | Bacteria | 1943 |
| 121 | Ga0068855_100040730 | 3300005563 | Bacteria | 5512 |
| 122 | Ga0070664_100000147 | 3300005564 | Bacteria | 48438 |
| 123 | Ga0070664_100010901 | 3300005564 | Bacteria | 7370 |
| 124 | Ga0068857_100000047 | 3300005577 | Bacteria | 67784 |
| 125 | Ga0068854_100002758 | 3300005578 | Bacteria | 10913 |
| 126 | Ga0068856_100001905 | 3300005614 | Bacteria | 21761 |
| 127 | Ga0070702_100000495 | 3300005615 | Bacteria | 14121 |
| 128 | Ga0068852_100000390 | 3300005616 | Bacteria | 29418 |
| 129 | Ga0068852_100001248 | 3300005616 | Bacteria | 16950 |
| 130 | Ga0068852_100231138 | 3300005616 | Bacteria | 1763 |
| 131 | Ga0068859_100001380 | 3300005617 | Bacteria | 24699 |
| 132 | Ga0068859_100082345 | 3300005617 | Bacteria | 3261 |
| 133 | Ga0068864_100002657 | 3300005618 | Bacteria | 14761 |
| 134 | Ga0068864_100046279 | 3300005618 | Bacteria | 3733 |
| 135 | Ga0068864_100048750 | 3300005618 | Bacteria | 3642 |
| 136 | Ga0068864_100231120 | 3300005618 | Bacteria | 1710 |
| 137 | Ga0068861_100000336 | 3300005719 | Bacteria | 26625 |
| 138 | Ga0068851_10030261 | 3300005834 | Bacteria | 2685 |
| 139 | Ga0068870_10000037 | 3300005840 | Bacteria | 42069 |
| 140 | Ga0068863_100000906 | 3300005841 | Bacteria | 29855 |
| 141 | Ga0068863_100015226 | 3300005841 | Bacteria | 7390 |
| 142 | Ga0068863_100032281 | 3300005841 | Bacteria | 4991 |
| 143 | Ga0068863_100087192 | 3300005841 | Bacteria | 2957 |
| 144 | Ga0068863_100128399 | 3300005841 | Bacteria | 2419 |
| 145 | Ga0068858_100004037 | 3300005842 | Bacteria | 14483 |
| 146 | Ga0068858_100431875 | 3300005842 | Bacteria | 1267 |
| 147 | Ga0068860_100002585 | 3300005843 | Bacteria | 18944 |
| 148 | Ga0068862_100000763 | 3300005844 | Bacteria | 32104 |
| 149 | Ga0068862_100177701 | 3300005844 | Bacteria | 1909 |
| 150 | Ga0081455_10007625 | 3300005937 | Bacteria | 11370 |
| 151 | Ga0081455_10020340 | 3300005937 | Bacteria | 6254 |
| 152 | Ga0081455_10033900 | 3300005937 | Bacteria | 4581 |
| 153 | Ga0081455_10155530 | 3300005937 | Bacteria | 1758 |
| 154 | Ga0081540_1009813 | 3300005983 | Bacteria | 6550 |
| 155 | Ga0081539_10002158 | 3300005985 | Bacteria | 28978 |
| 156 | Ga0081539_10018612 | 3300005985 | Bacteria | 4809 |
| 157 | Ga0070717_10021945 | 3300006028 | Bacteria | 5037 |
| 158 | Ga0070717_10154454 | 3300006028 | Bacteria | 1987 |
| 159 | Ga0075365_10013968 | 3300006038 | Bacteria | 4820 |
| 160 | Ga0075365_10038850 | 3300006038 | Bacteria | 3096 |
| 161 | Ga0075364_10040151 | 3300006051 | Bacteria | 3035 |
| 162 | Ga0070716_100055731 | 3300006173 | Bacteria | 2264 |
| 163 | Ga0070716_100281939 | 3300006173 | Bacteria | 1147 |
| 164 | Ga0070712_100000600 | 3300006175 | Bacteria | 21109 |
| 165 | Ga0070712_100055492 | 3300006175 | Bacteria | 2775 |
| 166 | Ga0075362_10065204 | 3300006177 | Bacteria | 1653 |
| 167 | Ga0075367_10081339 | 3300006178 | Bacteria | 1960 |
| 168 | Ga0075369_10002981 | 3300006186 | Bacteria | 6118 |
| 169 | Ga0075369_10021143 | 3300006186 | Bacteria | 2670 |
| 170 | Ga0075366_10129436 | 3300006195 | Bacteria | 1523 |
| 171 | Ga0097621_100000416 | 3300006237 | Bacteria | 29698 |
| 172 | Ga0097621_100019765 | 3300006237 | Bacteria | 5178 |
| 173 | Ga0097621_100038659 | 3300006237 | Bacteria | 3829 |
| 174 | Ga0097621_100098318 | 3300006237 | Bacteria | 2458 |
| 175 | Ga0097621_100216780 | 3300006237 | Bacteria | 1666 |
| 176 | Ga0068871_100001611 | 3300006358 | Bacteria | 15188 |
| 177 | Ga0068871_100010906 | 3300006358 | Bacteria | 6653 |
| 178 | Ga0068871_100021473 | 3300006358 | Bacteria | 4963 |
| 179 | Ga0068871_100079951 | 3300006358 | Bacteria | 2706 |
| 180 | Ga0068871_100136999 | 3300006358 | Bacteria | 2079 |
| 181 | Ga0075428_100038062 | 3300006844 | Bacteria | 5294 |
| 182 | Ga0075428_100272494 | 3300006844 | Bacteria | 1821 |
| 183 | Ga0075430_100066961 | 3300006846 | Bacteria | 3016 |
| 184 | Ga0075431_100027286 | 3300006847 | Bacteria | 5858 |
| 185 | Ga0075431_100082437 | 3300006847 | Bacteria | 3319 |
| 186 | Ga0075433_10009247 | 3300006852 | Bacteria | 7875 |
| 187 | Ga0075434_100002322 | 3300006871 | Bacteria | 16662 |
| 188 | Ga0075434_100086191 | 3300006871 | Bacteria | 3140 |
| 189 | Ga0075429_100039664 | 3300006880 | Bacteria | 4098 |
| 190 | Ga0075429_100060554 | 3300006880 | Bacteria | 3297 |
| 191 | Ga0068865_100000340 | 3300006881 | Bacteria | 25937 |
| 192 | Ga0068865_100062902 | 3300006881 | Bacteria | 2607 |
| 193 | Ga0075436_100000458 | 3300006914 | Bacteria | 26344 |
| 194 | Ga0075436_100089876 | 3300006914 | Bacteria | 2134 |
| 195 | Ga0075436_100106895 | 3300006914 | Bacteria | 1952 |
| 196 | Ga0097620_100001380 | 3300006931 | Bacteria | 24699 |
| 197 | Ga0097620_100082342 | 3300006931 | Bacteria | 3261 |
| 198 | Ga0075435_100146526 | 3300007076 | Bacteria | 1983 |
| 199 | Ga0075435_100181228 | 3300007076 | Bacteria | 1780 |
| 200 | Ga0099794_10019068 | 3300007265 | Bacteria | 3085 |
| 201 | Ga0099795_10009473 | 3300007788 | Bacteria | 2828 |
| 202 | Ga0105251_10079935 | 3300009011 | Bacteria | 1512 |
| 203 | Ga0105250_10087595 | 3300009092 | Bacteria | 1264 |
| 204 | Ga0105240_10099178 | 3300009093 | Plasmid | 3546 |
| 205 | Ga0111539_10061808 | 3300009094 | Bacteria | 4436 |
| 206 | Ga0111539_10192195 | 3300009094 | Bacteria | 2381 |
| 207 | Ga0111539_10387064 | 3300009094 | Bacteria | 1628 |
| 208 | Ga0105245_10001087 | 3300009098 | Bacteria | 24648 |
| 209 | Ga0105245_10034958 | 3300009098 | Bacteria | 4459 |
| 210 | Ga0105245_10114248 | 3300009098 | Bacteria | 2514 |
| 211 | Ga0105247_10001882 | 3300009101 | Bacteria | 14697 |
| 212 | Ga0114129_10960345 | 3300009147 | Bacteria | 1079 |
| 213 | Ga0105243_10001705 | 3300009148 | Bacteria | 18936 |
| 214 | Ga0105241_10001794 | 3300009174 | Bacteria | 16301 |
| 215 | Ga0105242_10004457 | 3300009176 | Bacteria | 10884 |
| 216 | Ga0105242_10015886 | 3300009176 | Bacteria | 5849 |
| 217 | Ga0105248_10003875 | 3300009177 | Bacteria | 16536 |
| 218 | Ga0105248_10069178 | 3300009177 | Bacteria | 3964 |
| 219 | Ga0105248_10218597 | 3300009177 | Bacteria | 2145 |
| 220 | Ga0105248_10667111 | 3300009177 | Bacteria | 1173 |
| 221 | Ga0105237_10004455 | 3300009545 | Bacteria | 16193 |
| 222 | Ga0105249_10001030 | 3300009553 | Bacteria | 24648 |
| 223 | Ga0099796_10082585 | 3300010159 | Bacteria | 1181 |
| 224 | Ga0105239_10002253 | 3300010375 | Bacteria | 24648 |
| 225 | Ga0105246_10000057 | 3300011119 | Bacteria | 44951 |
| 226 | Ga0105246_10241640 | 3300011119 | Bacteria | 1428 |
| 227 | Ga0157373_10015723 | 3300013100 | Bacteria | 5526 |
| 228 | Ga0157371_10005939 | 3300013102 | Bacteria | 10190 |
| 229 | Ga0157369_10300663 | 3300013105 | Bacteria | 1669 |
| 230 | Ga0157374_10003737 | 3300013296 | Bacteria | 12796 |
| 231 | Ga0157374_10004173 | 3300013296 | Bacteria | 12133 |
| 232 | Ga0157374_10131227 | 3300013296 | Bacteria | 2425 |
| 233 | Ga0157378_10002661 | 3300013297 | Bacteria | 15895 |
| 234 | Ga0157378_10027450 | 3300013297 | Bacteria | 5024 |
| 235 | Ga0157378_10112465 | 3300013297 | Bacteria | 2498 |
| 236 | Ga0163162_10019074 | 3300013306 | Bacteria | 6727 |
| 237 | Ga0163162_10037442 | 3300013306 | Bacteria | 4841 |
| 238 | Ga0163162_10346107 | 3300013306 | Bacteria | 1619 |
| 239 | Ga0157372_10008410 | 3300013307 | Bacteria | 10962 |
| 240 | Ga0157375_10000482 | 3300013308 | Bacteria | 36307 |
| 241 | Ga0157375_10000983 | 3300013308 | Bacteria | 24671 |
| 242 | Ga0157375_10099140 | 3300013308 | Bacteria | 2992 |
| 243 | Ga0157375_10299922 | 3300013308 | Bacteria | 1770 |
| 244 | Ga0163163_10002371 | 3300014325 | Bacteria | 15940 |
| 245 | Ga0163163_10045074 | 3300014325 | Bacteria | 4328 |
| 246 | Ga0157380_10000226 | 3300014326 | Bacteria | 33709 |
| 247 | Ga0157380_10140021 | 3300014326 | Bacteria | 2077 |
| 248 | Ga0157377_10000681 | 3300014745 | Bacteria | 14056 |
| 249 | Ga0157379_10000779 | 3300014968 | Bacteria | 25895 |
| 250 | Ga0157379_10277446 | 3300014968 | Bacteria | 1525 |
| 251 | Ga0157376_10002318 | 3300014969 | Bacteria | 12860 |
| 252 | Ga0157376_10026218 | 3300014969 | Bacteria | 4603 |
| 253 | Ga0157376_10059083 | 3300014969 | Bacteria | 3215 |
| 254 | Ga0157376_10079413 | 3300014969 | Bacteria | 2813 |
| 255 | Ga0157376_10152733 | 3300014969 | Bacteria | 2084 |
| 256 | Ga0163161_10000209 | 3300017792 | Bacteria | 53534 |
| 257 | Ga0163161_10039200 | 3300017792 | Bacteria | 3400 |
| 258 | Ga0213872_10059877 | 3300021361 | Bacteria | 1723 |
| 259 | Ga0207666_1000011 | 3300025271 | Bacteria | 46553 |
| 260 | Ga0207673_1000047 | 3300025290 | Bacteria | 9811 |
| 261 | Ga0209025_1000026 | 3300025294 | Bacteria | 519850 |
| 262 | Ga0207697_10000392 | 3300025315 | Bacteria | 24624 |
| 263 | Ga0207697_10063378 | 3300025315 | Bacteria | 1541 |
| 264 | Ga0207656_10000974 | 3300025321 | Bacteria | 9361 |
| 265 | Ga0207696_1050358 | 3300025711 | Bacteria | 1192 |
| 266 | Ga0207653_10012297 | 3300025885 | Bacteria | 2672 |
| 267 | Ga0207682_10000004 | 3300025893 | Bacteria | 104760 |
| 268 | Ga0207692_10034581 | 3300025898 | Bacteria | 2448 |
| 269 | Ga0207642_10002298 | 3300025899 | Bacteria | 5954 |
| 270 | Ga0207710_10001729 | 3300025900 | Bacteria | 10564 |
| 271 | Ga0207688_10000152 | 3300025901 | Bacteria | 29719 |
| 272 | Ga0207688_10064037 | 3300025901 | Bacteria | 2075 |
| 273 | Ga0207680_10001184 | 3300025903 | Bacteria | 12321 |
| 274 | Ga0207647_10003824 | 3300025904 | Bacteria | 11263 |
| 275 | Ga0207685_10033134 | 3300025905 | Bacteria | 1865 |
| 276 | Ga0207645_10000281 | 3300025907 | Bacteria | 42381 |
| 277 | Ga0207645_10041219 | 3300025907 | Bacteria | 2956 |
| 278 | Ga0207645_10228611 | 3300025907 | Bacteria | 1228 |
| 279 | Ga0207643_10000012 | 3300025908 | Bacteria | 133318 |
| 280 | Ga0207643_10040971 | 3300025908 | Bacteria | 2609 |
| 281 | Ga0207643_10108440 | 3300025908 | Bacteria | 1634 |
| 282 | Ga0207684_10071925 | 3300025910 | Bacteria | 2938 |
| 283 | Ga0207684_10142437 | 3300025910 | Bacteria | 2061 |
| 284 | Ga0207654_10004367 | 3300025911 | Bacteria | 7126 |
| 285 | Ga0207707_10000551 | 3300025912 | Bacteria | 38020 |
| 286 | Ga0207707_10008705 | 3300025912 | Bacteria | 8806 |
| 287 | Ga0207695_10147984 | 3300025913 | Unclassified | 2290 |
| 288 | Ga0207671_10004326 | 3300025914 | Bacteria | 13645 |
| 289 | Ga0207693_10007457 | 3300025915 | Bacteria | 8997 |
| 290 | Ga0207693_10033249 | 3300025915 | Bacteria | 4070 |
| 291 | Ga0207693_10047090 | 3300025915 | Bacteria | 3389 |
| 292 | Ga0207660_10000008 | 3300025917 | Bacteria | 98521 |
| 293 | Ga0207662_10000123 | 3300025918 | Bacteria | 37327 |
| 294 | Ga0207657_10000358 | 3300025919 | Bacteria | 48238 |
| 295 | Ga0207649_10000545 | 3300025920 | Bacteria | 26032 |
| 296 | Ga0207649_10019079 | 3300025920 | Bacteria | 3915 |
| 297 | Ga0207652_10004952 | 3300025921 | Bacteria | 10786 |
| 298 | Ga0207652_10011583 | 3300025921 | Bacteria | 7113 |
| 299 | Ga0207646_10158904 | 3300025922 | Bacteria | 2039 |
| 300 | Ga0207681_10000286 | 3300025923 | Bacteria | 37397 |
| 301 | Ga0207650_10003465 | 3300025925 | Bacteria | 10841 |
| 302 | Ga0207650_10005306 | 3300025925 | Bacteria | 8794 |
| 303 | Ga0207650_10056652 | 3300025925 | Bacteria | 2913 |
| 304 | Ga0207650_10069450 | 3300025925 | Bacteria | 2647 |
| 305 | Ga0207650_10105363 | 3300025925 | Bacteria | 2177 |
| 306 | Ga0207659_10000023 | 3300025926 | Bacteria | 142947 |
| 307 | Ga0207659_10004672 | 3300025926 | Bacteria | 8295 |
| 308 | Ga0207659_10039818 | 3300025926 | Bacteria | 3282 |
| 309 | Ga0207659_10065015 | 3300025926 | Bacteria | 2642 |
| 310 | Ga0207659_10186376 | 3300025926 | Bacteria | 1648 |
| 311 | Ga0207687_10000149 | 3300025927 | Bacteria | 46713 |
| 312 | Ga0207687_10031311 | 3300025927 | Bacteria | 3594 |
| 313 | Ga0207687_10378180 | 3300025927 | Unclassified | 1160 |
| 314 | Ga0207700_10041333 | 3300025928 | Bacteria | 3372 |
| 315 | Ga0207700_10070497 | 3300025928 | Bacteria | 2687 |
| 316 | Ga0207700_10357550 | 3300025928 | Bacteria | 1273 |
| 317 | Ga0207644_10000418 | 3300025931 | Bacteria | 27576 |
| 318 | Ga0207644_10000724 | 3300025931 | Bacteria | 20908 |
| 319 | Ga0207644_10161055 | 3300025931 | Bacteria | 1744 |
| 320 | Ga0207690_10000203 | 3300025932 | Bacteria | 46451 |
| 321 | Ga0207706_10001339 | 3300025933 | Bacteria | 24624 |
| 322 | Ga0207686_10000995 | 3300025934 | Bacteria | 16847 |
| 323 | Ga0207686_10080516 | 3300025934 | Bacteria | 2123 |
| 324 | Ga0207709_10000607 | 3300025935 | Bacteria | 29669 |
| 325 | Ga0207670_10000125 | 3300025936 | Bacteria | 50796 |
| 326 | Ga0207669_10000122 | 3300025937 | Bacteria | 39107 |
| 327 | Ga0207669_10100030 | 3300025937 | Bacteria | 1914 |
| 328 | Ga0207669_10152080 | 3300025937 | Bacteria | 1622 |
| 329 | Ga0207704_10062124 | 3300025938 | Bacteria | 2321 |
| 330 | Ga0207704_10078187 | 3300025938 | Bacteria | 2127 |
| 331 | Ga0207704_10091789 | 3300025938 | Bacteria | 1997 |
| 332 | Ga0207665_10001932 | 3300025939 | Bacteria | 13940 |
| 333 | Ga0207665_10263746 | 3300025939 | Bacteria | 1277 |
| 334 | Ga0207691_10000319 | 3300025940 | Bacteria | 47784 |
| 335 | Ga0207691_10001334 | 3300025940 | Bacteria | 24624 |
| 336 | Ga0207691_10034426 | 3300025940 | Bacteria | 4709 |
| 337 | Ga0207691_10061514 | 3300025940 | Bacteria | 3410 |
| 338 | Ga0207691_10062575 | 3300025940 | Bacteria | 3376 |
| 339 | Ga0207711_10000590 | 3300025941 | Bacteria | 36793 |
| 340 | Ga0207711_10036587 | 3300025941 | Bacteria | 4165 |
| 341 | Ga0207711_10157597 | 3300025941 | Bacteria | 2053 |
| 342 | Ga0207689_10000008 | 3300025942 | Bacteria | 127942 |
| 343 | Ga0207689_10024775 | 3300025942 | Bacteria | 5031 |
| 344 | Ga0207689_10245064 | 3300025942 | Bacteria | 1482 |
| 345 | Ga0207661_10000104 | 3300025944 | Bacteria | 53977 |
| 346 | Ga0207661_10024178 | 3300025944 | Bacteria | 4600 |
| 347 | Ga0207679_10000053 | 3300025945 | Bacteria | 109038 |
| 348 | Ga0207679_10133286 | 3300025945 | Bacteria | 1996 |
| 349 | Ga0207667_10010178 | 3300025949 | Bacteria | 11014 |
| 350 | Ga0207651_10001418 | 3300025960 | Bacteria | 10896 |
| 351 | Ga0207651_10009405 | 3300025960 | Bacteria | 5348 |
| 352 | Ga0207712_10000156 | 3300025961 | Bacteria | 70300 |
| 353 | Ga0207668_10000251 | 3300025972 | Bacteria | 35861 |
| 354 | Ga0207668_10030232 | 3300025972 | Bacteria | 3558 |
| 355 | Ga0207668_10083754 | 3300025972 | Bacteria | 2322 |
| 356 | Ga0207668_10159317 | 3300025972 | Bacteria | 1757 |
| 357 | Ga0207640_10000157 | 3300025981 | Bacteria | 49126 |
| 358 | Ga0207640_10002548 | 3300025981 | Bacteria | 9773 |
| 359 | Ga0207658_10001085 | 3300025986 | Bacteria | 22019 |
| 360 | Ga0207658_10127209 | 3300025986 | Bacteria | 2041 |
| 361 | Ga0207677_10000609 | 3300026023 | Bacteria | 22003 |
| 362 | Ga0207703_10007370 | 3300026035 | Bacteria | 8740 |
| 363 | Ga0207639_10001949 | 3300026041 | Bacteria | 13856 |
| 364 | Ga0207678_10001114 | 3300026067 | Bacteria | 24624 |
| 365 | Ga0207678_10041948 | 3300026067 | Bacteria | 3966 |
| 366 | Ga0207678_10259902 | 3300026067 | Bacteria | 1488 |
| 367 | Ga0207708_10000734 | 3300026075 | Bacteria | 24624 |
| 368 | Ga0207708_10005760 | 3300026075 | Bacteria | 9156 |
| 369 | Ga0207708_10007249 | 3300026075 | Bacteria | 8199 |
| 370 | Ga0207702_10027811 | 3300026078 | Bacteria | 4698 |
| 371 | Ga0207641_10000794 | 3300026088 | Bacteria | 33696 |
| 372 | Ga0207641_10040421 | 3300026088 | Bacteria | 3905 |
| 373 | Ga0207648_10001602 | 3300026089 | Bacteria | 24780 |
| 374 | Ga0207648_10036740 | 3300026089 | Bacteria | 4316 |
| 375 | Ga0207648_10342430 | 3300026089 | Bacteria | 1347 |
| 376 | Ga0207676_10000934 | 3300026095 | Bacteria | 22596 |
| 377 | Ga0207676_10034633 | 3300026095 | Bacteria | 3824 |
| 378 | Ga0207676_10043250 | 3300026095 | Bacteria | 3467 |
| 379 | Ga0207674_10009261 | 3300026116 | Bacteria | 11286 |
| 380 | Ga0207675_100000604 | 3300026118 | Bacteria | 35079 |
| 381 | Ga0207675_100024855 | 3300026118 | Bacteria | 5574 |
| 382 | Ga0207675_100098647 | 3300026118 | Bacteria | 2751 |
| 383 | Ga0207675_100416043 | 3300026118 | Bacteria | 1327 |
| 384 | Ga0207683_10000006 | 3300026121 | Bacteria | 181260 |
| 385 | Ga0207683_10002093 | 3300026121 | Bacteria | 17577 |
| 386 | Ga0207683_10043032 | 3300026121 | Bacteria | 3944 |
| 387 | Ga0207698_10000378 | 3300026142 | Bacteria | 25887 |
| 388 | Ga0207698_10055322 | 3300026142 | Bacteria | 3057 |
| 389 | Ga0207698_10223161 | 3300026142 | Bacteria | 1705 |
| 390 | Ga0209998_10000622 | 3300027717 | Bacteria | 9498 |
| 391 | Ga0209813_10042793 | 3300027866 | Bacteria | 1385 |
| 392 | Ga0207428_10000112 | 3300027907 | Bacteria | 110733 |
| 393 | Ga0207428_10186529 | 3300027907 | Bacteria | 1565 |
| 394 | Ga0268266_10008074 | 3300028379 | Bacteria | 9402 |
| 395 | Ga0268266_10353002 | 3300028379 | Bacteria | 1382 |
| 396 | Ga0268265_10002652 | 3300028380 | Bacteria | 13283 |
| 397 | Ga0268264_10002426 | 3300028381 | Bacteria | 16403 |
| 398 | Ga0265320_10047327 | 3300031240 | Unclassified | 2103 |
| 399 | Ga0265320_10060247 | 3300031240 | Bacteria | 1813 |
| 400 | Ga0265325_10057347 | 3300031241 | Bacteria | 1986 |
| 401 | Ga0265325_10089275 | 3300031241 | Bacteria | 1522 |
| 402 | Ga0265329_10039525 | 3300031242 | Bacteria | 1515 |
| 403 | Ga0265340_10020800 | 3300031247 | Bacteria | 3367 |
| 404 | Ga0265316_10271693 | 3300031344 | Bacteria | 1240 |
| 405 | Ga0265342_10100839 | 3300031712 | Bacteria | 1644 |
| 406 | Ga0307412_10448488 | 3300031911 | Bacteria | 1062 |
| 407 | Ga0373938_0001311 | 3300034957 | Bacteria | 3996 |
| 408 | Ga0373938_0036576 | 3300034957 | Bacteria | 1075 |
| 409 | Ga0373926_0074336 | 3300035083 | Bacteria | 1251 |
| 410 | Ga0373940_0020414 | 3300035088 | Bacteria | 1683 |
| 411 | Ga0373944_0079045 | 3300035089 | Bacteria | 1083 |
| 412 | Ga0373951_0050269 | 3300035091 | Bacteria | 1024 |
| 413 | Ga0373952_0002039 | 3300035092 | Bacteria | 3640 |
| 414 | Ga0373952_0007354 | 3300035092 | Bacteria | 2063 |
| 415 | Ga0373923_0093067 | 3300035111 | Bacteria | 1321 |
| 416 | Ga0373932_0002972 | 3300035112 | Bacteria | 4169 |
| 417 | Ga0373936_0008843 | 3300035113 | Bacteria | 3795 |
| 418 | Ga0373936_0139712 | 3300035113 | Bacteria | 1045 |
| 419 | Ga0373939_0002339 | 3300035114 | Bacteria | 4484 |
| 420 | Ga0373941_0002973 | 3300035115 | Bacteria | 3792 |
| 421 | Ga0373945_0022048 | 3300035116 | Bacteria | 2191 |
| 422 | Ga0373945_0029923 | 3300035116 | Bacteria | 1916 |
| 423 | Ga0373960_0003207 | 3300035121 | Bacteria | 3700 |
| 424 | Ga0373960_0008610 | 3300035121 | Bacteria | 2449 |
| 425 | Ga0373943_0016423 | 3300035170 | Bacteria | 3375 |
| 426 | Ga0373946_0008578 | 3300035171 | Bacteria | 3751 |
| 427 | Ga0373946_0036312 | 3300035171 | Bacteria | 1997 |
| 428 | Ga0373961_0003015 | 3300035241 | Bacteria | 4249 |
| 429 | Ga0373931_0000687 | 3300035691 | Bacteria | 14022 |
| 430 | Ga0373931_0154449 | 3300035691 | Bacteria | 1340 |
| 431 | Ga0373935_0224245 | 3300035692 | Bacteria | 1306 |
| 432 | Ga0373927_0019879 | 3300035695 | Bacteria | 4403 |
| 433 | Ga0373937_0339714 | 3300036401 | Bacteria | 1422 |
| 434 | Ga0373925_0117115 | 3300037068 | Bacteria | 2064 |
| 435 | Ga0395905_0234489 | 3300037471 | Bacteria | 1715 |
| 436 | Ga0451807_0915961 | 3300041486 | Bacteria | 3266 |
| 437 | Ga0439443_001336 | 3300042003 | Bacteria | 2673 |
| 438 | Ga0439449_0001455 | 3300042007 | Bacteria | 9260 |
| 439 | Ga0439444_0000062 | 3300042437 | Bacteria | 7951 |
| 440 | Ga0439459_0030550 | 3300042438 | Bacteria | 1094 |
| 441 | Ga0466963_0114475 | 3300044694 | Bacteria | 1853 |
| 442 | Ga0466957_0047924 | 3300044842 | Bacteria | 2597 |
| 443 | Ga0451576_0075590 | 3300045051 | Bacteria | 3505 |
| 444 | Ga0451576_0305773 | 3300045051 | Bacteria | 1663 |
| 445 | Ga0495603_0006198 | 3300046455 | Bacteria | 7152 |
| 446 | Ga0495629_0076154 | 3300046459 | Bacteria | 2343 |
| 447 | Ga0495629_0093952 | 3300046459 | Bacteria | 2093 |
| 448 | Ga0495641_0094294 | 3300046461 | Unclassified | 1337 |
| 449 | Ga0495580_0048052 | 3300046472 | Bacteria | 3024 |
| 450 | Ga0495605_0087756 | 3300046474 | Bacteria | 1446 |
| 451 | Ga0495662_0004855 | 3300046476 | Bacteria | 6735 |
| 452 | Ga0495662_0022103 | 3300046476 | Bacteria | 3074 |
| 453 | Ga0495584_0099783 | 3300046491 | Bacteria | 1467 |
| 454 | Ga0495584_0109536 | 3300046491 | Bacteria | 1397 |
| 455 | Ga0495585_0011090 | 3300046492 | Bacteria | 5348 |
| 456 | Ga0495585_0011501 | 3300046492 | Bacteria | 5237 |
| 457 | Ga0495594_0034622 | 3300046499 | Bacteria | 2748 |
| 458 | Ga0495594_0060654 | 3300046499 | Bacteria | 2092 |
| 459 | Ga0495596_0032329 | 3300046500 | Bacteria | 2087 |
| 460 | Ga0495618_0105173 | 3300046514 | Bacteria | 1807 |
| 461 | Ga0495630_0283672 | 3300046517 | Bacteria | 1265 |
| 462 | Ga0495631_0045847 | 3300046518 | Bacteria | 1924 |
| 463 | Ga0495637_0032095 | 3300046520 | Bacteria | 2316 |
| 464 | Ga0495644_0041417 | 3300046523 | Bacteria | 1734 |
| 465 | Ga0495666_0042521 | 3300046526 | Bacteria | 2197 |
| 466 | Ga0495642_0038703 | 3300046528 | Bacteria | 1933 |
| 467 | Ga0495642_0046939 | 3300046528 | Bacteria | 1767 |
| 468 | Ga0495665_0117482 | 3300046531 | Bacteria | 1393 |
| 469 | Ga0495640_0142343 | 3300046533 | Bacteria | 1545 |
| 470 | Ga0495586_0114431 | 3300046535 | Bacteria | 1503 |
| 471 | Ga0495598_0001385 | 3300046537 | Bacteria | 4779 |
| 472 | Ga0495598_0005558 | 3300046537 | Bacteria | 2803 |
| 473 | Ga0495609_0117289 | 3300046538 | Bacteria | 1146 |
| 474 | Ga0495621_0016539 | 3300046539 | Bacteria | 2370 |
| 475 | Ga0495621_0119999 | 3300046539 | Bacteria | 1015 |
| 476 | Ga0495622_0126358 | 3300046557 | Bacteria | 1166 |
| 477 | Ga0495656_0035242 | 3300046615 | Bacteria | 2055 |
| 478 | Ga0495659_0002522 | 3300046664 | Bacteria | 5913 |
| 479 | Ga0495659_0048688 | 3300046664 | Bacteria | 1537 |
| 480 | Ga0495661_0068856 | 3300046665 | Bacteria | 2075 |
| 481 | Ga0495588_0015185 | 3300046674 | Bacteria | 3700 |
| 482 | Ga0495647_0083520 | 3300046681 | Bacteria | 1298 |
| 483 | Ga0495658_0038858 | 3300046683 | Bacteria | 2637 |
| 484 | Ga0495658_0303825 | 3300046683 | Bacteria | 1009 |
| 485 | Ga0495669_0057031 | 3300046684 | Bacteria | 1762 |
| 486 | Ga0495669_0079165 | 3300046684 | Bacteria | 1506 |
| 487 | Ga0495613_0060112 | 3300046689 | Bacteria | 2784 |
| 488 | Ga0495613_0071365 | 3300046689 | Bacteria | 2532 |
| 489 | Ga0495613_0074491 | 3300046689 | Bacteria | 2472 |
| 490 | Ga0495624_0081146 | 3300046690 | Bacteria | 2009 |
| 491 | Ga0495670_0021075 | 3300046691 | Bacteria | 3214 |
| 492 | Ga0495671_0052045 | 3300046692 | Bacteria | 2035 |
| 493 | Ga0495589_0027290 | 3300046794 | Bacteria | 2887 |
| 494 | Ga0495581_0070007 | 3300047315 | Bacteria | 2029 |
| 495 | Ga0495581_0142952 | 3300047315 | Bacteria | 1396 |
| 496 | Ga0495636_0095613 | 3300047318 | Bacteria | 1294 |
| 497 | Ga0495674_0050581 | 3300047319 | Bacteria | 3667 |
| 498 | Ga0495676_0295553 | 3300047321 | Bacteria | 1093 |
| 499 | Ga0495677_0017535 | 3300047445 | Bacteria | 2596 |
| 500 | Ga0495679_019841 | 3300047446 | Bacteria | 2353 |
| 501 | Ga0495684_0220573 | 3300047471 | Bacteria | 1390 |
| 502 | Ga0495686_0068703 | 3300047472 | Bacteria | 2186 |
| 503 | Ga0496100_0001037 | 3300048903 | Bacteria | 13421 |
| 504 | Ga0496101_0002660 | 3300048904 | Bacteria | 10971 |
| 505 | Ga0496101_0328069 | 3300048904 | Bacteria | 1201 |
| 506 | Ga0496102_0001120 | 3300048905 | Bacteria | 24582 |
| 507 | Ga0496103_0000611 | 3300048906 | Bacteria | 27883 |
| 508 | Ga0496104_0000383 | 3300048907 | Bacteria | 38697 |
| 509 | Ga0496104_0000434 | 3300048907 | Bacteria | 36228 |
| 510 | Ga0496104_0002239 | 3300048907 | Bacteria | 16693 |
| 511 | Ga0496104_0003487 | 3300048907 | Bacteria | 13567 |
| 512 | Ga0496104_0050654 | 3300048907 | Bacteria | 3918 |
| 513 | Ga0496105_0011456 | 3300048908 | Bacteria | 7006 |
| 514 | Ga0496105_0082458 | 3300048908 | Bacteria | 2656 |
| 515 | Ga0496105_0090171 | 3300048908 | Bacteria | 2532 |
| 516 | Ga0496105_0107377 | 3300048908 | Bacteria | 2304 |
| 517 | Ga0496106_0000541 | 3300048909 | Bacteria | 26824 |
| 518 | Ga0496106_0040908 | 3300048909 | Bacteria | 3473 |
| 519 | Ga0496106_0093286 | 3300048909 | Bacteria | 2326 |
| 520 | Ga0496106_0125638 | 3300048909 | Bacteria | 2008 |
| 521 | Ga0496107_0000493 | 3300048910 | Bacteria | 21794 |
| 522 | Ga0496107_0056207 | 3300048910 | Bacteria | 2843 |
| 523 | Ga0496108_0093195 | 3300048911 | Bacteria | 2562 |
| 524 | Ga0496108_0135015 | 3300048911 | Bacteria | 2122 |
| 525 | Ga0496108_0165285 | 3300048911 | Bacteria | 1913 |
| 526 | Ga0496108_0203635 | 3300048911 | Bacteria | 1717 |
| 527 | Ga0496109_0002920 | 3300048912 | Bacteria | 14286 |
| 528 | Ga0496109_0026898 | 3300048912 | Bacteria | 5131 |
| 529 | Ga0496109_0077652 | 3300048912 | Bacteria | 3056 |
| 530 | Ga0496109_0174833 | 3300048912 | Bacteria | 2015 |
| 531 | Ga0496110_0001712 | 3300048913 | Bacteria | 16146 |
| 532 | Ga0496110_0097606 | 3300048913 | Bacteria | 2633 |
| 533 | Ga0496110_0208981 | 3300048913 | Bacteria | 1774 |
| 534 | Ga0496110_0442417 | 3300048913 | Bacteria | 1185 |
| 535 | Ga0496111_0131812 | 3300048914 | Bacteria | 1850 |
| 536 | Ga0496112_0051062 | 3300048915 | Bacteria | 4056 |
| 537 | Ga0496113_0036261 | 3300048916 | Bacteria | 3612 |
| 538 | Ga0496113_0068971 | 3300048916 | Bacteria | 2684 |
| 539 | Ga0496113_0219126 | 3300048916 | Bacteria | 1516 |
| 540 | Ga0496114_0003043 | 3300048917 | Bacteria | 12845 |
| 541 | Ga0496114_0030598 | 3300048917 | Bacteria | 4430 |
| 542 | Ga0496114_0143795 | 3300048917 | Bacteria | 2067 |
| 543 | Ga0496115_0003177 | 3300048918 | Bacteria | 11804 |
| 544 | Ga0496115_0025764 | 3300048918 | Bacteria | 4583 |
| 545 | Ga0496115_0048785 | 3300048918 | Bacteria | 3387 |
| 546 | Ga0501034_0605646 | 3300049571 | Bacteria | 1001 |
| 547 | Ga0501040_0143140 | 3300049576 | Bacteria | 1685 |
| 548 | Ga0501043_0000053 | 3300049579 | Bacteria | 106085 |
| 549 | Ga0501046_0206920 | 3300049580 | Bacteria | 1458 |
| 550 | Ga0501071_0107856 | 3300049587 | Bacteria | 2057 |
| 551 | Ga0501035_0064120 | 3300049822 | Bacteria | 3266 |
| 552 | Ga0501044_0036008 | 3300049823 | Bacteria | 5179 |
| 553 | nmdc:mga03683_27101_c1 | 3300050489 | Bacteria | 2266 |
| 554 | nmdc:mga00v17_79253_c1 | 3300050491 | Bacteria | 2048 |
| 555 | nmdc:mga0yw44_132323_c1 | 3300050492 | Bacteria | 1616 |
| 556 | nmdc:mga0yw44_3893_c2 | 3300050492 | Bacteria | 4777 |
| 557 | nmdc:mga0k408_203369_c1 | 3300050493 | Bacteria | 1182 |
| 558 | nmdc:mga0k408_67553_c1 | 3300050493 | Bacteria | 2083 |
| 559 | nmdc:mga06z11_25983_c1 | 3300050494 | Bacteria | 2782 |
| 560 | nmdc:mga04h51_49486_c1 | 3300050495 | Bacteria | 1404 |
| 561 | nmdc:mga05p37_14797_c1 | 3300050507 | Bacteria | 9370 |
| 562 | nmdc:mga05p37_297552_c1 | 3300050507 | Bacteria | 1919 |
| 563 | nmdc:mga09592_277806_c1 | 3300050508 | Bacteria | 1452 |
| 564 | nmdc:mga09592_44526_c1 | 3300050508 | Bacteria | 3737 |
| 565 | nmdc:mga09592_70118_c1 | 3300050508 | Bacteria | 2974 |
| 566 | nmdc:mga0qj67_114385_c1 | 3300050509 | Bacteria | 2179 |
| 567 | nmdc:mga0qj67_30949_c1 | 3300050509 | Bacteria | 4167 |
| 568 | nmdc:mga06r32_139195_c1 | 3300050510 | Bacteria | 2403 |
| 569 | nmdc:mga06r32_44581_c1 | 3300050510 | Bacteria | 4224 |
| 570 | nmdc:mga08y16_452926_c1 | 3300050511 | Bacteria | 1308 |
| 571 | nmdc:mga08y16_802_c1 | 3300050511 | Bacteria | 30082 |
| 572 | nmdc:mga0n895_291_c1 | 3300050512 | Bacteria | 33000 |
| 573 | nmdc:mga0rr50_157380_c1 | 3300050513 | Bacteria | 1841 |
| 574 | nmdc:mga08x19_4594_c1 | 3300050514 | Bacteria | 8198 |
| 575 | nmdc:mga08x19_97857_c1 | 3300050514 | Bacteria | 1943 |
| 576 | nmdc:mga0a205_1940_c1 | 3300050515 | Bacteria | 17960 |
| 577 | nmdc:mga0sz30_44033_c1 | 3300050516 | Bacteria | 1879 |
| 578 | Ga0495601_0036988 | 3300053077 | Bacteria | 3051 |
| 579 | Ga0495619_0123904 | 3300053085 | Bacteria | 1773 |
| 580 | Ga0500616_0002206 | 3300053153 | Bacteria | 16693 |
| 581 | Ga0500619_000039 | 3300053154 | Bacteria | 40533 |
| 582 | Ga0530510_0169060 | 3300061734 | Bacteria | 1619 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300046689 | Ga0495613_0060112 | Ga0495613_0060112_1484_2488 | 272 |
| 2 | 3300046665 | Ga0495661_0068856 | Ga0495661_0068856_1053_1880 | 275 |
| 3 | 3300046683 | Ga0495658_0303825 | Ga0495658_0303825_149_976 | 275 |
| 4 | 3300047321 | Ga0495676_0295553 | Ga0495676_0295553_236_1063 | 275 |
| 5 | 3300031911 | Ga0307412_10448488 | Ga0307412_104484881 | 276 |
| 6 | 3300042438 | Ga0439459_0030550 | Ga0439459_0030550_13_975 | 282 |
| 7 | 3300049587 | Ga0501071_0107856 | Ga0501071_0107856_343_1209 | 288 |
| 8 | 3300050493 | nmdc:mga0k408_67553_c1 | nmdc:mga0k408_67553_c1_29_898 | 288 |
| 9 | 3300035091 | Ga0373951_0050269 | Ga0373951_0050269_22_900 | 290 |
| 10 | iso_pu_bacteria | 2855730933 | 2855732471 | 294 |
| 11 | iso_pu_bacteria | 2855767633 | 2855769179 | 294 |
| 12 | 3300005937 | Ga0081455_10155530 | Ga0081455_101555302 | 295 |
| 13 | 3300053154 | Ga0500619_000039 | Ga0500619_000039_5097_6071 | 299 |
| 14 | 3300053085 | Ga0495619_0123904 | Ga0495619_0123904_424_1329 | 301 |
| 15 | 3300006844 | Ga0075428_100038062 | Ga0075428_1000380626 | 302 |
| 16 | 3300006880 | Ga0075429_100060554 | Ga0075429_1000605542 | 302 |
| 17 | 3300042003 | Ga0439443_001336 | Ga0439443_001336_84_1040 | 302 |
| 18 | 3300042437 | Ga0439444_0000062 | Ga0439444_0000062_91_1047 | 302 |
| 19 | 3300050508 | nmdc:mga09592_44526_c1 | nmdc:mga09592_44526_c1_693_1649 | 302 |
| 20 | 3300048913 | Ga0496110_0097606 | Ga0496110_0097606_947_1918 | 305 |
| 21 | 3300048911 | Ga0496108_0165285 | Ga0496108_0165285_11_943 | 308 |
| 22 | iso_pu_bacteria | 2881412998 | 2881414940 | 308 |
| 23 | iso_pu_bacteria | 2881412998 | 2881414941 | 308 |
| 24 | 3300046664 | Ga0495659_0002522 | Ga0495659_0002522_4918_5853 | 309 |
| 25 | 3300047472 | Ga0495686_0068703 | Ga0495686_0068703_1131_2123 | 310 |
| 26 | 3300049571 | Ga0501034_0605646 | Ga0501034_0605646_42_974 | 310 |
| 27 | 3300050513 | nmdc:mga0rr50_157380_c1 | nmdc:mga0rr50_157380_c1_297_1241 | 310 |
| 28 | iso_pu_bacteria | 2808606395 | 2809033025 | 311 |
| 29 | 3300005467 | Ga0070706_100047939 | Ga0070706_1000479392 | 312 |
| 30 | 3300005518 | Ga0070699_100412707 | Ga0070699_1004127071 | 312 |
| 31 | 3300005536 | Ga0070697_100022533 | Ga0070697_1000225332 | 312 |
| 32 | 3300005545 | Ga0070695_100004325 | Ga0070695_1000043258 | 312 |
| 33 | 3300005546 | Ga0070696_100009047 | Ga0070696_1000090476 | 312 |
| 34 | 3300005549 | Ga0070704_100131087 | Ga0070704_1001310872 | 312 |
| 35 | 3300006914 | Ga0075436_100106895 | Ga0075436_1001068952 | 312 |
| 36 | 3300009094 | Ga0111539_10061808 | Ga0111539_100618084 | 312 |
| 37 | 3300044694 | Ga0466963_0114475 | Ga0466963_0114475_827_1783 | 312 |
| 38 | 3300044842 | Ga0466957_0047924 | Ga0466957_0047924_617_1573 | 312 |
| 39 | 3300005434 | Ga0070709_10265370 | Ga0070709_102653701 | 313 |
| 40 | 3300005435 | Ga0070714_100433803 | Ga0070714_1004338031 | 313 |
| 41 | 3300005436 | Ga0070713_100230610 | Ga0070713_1002306102 | 313 |
| 42 | 3300005458 | Ga0070681_10001610 | Ga0070681_1000161022 | 313 |
| 43 | 3300005536 | Ga0070697_100290534 | Ga0070697_1002905342 | 313 |
| 44 | 3300006028 | Ga0070717_10154454 | Ga0070717_101544542 | 313 |
| 45 | 3300009147 | Ga0114129_10960345 | Ga0114129_109603452 | 313 |
| 46 | 3300050514 | nmdc:mga08x19_4594_c1 | nmdc:mga08x19_4594_c1_2537_3484 | 313 |
| 47 | 3300006237 | Ga0097621_100216780 | Ga0097621_1002167802 | 314 |
| 48 | 3300006358 | Ga0068871_100010906 | Ga0068871_1000109062 | 314 |
| 49 | 3300006881 | Ga0068865_100062902 | Ga0068865_1000629023 | 314 |
| 50 | 3300009098 | Ga0105245_10034958 | Ga0105245_100349585 | 314 |
| 51 | 3300009176 | Ga0105242_10015886 | Ga0105242_100158867 | 314 |
| 52 | 3300013308 | Ga0157375_10099140 | Ga0157375_100991404 | 314 |
| 53 | 3300014969 | Ga0157376_10079413 | Ga0157376_100794133 | 314 |
| 54 | 3300025927 | Ga0207687_10031311 | Ga0207687_100313114 | 314 |
| 55 | 3300025934 | Ga0207686_10080516 | Ga0207686_100805162 | 314 |
| 56 | 3300025938 | Ga0207704_10078187 | Ga0207704_100781872 | 314 |
| 57 | 3300026067 | Ga0207678_10259902 | Ga0207678_102599022 | 314 |
| 58 | 3300005435 | Ga0070714_100037938 | Ga0070714_1000379382 | 315 |
| 59 | 3300005440 | Ga0070705_100013435 | Ga0070705_1000134352 | 315 |
| 60 | 3300005444 | Ga0070694_100009893 | Ga0070694_1000098932 | 315 |
| 61 | 3300005444 | Ga0070694_100028037 | Ga0070694_1000280373 | 315 |
| 62 | 3300005458 | Ga0070681_10001245 | Ga0070681_1000124535 | 315 |
| 63 | 3300005518 | Ga0070699_100024861 | Ga0070699_1000248612 | 315 |
| 64 | 3300005518 | Ga0070699_100260207 | Ga0070699_1002602071 | 315 |
| 65 | 3300005530 | Ga0070679_100006873 | Ga0070679_1000068732 | 315 |
| 66 | 3300005536 | Ga0070697_100023172 | Ga0070697_1000231722 | 315 |
| 67 | 3300005536 | Ga0070697_100062012 | Ga0070697_1000620123 | 315 |
| 68 | 3300005536 | Ga0070697_100393346 | Ga0070697_1003933461 | 315 |
| 69 | 3300005545 | Ga0070695_100004241 | Ga0070695_1000042413 | 315 |
| 70 | 3300005546 | Ga0070696_100024753 | Ga0070696_1000247532 | 315 |
| 71 | 3300005985 | Ga0081539_10002158 | Ga0081539_1000215822 | 315 |
| 72 | 3300006173 | Ga0070716_100281939 | Ga0070716_1002819392 | 315 |
| 73 | 3300006914 | Ga0075436_100000458 | Ga0075436_1000004587 | 315 |
| 74 | 3300006914 | Ga0075436_100089876 | Ga0075436_1000898761 | 315 |
| 75 | 3300025912 | Ga0207707_10008705 | Ga0207707_100087052 | 315 |
| 76 | 3300025921 | Ga0207652_10004952 | Ga0207652_100049522 | 315 |
| 77 | 3300025939 | Ga0207665_10263746 | Ga0207665_102637462 | 315 |
| 78 | 3300034957 | Ga0373938_0036576 | Ga0373938_0036576_39_995 | 315 |
| 79 | 3300035092 | Ga0373952_0007354 | Ga0373952_0007354_660_1616 | 315 |
| 80 | 3300035121 | Ga0373960_0003207 | Ga0373960_0003207_1399_2355 | 315 |
| 81 | 3300035691 | Ga0373931_0154449 | Ga0373931_0154449_17_973 | 315 |
| 82 | 3300045051 | Ga0451576_0075590 | Ga0451576_0075590_1739_2695 | 315 |
| 83 | 3300045051 | Ga0451576_0305773 | Ga0451576_0305773_39_995 | 315 |
| 84 | 3300046476 | Ga0495662_0004855 | Ga0495662_0004855_5757_6713 | 315 |
| 85 | 3300046533 | Ga0495640_0142343 | Ga0495640_0142343_23_979 | 315 |
| 86 | 3300046535 | Ga0495586_0114431 | Ga0495586_0114431_532_1488 | 315 |
| 87 | 3300046684 | Ga0495669_0079165 | Ga0495669_0079165_17_973 | 315 |
| 88 | 3300046690 | Ga0495624_0081146 | Ga0495624_0081146_903_1859 | 315 |
| 89 | 3300047315 | Ga0495581_0142952 | Ga0495581_0142952_285_1241 | 315 |
| 90 | 3300047319 | Ga0495674_0050581 | Ga0495674_0050581_22_978 | 315 |
| 91 | 3300050514 | nmdc:mga08x19_97857_c1 | nmdc:mga08x19_97857_c1_539_1495 | 315 |
| 92 | 3300003187 | JGI25151J46595_10000159 | JGI25151J46595_1000015921 | 316 |
| 93 | 3300005844 | Ga0068862_100177701 | Ga0068862_1001777012 | 316 |
| 94 | 3300025294 | Ga0209025_1000026 | Ga0209025_1000026416 | 316 |
| 95 | 3300049579 | Ga0501043_0000053 | Ga0501043_0000053_93388_94365 | 316 |
| 96 | 3300005331 | Ga0070670_100429425 | Ga0070670_1004294252 | 317 |
| 97 | 3300005335 | Ga0070666_10132143 | Ga0070666_101321432 | 317 |
| 98 | 3300005347 | Ga0070668_100042787 | Ga0070668_1000427873 | 317 |
| 99 | 3300005354 | Ga0070675_100018334 | Ga0070675_1000183342 | 317 |
| 100 | 3300005367 | Ga0070667_100174158 | Ga0070667_1001741581 | 317 |
| 101 | 3300005617 | Ga0068859_100082345 | Ga0068859_1000823452 | 317 |
| 102 | 3300006931 | Ga0097620_100082342 | Ga0097620_1000823423 | 317 |
| 103 | 3300025315 | Ga0207697_10063378 | Ga0207697_100633782 | 317 |
| 104 | 3300025907 | Ga0207645_10228611 | Ga0207645_102286112 | 317 |
| 105 | 3300025925 | Ga0207650_10105363 | Ga0207650_101053632 | 317 |
| 106 | 3300025926 | Ga0207659_10039818 | Ga0207659_100398183 | 317 |
| 107 | 3300025940 | Ga0207691_10034426 | Ga0207691_100344262 | 317 |
| 108 | 3300025940 | Ga0207691_10061514 | Ga0207691_100615144 | 317 |
| 109 | 3300025972 | Ga0207668_10030232 | Ga0207668_100302323 | 317 |
| 110 | 3300025986 | Ga0207658_10127209 | Ga0207658_101272091 | 317 |
| 111 | 3300026067 | Ga0207678_10041948 | Ga0207678_100419486 | 317 |
| 112 | 3300026118 | Ga0207675_100416043 | Ga0207675_1004160432 | 317 |
| 113 | 3300005329 | Ga0070683_100003185 | Ga0070683_1000031851 | 318 |
| 114 | 3300005331 | Ga0070670_100010951 | Ga0070670_1000109518 | 318 |
| 115 | 3300005333 | Ga0070677_10003290 | Ga0070677_100032906 | 318 |
| 116 | 3300005333 | Ga0070677_10023785 | Ga0070677_100237852 | 318 |
| 117 | 3300005335 | Ga0070666_10113655 | Ga0070666_101136552 | 318 |
| 118 | 3300005338 | Ga0068868_100000731 | Ga0068868_10000073112 | 318 |
| 119 | 3300005340 | Ga0070689_100150873 | Ga0070689_1001508732 | 318 |
| 120 | 3300005344 | Ga0070661_100006036 | Ga0070661_10000603610 | 318 |
| 121 | 3300005354 | Ga0070675_100056208 | Ga0070675_1000562082 | 318 |
| 122 | 3300005354 | Ga0070675_100244560 | Ga0070675_1002445601 | 318 |
| 123 | 3300005355 | Ga0070671_100006361 | Ga0070671_1000063612 | 318 |
| 124 | 3300005355 | Ga0070671_100234145 | Ga0070671_1002341452 | 318 |
| 125 | 3300005356 | Ga0070674_100210291 | Ga0070674_1002102911 | 318 |
| 126 | 3300005364 | Ga0070673_100044911 | Ga0070673_1000449112 | 318 |
| 127 | 3300005364 | Ga0070673_100194330 | Ga0070673_1001943302 | 318 |
| 128 | 3300005365 | Ga0070688_100264488 | Ga0070688_1002644882 | 318 |
| 129 | 3300005367 | Ga0070667_100078873 | Ga0070667_1000788732 | 318 |
| 130 | 3300005367 | Ga0070667_100116992 | Ga0070667_1001169921 | 318 |
| 131 | 3300005441 | Ga0070700_100030685 | Ga0070700_1000306852 | 318 |
| 132 | 3300005456 | Ga0070678_100013375 | Ga0070678_1000133752 | 318 |
| 133 | 3300005459 | Ga0068867_100090845 | Ga0068867_1000908452 | 318 |
| 134 | 3300005535 | Ga0070684_100036551 | Ga0070684_1000365512 | 318 |
| 135 | 3300005543 | Ga0070672_100000155 | Ga0070672_1000001552 | 318 |
| 136 | 3300005548 | Ga0070665_100406213 | Ga0070665_1004062131 | 318 |
| 137 | 3300005564 | Ga0070664_100000147 | Ga0070664_10000014755 | 318 |
| 138 | 3300005578 | Ga0068854_100002758 | Ga0068854_10000275813 | 318 |
| 139 | 3300005616 | Ga0068852_100000390 | Ga0068852_10000039032 | 318 |
| 140 | 3300005616 | Ga0068852_100231138 | Ga0068852_1002311382 | 318 |
| 141 | 3300005618 | Ga0068864_100046279 | Ga0068864_1000462794 | 318 |
| 142 | 3300005618 | Ga0068864_100048750 | Ga0068864_1000487504 | 318 |
| 143 | 3300005834 | Ga0068851_10030261 | Ga0068851_100302613 | 318 |
| 144 | 3300005841 | Ga0068863_100015226 | Ga0068863_1000152262 | 318 |
| 145 | 3300005841 | Ga0068863_100032281 | Ga0068863_1000322812 | 318 |
| 146 | 3300005841 | Ga0068863_100087192 | Ga0068863_1000871924 | 318 |
| 147 | 3300005842 | Ga0068858_100431875 | Ga0068858_1004318751 | 318 |
| 148 | 3300006038 | Ga0075365_10013968 | Ga0075365_100139682 | 318 |
| 149 | 3300006186 | Ga0075369_10002981 | Ga0075369_100029812 | 318 |
| 150 | 3300006186 | Ga0075369_10021143 | Ga0075369_100211431 | 318 |
| 151 | 3300006195 | Ga0075366_10129436 | Ga0075366_101294362 | 318 |
| 152 | 3300006237 | Ga0097621_100019765 | Ga0097621_1000197656 | 318 |
| 153 | 3300006237 | Ga0097621_100038659 | Ga0097621_1000386593 | 318 |
| 154 | 3300006358 | Ga0068871_100021473 | Ga0068871_1000214732 | 318 |
| 155 | 3300006358 | Ga0068871_100079951 | Ga0068871_1000799513 | 318 |
| 156 | 3300009098 | Ga0105245_10114248 | Ga0105245_101142482 | 318 |
| 157 | 3300009177 | Ga0105248_10069178 | Ga0105248_100691782 | 318 |
| 158 | 3300009177 | Ga0105248_10218597 | Ga0105248_102185972 | 318 |
| 159 | 3300009177 | Ga0105248_10667111 | Ga0105248_106671111 | 318 |
| 160 | 3300011119 | Ga0105246_10241640 | Ga0105246_102416402 | 318 |
| 161 | 3300013296 | Ga0157374_10004173 | Ga0157374_1000417312 | 318 |
| 162 | 3300013296 | Ga0157374_10131227 | Ga0157374_101312273 | 318 |
| 163 | 3300013297 | Ga0157378_10027450 | Ga0157378_100274503 | 318 |
| 164 | 3300013297 | Ga0157378_10112465 | Ga0157378_101124652 | 318 |
| 165 | 3300013306 | Ga0163162_10019074 | Ga0163162_100190741 | 318 |
| 166 | 3300013308 | Ga0157375_10000482 | Ga0157375_100004822 | 318 |
| 167 | 3300014325 | Ga0163163_10045074 | Ga0163163_100450743 | 318 |
| 168 | 3300014969 | Ga0157376_10026218 | Ga0157376_100262185 | 318 |
| 169 | 3300014969 | Ga0157376_10059083 | Ga0157376_100590834 | 318 |
| 170 | 3300017792 | Ga0163161_10039200 | Ga0163161_100392004 | 318 |
| 171 | 3300025321 | Ga0207656_10000974 | Ga0207656_100009742 | 318 |
| 172 | 3300025907 | Ga0207645_10041219 | Ga0207645_100412194 | 318 |
| 173 | 3300025908 | Ga0207643_10040971 | Ga0207643_100409713 | 318 |
| 174 | 3300025908 | Ga0207643_10108440 | Ga0207643_101084402 | 318 |
| 175 | 3300025920 | Ga0207649_10019079 | Ga0207649_100190792 | 318 |
| 176 | 3300025925 | Ga0207650_10003465 | Ga0207650_1000346511 | 318 |
| 177 | 3300025925 | Ga0207650_10056652 | Ga0207650_100566522 | 318 |
| 178 | 3300025926 | Ga0207659_10004672 | Ga0207659_100046726 | 318 |
| 179 | 3300025927 | Ga0207687_10378180 | Ga0207687_103781801 | 318 |
| 180 | 3300025931 | Ga0207644_10000418 | Ga0207644_1000041812 | 318 |
| 181 | 3300025931 | Ga0207644_10161055 | Ga0207644_101610553 | 318 |
| 182 | 3300025937 | Ga0207669_10152080 | Ga0207669_101520802 | 318 |
| 183 | 3300025938 | Ga0207704_10062124 | Ga0207704_100621241 | 318 |
| 184 | 3300025940 | Ga0207691_10000319 | Ga0207691_100003192 | 318 |
| 185 | 3300025941 | Ga0207711_10157597 | Ga0207711_101575971 | 318 |
| 186 | 3300025942 | Ga0207689_10024775 | Ga0207689_100247753 | 318 |
| 187 | 3300025942 | Ga0207689_10245064 | Ga0207689_102450642 | 318 |
| 188 | 3300025944 | Ga0207661_10024178 | Ga0207661_100241782 | 318 |
| 189 | 3300025945 | Ga0207679_10133286 | Ga0207679_101332862 | 318 |
| 190 | 3300025960 | Ga0207651_10001418 | Ga0207651_100014188 | 318 |
| 191 | 3300025972 | Ga0207668_10083754 | Ga0207668_100837541 | 318 |
| 192 | 3300025981 | Ga0207640_10002548 | Ga0207640_1000254810 | 318 |
| 193 | 3300026075 | Ga0207708_10005760 | Ga0207708_100057606 | 318 |
| 194 | 3300026075 | Ga0207708_10007249 | Ga0207708_100072496 | 318 |
| 195 | 3300026089 | Ga0207648_10036740 | Ga0207648_100367404 | 318 |
| 196 | 3300026095 | Ga0207676_10034633 | Ga0207676_100346331 | 318 |
| 197 | 3300026095 | Ga0207676_10043250 | Ga0207676_100432504 | 318 |
| 198 | 3300026118 | Ga0207675_100024855 | Ga0207675_1000248552 | 318 |
| 199 | 3300026118 | Ga0207675_100098647 | Ga0207675_1000986472 | 318 |
| 200 | 3300026121 | Ga0207683_10002093 | Ga0207683_1000209318 | 318 |
| 201 | 3300026121 | Ga0207683_10043032 | Ga0207683_100430321 | 318 |
| 202 | 3300026142 | Ga0207698_10055322 | Ga0207698_100553224 | 318 |
| 203 | 3300026142 | Ga0207698_10223161 | Ga0207698_102231612 | 318 |
| 204 | 3300027907 | Ga0207428_10186529 | Ga0207428_101865292 | 318 |
| 205 | 3300028379 | Ga0268266_10353002 | Ga0268266_103530021 | 318 |
| 206 | 3300041486 | Ga0451807_0915961 | Ga0451807_0915961_1003_1971 | 318 |
| 207 | 3300046459 | Ga0495629_0076154 | Ga0495629_0076154_1256_2224 | 318 |
| 208 | 3300046528 | Ga0495642_0038703 | Ga0495642_0038703_905_1870 | 318 |
| 209 | 3300046539 | Ga0495621_0016539 | Ga0495621_0016539_815_1783 | 318 |
| 210 | 3300046683 | Ga0495658_0038858 | Ga0495658_0038858_1639_2604 | 318 |
| 211 | 3300048907 | Ga0496104_0000434 | Ga0496104_0000434_1787_2764 | 318 |
| 212 | 3300048907 | Ga0496104_0003487 | Ga0496104_0003487_11719_12696 | 318 |
| 213 | 3300048908 | Ga0496105_0090171 | Ga0496105_0090171_316_1284 | 318 |
| 214 | 3300048908 | Ga0496105_0107377 | Ga0496105_0107377_470_1447 | 318 |
| 215 | 3300048911 | Ga0496108_0203635 | Ga0496108_0203635_133_1101 | 318 |
| 216 | 3300048912 | Ga0496109_0026898 | Ga0496109_0026898_153_1121 | 318 |
| 217 | 3300048913 | Ga0496110_0001712 | Ga0496110_0001712_136_1104 | 318 |
| 218 | 3300048913 | Ga0496110_0442417 | Ga0496110_0442417_35_1003 | 318 |
| 219 | 3300048916 | Ga0496113_0219126 | Ga0496113_0219126_501_1478 | 318 |
| 220 | 3300048917 | Ga0496114_0030598 | Ga0496114_0030598_160_1128 | 318 |
| 221 | 3300048917 | Ga0496114_0143795 | Ga0496114_0143795_1087_2055 | 318 |
| 222 | 3300050492 | nmdc:mga0yw44_3893_c2 | nmdc:mga0yw44_3893_c2_551_1522 | 318 |
| 223 | 3300050493 | nmdc:mga0k408_203369_c1 | nmdc:mga0k408_203369_c1_110_1081 | 318 |
| 224 | 3300050511 | nmdc:mga08y16_452926_c1 | nmdc:mga08y16_452926_c1_202_1290 | 318 |
| 225 | 3300050516 | nmdc:mga0sz30_44033_c1 | nmdc:mga0sz30_44033_c1_692_1663 | 318 |
| 226 | 3300053153 | Ga0500616_0002206 | Ga0500616_0002206_8710_9681 | 318 |
| 227 | 3300005544 | Ga0070686_100137983 | Ga0070686_1001379832 | 319 |
| 228 | 3300005539 | Ga0068853_100085153 | Ga0068853_1000851532 | 320 |
| 229 | 3300005937 | Ga0081455_10007625 | Ga0081455_100076259 | 320 |
| 230 | 3300037471 | Ga0395905_0234489 | Ga0395905_0234489_101_1078 | 320 |
| 231 | 3300042007 | Ga0439449_0001455 | Ga0439449_0001455_6599_7576 | 320 |
| 232 | 3300005445 | Ga0070708_100158391 | Ga0070708_1001583912 | 321 |
| 233 | 3300007076 | Ga0075435_100181228 | Ga0075435_1001812281 | 321 |
| 234 | 3300048909 | Ga0496106_0093286 | Ga0496106_0093286_779_1765 | 321 |
| 235 | 3300005471 | Ga0070698_100056349 | Ga0070698_1000563492 | 322 |
| 236 | 3300005618 | Ga0068864_100231120 | Ga0068864_1002311201 | 322 |
| 237 | 3300005841 | Ga0068863_100128399 | Ga0068863_1001283991 | 322 |
| 238 | 3300006237 | Ga0097621_100098318 | Ga0097621_1000983181 | 322 |
| 239 | 3300006358 | Ga0068871_100136999 | Ga0068871_1001369992 | 322 |
| 240 | 3300006880 | Ga0075429_100039664 | Ga0075429_1000396643 | 322 |
| 241 | 3300014968 | Ga0157379_10277446 | Ga0157379_102774461 | 322 |
| 242 | 3300025925 | Ga0207650_10069450 | Ga0207650_100694503 | 322 |
| 243 | 3300025926 | Ga0207659_10186376 | Ga0207659_101863761 | 322 |
| 244 | 3300025940 | Ga0207691_10062575 | Ga0207691_100625752 | 322 |
| 245 | 3300026088 | Ga0207641_10040421 | Ga0207641_100404212 | 322 |
| 246 | 3300026089 | Ga0207648_10342430 | Ga0207648_103424301 | 322 |
| 247 | 3300046664 | Ga0495659_0048688 | Ga0495659_0048688_76_1056 | 322 |
| 248 | 3300048904 | Ga0496101_0328069 | Ga0496101_0328069_104_1084 | 322 |
| 249 | 3300048907 | Ga0496104_0002239 | Ga0496104_0002239_4037_5017 | 322 |
| 250 | 3300048907 | Ga0496104_0050654 | Ga0496104_0050654_2925_3905 | 322 |
| 251 | 3300048908 | Ga0496105_0011456 | Ga0496105_0011456_1802_2782 | 322 |
| 252 | 3300048908 | Ga0496105_0082458 | Ga0496105_0082458_1424_2404 | 322 |
| 253 | 3300048909 | Ga0496106_0125638 | Ga0496106_0125638_980_1960 | 322 |
| 254 | 3300048911 | Ga0496108_0135015 | Ga0496108_0135015_44_1024 | 322 |
| 255 | 3300048912 | Ga0496109_0174833 | Ga0496109_0174833_753_1733 | 322 |
| 256 | 3300048918 | Ga0496115_0025764 | Ga0496115_0025764_143_1123 | 322 |
| 257 | 3300050508 | nmdc:mga09592_70118_c1 | nmdc:mga09592_70118_c1_1454_2434 | 322 |
| 258 | 3300050509 | nmdc:mga0qj67_30949_c1 | nmdc:mga0qj67_30949_c1_1209_2189 | 322 |
| 259 | 3300050510 | nmdc:mga06r32_44581_c1 | nmdc:mga06r32_44581_c1_380_1360 | 322 |
| 260 | 3300035116 | Ga0373945_0022048 | Ga0373945_0022048_960_1994 | 323 |
| 261 | 3300035171 | Ga0373946_0036312 | Ga0373946_0036312_236_1270 | 323 |
| 262 | 3300046459 | Ga0495629_0093952 | Ga0495629_0093952_997_2013 | 323 |
| 263 | 3300047315 | Ga0495581_0070007 | Ga0495581_0070007_748_1782 | 323 |
| 264 | 3300005937 | Ga0081455_10033900 | Ga0081455_100339004 | 324 |
| 265 | 3300006844 | Ga0075428_100272494 | Ga0075428_1002724942 | 324 |
| 266 | 3300006846 | Ga0075430_100066961 | Ga0075430_1000669612 | 324 |
| 267 | 3300006847 | Ga0075431_100082437 | Ga0075431_1000824373 | 324 |
| 268 | 3300009094 | Ga0111539_10192195 | Ga0111539_101921952 | 324 |
| 269 | 3300031240 | Ga0265320_10047327 | Ga0265320_100473272 | 324 |
| 270 | 3300031240 | Ga0265320_10060247 | Ga0265320_100602472 | 324 |
| 271 | 3300031241 | Ga0265325_10057347 | Ga0265325_100573472 | 324 |
| 272 | 3300031241 | Ga0265325_10089275 | Ga0265325_100892752 | 324 |
| 273 | 3300031242 | Ga0265329_10039525 | Ga0265329_100395251 | 324 |
| 274 | 3300031247 | Ga0265340_10020800 | Ga0265340_100208003 | 324 |
| 275 | 3300031344 | Ga0265316_10271693 | Ga0265316_102716932 | 324 |
| 276 | 3300031712 | Ga0265342_10100839 | Ga0265342_101008391 | 324 |
| 277 | 3300035083 | Ga0373926_0074336 | Ga0373926_0074336_184_1158 | 324 |
| 278 | 3300035089 | Ga0373944_0079045 | Ga0373944_0079045_11_985 | 324 |
| 279 | 3300035111 | Ga0373923_0093067 | Ga0373923_0093067_306_1280 | 324 |
| 280 | 3300035113 | Ga0373936_0139712 | Ga0373936_0139712_60_1034 | 324 |
| 281 | 3300035116 | Ga0373945_0029923 | Ga0373945_0029923_196_1170 | 324 |
| 282 | 3300035170 | Ga0373943_0016423 | Ga0373943_0016423_236_1210 | 324 |
| 283 | 3300035171 | Ga0373946_0008578 | Ga0373946_0008578_177_1151 | 324 |
| 284 | 3300035692 | Ga0373935_0224245 | Ga0373935_0224245_250_1224 | 324 |
| 285 | 3300035695 | Ga0373927_0019879 | Ga0373927_0019879_1334_2308 | 324 |
| 286 | 3300037068 | Ga0373925_0117115 | Ga0373925_0117115_786_1760 | 324 |
| 287 | 3300046472 | Ga0495580_0048052 | Ga0495580_0048052_14_988 | 324 |
| 288 | 3300046474 | Ga0495605_0087756 | Ga0495605_0087756_111_1088 | 324 |
| 289 | 3300046491 | Ga0495584_0109536 | Ga0495584_0109536_165_1151 | 324 |
| 290 | 3300046492 | Ga0495585_0011501 | Ga0495585_0011501_2894_3871 | 324 |
| 291 | 3300046499 | Ga0495594_0060654 | Ga0495594_0060654_961_1935 | 324 |
| 292 | 3300046517 | Ga0495630_0283672 | Ga0495630_0283672_234_1208 | 324 |
| 293 | 3300046520 | Ga0495637_0032095 | Ga0495637_0032095_235_1209 | 324 |
| 294 | 3300046523 | Ga0495644_0041417 | Ga0495644_0041417_30_1004 | 324 |
| 295 | 3300046526 | Ga0495666_0042521 | Ga0495666_0042521_1127_2101 | 324 |
| 296 | 3300046528 | Ga0495642_0046939 | Ga0495642_0046939_724_1701 | 324 |
| 297 | 3300046531 | Ga0495665_0117482 | Ga0495665_0117482_181_1155 | 324 |
| 298 | 3300046537 | Ga0495598_0005558 | Ga0495598_0005558_444_1421 | 324 |
| 299 | 3300046539 | Ga0495621_0119999 | Ga0495621_0119999_27_1001 | 324 |
| 300 | 3300046557 | Ga0495622_0126358 | Ga0495622_0126358_15_989 | 324 |
| 301 | 3300046615 | Ga0495656_0035242 | Ga0495656_0035242_1042_2019 | 324 |
| 302 | 3300046674 | Ga0495588_0015185 | Ga0495588_0015185_214_1188 | 324 |
| 303 | 3300046681 | Ga0495647_0083520 | Ga0495647_0083520_239_1213 | 324 |
| 304 | 3300046689 | Ga0495613_0071365 | Ga0495613_0071365_1086_2072 | 324 |
| 305 | 3300046689 | Ga0495613_0074491 | Ga0495613_0074491_208_1182 | 324 |
| 306 | 3300046794 | Ga0495589_0027290 | Ga0495589_0027290_829_1803 | 324 |
| 307 | 3300047318 | Ga0495636_0095613 | Ga0495636_0095613_226_1218 | 324 |
| 308 | 3300047445 | Ga0495677_0017535 | Ga0495677_0017535_118_1092 | 324 |
| 309 | 3300050507 | nmdc:mga05p37_14797_c1 | nmdc:mga05p37_14797_c1_224_1198 | 324 |
| 310 | 3300050509 | nmdc:mga0qj67_114385_c1 | nmdc:mga0qj67_114385_c1_1000_1974 | 324 |
| 311 | 3300001989 | JGI24739J22299_10003110 | JGI24739J22299_100031106 | 325 |
| 312 | 3300002073 | JGI24745J21846_1001594 | JGI24745J21846_10015942 | 325 |
| 313 | 3300002074 | JGI24748J21848_1000577 | JGI24748J21848_10005775 | 325 |
| 314 | 3300002075 | JGI24738J21930_10000272 | JGI24738J21930_100002721 | 325 |
| 315 | 3300002076 | JGI24749J21850_1000351 | JGI24749J21850_10003513 | 325 |
| 316 | 3300002077 | JGI24744J21845_10007470 | JGI24744J21845_100074703 | 325 |
| 317 | 3300002126 | JGI24035J26624_1000417 | JGI24035J26624_10004173 | 325 |
| 318 | 3300002155 | JGI24033J26618_1000610 | JGI24033J26618_10006103 | 325 |
| 319 | 3300002239 | JGI24034J26672_10000190 | JGI24034J26672_100001904 | 325 |
| 320 | 3300005290 | Ga0065712_10082160 | Ga0065712_100821603 | 325 |
| 321 | 3300005293 | Ga0065715_10000395 | Ga0065715_1000039515 | 325 |
| 322 | 3300005328 | Ga0070676_10000128 | Ga0070676_1000012819 | 325 |
| 323 | 3300005330 | Ga0070690_100000302 | Ga0070690_1000003022 | 325 |
| 324 | 3300005331 | Ga0070670_100019884 | Ga0070670_1000198844 | 325 |
| 325 | 3300005333 | Ga0070677_10000043 | Ga0070677_1000004329 | 325 |
| 326 | 3300005334 | Ga0068869_100000289 | Ga0068869_10000028914 | 325 |
| 327 | 3300005335 | Ga0070666_10001787 | Ga0070666_100017876 | 325 |
| 328 | 3300005336 | Ga0070680_100001826 | Ga0070680_10000182614 | 325 |
| 329 | 3300005337 | Ga0070682_100000988 | Ga0070682_1000009884 | 325 |
| 330 | 3300005338 | Ga0068868_100000408 | Ga0068868_1000004084 | 325 |
| 331 | 3300005339 | Ga0070660_100000182 | Ga0070660_10000018213 | 325 |
| 332 | 3300005340 | Ga0070689_100000224 | Ga0070689_10000022436 | 325 |
| 333 | 3300005343 | Ga0070687_100000656 | Ga0070687_10000065612 | 325 |
| 334 | 3300005344 | Ga0070661_100002755 | Ga0070661_10000275513 | 325 |
| 335 | 3300005345 | Ga0070692_10000614 | Ga0070692_1000061412 | 325 |
| 336 | 3300005347 | Ga0070668_100000564 | Ga0070668_1000005642 | 325 |
| 337 | 3300005353 | Ga0070669_100001946 | Ga0070669_1000019461 | 325 |
| 338 | 3300005355 | Ga0070671_100000598 | Ga0070671_1000005988 | 325 |
| 339 | 3300005356 | Ga0070674_100002568 | Ga0070674_10000256811 | 325 |
| 340 | 3300005356 | Ga0070674_100102342 | Ga0070674_1001023422 | 325 |
| 341 | 3300005364 | Ga0070673_100000198 | Ga0070673_1000001984 | 325 |
| 342 | 3300005365 | Ga0070688_100000189 | Ga0070688_10000018924 | 325 |
| 343 | 3300005366 | Ga0070659_100000677 | Ga0070659_1000006772 | 325 |
| 344 | 3300005367 | Ga0070667_100000436 | Ga0070667_10000043635 | 325 |
| 345 | 3300005406 | Ga0070703_10008818 | Ga0070703_100088183 | 325 |
| 346 | 3300005434 | Ga0070709_10047224 | Ga0070709_100472243 | 325 |
| 347 | 3300005435 | Ga0070714_100153759 | Ga0070714_1001537592 | 325 |
| 348 | 3300005437 | Ga0070710_10026425 | Ga0070710_100264252 | 325 |
| 349 | 3300005438 | Ga0070701_10000052 | Ga0070701_100000522 | 325 |
| 350 | 3300005439 | Ga0070711_100128305 | Ga0070711_1001283052 | 325 |
| 351 | 3300005440 | Ga0070705_100000973 | Ga0070705_1000009732 | 325 |
| 352 | 3300005441 | Ga0070700_100000330 | Ga0070700_10000033025 | 325 |
| 353 | 3300005444 | Ga0070694_100000352 | Ga0070694_10000035225 | 325 |
| 354 | 3300005445 | Ga0070708_100012248 | Ga0070708_1000122485 | 325 |
| 355 | 3300005455 | Ga0070663_100000331 | Ga0070663_10000033125 | 325 |
| 356 | 3300005456 | Ga0070678_100000087 | Ga0070678_10000008735 | 325 |
| 357 | 3300005458 | Ga0070681_10000593 | Ga0070681_100005931 | 325 |
| 358 | 3300005459 | Ga0068867_100000942 | Ga0068867_10000094218 | 325 |
| 359 | 3300005466 | Ga0070685_10011732 | Ga0070685_100117321 | 325 |
| 360 | 3300005466 | Ga0070685_10054569 | Ga0070685_100545692 | 325 |
| 361 | 3300005471 | Ga0070698_100271261 | Ga0070698_1002712612 | 325 |
| 362 | 3300005530 | Ga0070679_100003219 | Ga0070679_10000321914 | 325 |
| 363 | 3300005535 | Ga0070684_100000687 | Ga0070684_1000006879 | 325 |
| 364 | 3300005536 | Ga0070697_100237921 | Ga0070697_1002379211 | 325 |
| 365 | 3300005539 | Ga0068853_100000417 | Ga0068853_10000041725 | 325 |
| 366 | 3300005543 | Ga0070672_100000623 | Ga0070672_10000062320 | 325 |
| 367 | 3300005544 | Ga0070686_100002393 | Ga0070686_1000023935 | 325 |
| 368 | 3300005545 | Ga0070695_100351153 | Ga0070695_1003511531 | 325 |
| 369 | 3300005546 | Ga0070696_100002225 | Ga0070696_10000222513 | 325 |
| 370 | 3300005547 | Ga0070693_100000771 | Ga0070693_1000007711 | 325 |
| 371 | 3300005548 | Ga0070665_100013381 | Ga0070665_1000133816 | 325 |
| 372 | 3300005549 | Ga0070704_100001277 | Ga0070704_1000012779 | 325 |
| 373 | 3300005563 | Ga0068855_100040730 | Ga0068855_1000407303 | 325 |
| 374 | 3300005564 | Ga0070664_100010901 | Ga0070664_1000109016 | 325 |
| 375 | 3300005577 | Ga0068857_100000047 | Ga0068857_10000004727 | 325 |
| 376 | 3300005614 | Ga0068856_100001905 | Ga0068856_10000190524 | 325 |
| 377 | 3300005615 | Ga0070702_100000495 | Ga0070702_10000049514 | 325 |
| 378 | 3300005616 | Ga0068852_100001248 | Ga0068852_10000124816 | 325 |
| 379 | 3300005617 | Ga0068859_100001380 | Ga0068859_1000013802 | 325 |
| 380 | 3300005618 | Ga0068864_100002657 | Ga0068864_1000026572 | 325 |
| 381 | 3300005719 | Ga0068861_100000336 | Ga0068861_1000003364 | 325 |
| 382 | 3300005840 | Ga0068870_10000037 | Ga0068870_1000003714 | 325 |
| 383 | 3300005841 | Ga0068863_100000906 | Ga0068863_1000009062 | 325 |
| 384 | 3300005842 | Ga0068858_100004037 | Ga0068858_10000403714 | 325 |
| 385 | 3300005843 | Ga0068860_100002585 | Ga0068860_1000025854 | 325 |
| 386 | 3300005844 | Ga0068862_100000763 | Ga0068862_1000007634 | 325 |
| 387 | 3300005937 | Ga0081455_10020340 | Ga0081455_100203402 | 325 |
| 388 | 3300005983 | Ga0081540_1009813 | Ga0081540_10098132 | 325 |
| 389 | 3300005985 | Ga0081539_10018612 | Ga0081539_100186124 | 325 |
| 390 | 3300006028 | Ga0070717_10021945 | Ga0070717_100219453 | 325 |
| 391 | 3300006038 | Ga0075365_10038850 | Ga0075365_100388501 | 325 |
| 392 | 3300006051 | Ga0075364_10040151 | Ga0075364_100401512 | 325 |
| 393 | 3300006173 | Ga0070716_100055731 | Ga0070716_1000557312 | 325 |
| 394 | 3300006175 | Ga0070712_100000600 | Ga0070712_1000006008 | 325 |
| 395 | 3300006175 | Ga0070712_100055492 | Ga0070712_1000554922 | 325 |
| 396 | 3300006177 | Ga0075362_10065204 | Ga0075362_100652042 | 325 |
| 397 | 3300006178 | Ga0075367_10081339 | Ga0075367_100813392 | 325 |
| 398 | 3300006237 | Ga0097621_100000416 | Ga0097621_1000004165 | 325 |
| 399 | 3300006358 | Ga0068871_100001611 | Ga0068871_10000161112 | 325 |
| 400 | 3300006847 | Ga0075431_100027286 | Ga0075431_1000272862 | 325 |
| 401 | 3300006852 | Ga0075433_10009247 | Ga0075433_100092475 | 325 |
| 402 | 3300006871 | Ga0075434_100002322 | Ga0075434_1000023224 | 325 |
| 403 | 3300006871 | Ga0075434_100086191 | Ga0075434_1000861913 | 325 |
| 404 | 3300006881 | Ga0068865_100000340 | Ga0068865_10000034025 | 325 |
| 405 | 3300006931 | Ga0097620_100001380 | Ga0097620_1000013802 | 325 |
| 406 | 3300007076 | Ga0075435_100146526 | Ga0075435_1001465262 | 325 |
| 407 | 3300007265 | Ga0099794_10019068 | Ga0099794_100190682 | 325 |
| 408 | 3300007788 | Ga0099795_10009473 | Ga0099795_100094734 | 325 |
| 409 | 3300009011 | Ga0105251_10079935 | Ga0105251_100799353 | 325 |
| 410 | 3300009092 | Ga0105250_10087595 | Ga0105250_100875951 | 325 |
| 411 | 3300009093 | Ga0105240_10099178 | Ga0105240_100991783 | 325 |
| 412 | 3300009094 | Ga0111539_10387064 | Ga0111539_103870642 | 325 |
| 413 | 3300009098 | Ga0105245_10001087 | Ga0105245_1000108725 | 325 |
| 414 | 3300009101 | Ga0105247_10001882 | Ga0105247_100018821 | 325 |
| 415 | 3300009148 | Ga0105243_10001705 | Ga0105243_100017053 | 325 |
| 416 | 3300009174 | Ga0105241_10001794 | Ga0105241_100017941 | 325 |
| 417 | 3300009176 | Ga0105242_10004457 | Ga0105242_100044571 | 325 |
| 418 | 3300009177 | Ga0105248_10003875 | Ga0105248_100038751 | 325 |
| 419 | 3300009545 | Ga0105237_10004455 | Ga0105237_100044551 | 325 |
| 420 | 3300009553 | Ga0105249_10001030 | Ga0105249_1000103025 | 325 |
| 421 | 3300010159 | Ga0099796_10082585 | Ga0099796_100825852 | 325 |
| 422 | 3300010375 | Ga0105239_10002253 | Ga0105239_1000225325 | 325 |
| 423 | 3300011119 | Ga0105246_10000057 | Ga0105246_1000005725 | 325 |
| 424 | 3300013100 | Ga0157373_10015723 | Ga0157373_100157236 | 325 |
| 425 | 3300013102 | Ga0157371_10005939 | Ga0157371_100059395 | 325 |
| 426 | 3300013105 | Ga0157369_10300663 | Ga0157369_103006632 | 325 |
| 427 | 3300013296 | Ga0157374_10003737 | Ga0157374_100037371 | 325 |
| 428 | 3300013297 | Ga0157378_10002661 | Ga0157378_100026611 | 325 |
| 429 | 3300013306 | Ga0163162_10037442 | Ga0163162_100374422 | 325 |
| 430 | 3300013306 | Ga0163162_10346107 | Ga0163162_103461072 | 325 |
| 431 | 3300013307 | Ga0157372_10008410 | Ga0157372_100084102 | 325 |
| 432 | 3300013308 | Ga0157375_10000983 | Ga0157375_1000098325 | 325 |
| 433 | 3300013308 | Ga0157375_10299922 | Ga0157375_102999222 | 325 |
| 434 | 3300014325 | Ga0163163_10002371 | Ga0163163_100023717 | 325 |
| 435 | 3300014326 | Ga0157380_10000226 | Ga0157380_100002261 | 325 |
| 436 | 3300014326 | Ga0157380_10140021 | Ga0157380_101400212 | 325 |
| 437 | 3300014745 | Ga0157377_10000681 | Ga0157377_100006815 | 325 |
| 438 | 3300014968 | Ga0157379_10000779 | Ga0157379_100007795 | 325 |
| 439 | 3300014969 | Ga0157376_10002318 | Ga0157376_100023181 | 325 |
| 440 | 3300014969 | Ga0157376_10152733 | Ga0157376_101527332 | 325 |
| 441 | 3300017792 | Ga0163161_10000209 | Ga0163161_1000020922 | 325 |
| 442 | 3300021361 | Ga0213872_10059877 | Ga0213872_100598772 | 325 |
| 443 | 3300025271 | Ga0207666_1000011 | Ga0207666_100001115 | 325 |
| 444 | 3300025290 | Ga0207673_1000047 | Ga0207673_10000472 | 325 |
| 445 | 3300025315 | Ga0207697_10000392 | Ga0207697_100003921 | 325 |
| 446 | 3300025711 | Ga0207696_1050358 | Ga0207696_10503581 | 325 |
| 447 | 3300025885 | Ga0207653_10012297 | Ga0207653_100122972 | 325 |
| 448 | 3300025893 | Ga0207682_10000004 | Ga0207682_100000041 | 325 |
| 449 | 3300025898 | Ga0207692_10034581 | Ga0207692_100345812 | 325 |
| 450 | 3300025899 | Ga0207642_10002298 | Ga0207642_100022983 | 325 |
| 451 | 3300025900 | Ga0207710_10001729 | Ga0207710_100017293 | 325 |
| 452 | 3300025901 | Ga0207688_10000152 | Ga0207688_100001521 | 325 |
| 453 | 3300025901 | Ga0207688_10064037 | Ga0207688_100640372 | 325 |
| 454 | 3300025903 | Ga0207680_10001184 | Ga0207680_100011848 | 325 |
| 455 | 3300025904 | Ga0207647_10003824 | Ga0207647_1000382411 | 325 |
| 456 | 3300025905 | Ga0207685_10033134 | Ga0207685_100331341 | 325 |
| 457 | 3300025907 | Ga0207645_10000281 | Ga0207645_1000028115 | 325 |
| 458 | 3300025908 | Ga0207643_10000012 | Ga0207643_1000001229 | 325 |
| 459 | 3300025910 | Ga0207684_10071925 | Ga0207684_100719253 | 325 |
| 460 | 3300025910 | Ga0207684_10142437 | Ga0207684_101424372 | 325 |
| 461 | 3300025911 | Ga0207654_10004367 | Ga0207654_100043674 | 325 |
| 462 | 3300025912 | Ga0207707_10000551 | Ga0207707_1000055117 | 325 |
| 463 | 3300025913 | Ga0207695_10147984 | Ga0207695_101479842 | 325 |
| 464 | 3300025914 | Ga0207671_10004326 | Ga0207671_100043268 | 325 |
| 465 | 3300025915 | Ga0207693_10007457 | Ga0207693_100074574 | 325 |
| 466 | 3300025915 | Ga0207693_10033249 | Ga0207693_100332492 | 325 |
| 467 | 3300025915 | Ga0207693_10047090 | Ga0207693_100470902 | 325 |
| 468 | 3300025917 | Ga0207660_10000008 | Ga0207660_1000000891 | 325 |
| 469 | 3300025918 | Ga0207662_10000123 | Ga0207662_1000012315 | 325 |
| 470 | 3300025919 | Ga0207657_10000358 | Ga0207657_1000035829 | 325 |
| 471 | 3300025920 | Ga0207649_10000545 | Ga0207649_100005455 | 325 |
| 472 | 3300025921 | Ga0207652_10011583 | Ga0207652_100115833 | 325 |
| 473 | 3300025922 | Ga0207646_10158904 | Ga0207646_101589042 | 325 |
| 474 | 3300025923 | Ga0207681_10000286 | Ga0207681_1000028615 | 325 |
| 475 | 3300025925 | Ga0207650_10005306 | Ga0207650_100053063 | 325 |
| 476 | 3300025926 | Ga0207659_10000023 | Ga0207659_1000002391 | 325 |
| 477 | 3300025926 | Ga0207659_10065015 | Ga0207659_100650152 | 325 |
| 478 | 3300025927 | Ga0207687_10000149 | Ga0207687_100001497 | 325 |
| 479 | 3300025928 | Ga0207700_10041333 | Ga0207700_100413332 | 325 |
| 480 | 3300025928 | Ga0207700_10070497 | Ga0207700_100704972 | 325 |
| 481 | 3300025928 | Ga0207700_10357550 | Ga0207700_103575501 | 325 |
| 482 | 3300025931 | Ga0207644_10000724 | Ga0207644_100007248 | 325 |
| 483 | 3300025932 | Ga0207690_10000203 | Ga0207690_1000020325 | 325 |
| 484 | 3300025933 | Ga0207706_10001339 | Ga0207706_100013391 | 325 |
| 485 | 3300025934 | Ga0207686_10000995 | Ga0207686_100009957 | 325 |
| 486 | 3300025935 | Ga0207709_10000607 | Ga0207709_1000060713 | 325 |
| 487 | 3300025936 | Ga0207670_10000125 | Ga0207670_1000012514 | 325 |
| 488 | 3300025937 | Ga0207669_10000122 | Ga0207669_100001224 | 325 |
| 489 | 3300025937 | Ga0207669_10100030 | Ga0207669_101000302 | 325 |
| 490 | 3300025938 | Ga0207704_10091789 | Ga0207704_100917892 | 325 |
| 491 | 3300025939 | Ga0207665_10001932 | Ga0207665_100019322 | 325 |
| 492 | 3300025940 | Ga0207691_10001334 | Ga0207691_100013341 | 325 |
| 493 | 3300025941 | Ga0207711_10000590 | Ga0207711_100005901 | 325 |
| 494 | 3300025941 | Ga0207711_10036587 | Ga0207711_100365873 | 325 |
| 495 | 3300025942 | Ga0207689_10000008 | Ga0207689_1000000815 | 325 |
| 496 | 3300025944 | Ga0207661_10000104 | Ga0207661_1000010445 | 325 |
| 497 | 3300025945 | Ga0207679_10000053 | Ga0207679_100000534 | 325 |
| 498 | 3300025949 | Ga0207667_10010178 | Ga0207667_100101783 | 325 |
| 499 | 3300025960 | Ga0207651_10009405 | Ga0207651_100094052 | 325 |
| 500 | 3300025961 | Ga0207712_10000156 | Ga0207712_1000015611 | 325 |
| 501 | 3300025972 | Ga0207668_10000251 | Ga0207668_1000025125 | 325 |
| 502 | 3300025972 | Ga0207668_10159317 | Ga0207668_101593172 | 325 |
| 503 | 3300025981 | Ga0207640_10000157 | Ga0207640_1000015722 | 325 |
| 504 | 3300025986 | Ga0207658_10001085 | Ga0207658_1000108512 | 325 |
| 505 | 3300026023 | Ga0207677_10000609 | Ga0207677_100006093 | 325 |
| 506 | 3300026035 | Ga0207703_10007370 | Ga0207703_100073702 | 325 |
| 507 | 3300026041 | Ga0207639_10001949 | Ga0207639_100019496 | 325 |
| 508 | 3300026067 | Ga0207678_10001114 | Ga0207678_1000111425 | 325 |
| 509 | 3300026075 | Ga0207708_10000734 | Ga0207708_1000073425 | 325 |
| 510 | 3300026078 | Ga0207702_10027811 | Ga0207702_100278111 | 325 |
| 511 | 3300026088 | Ga0207641_10000794 | Ga0207641_1000079436 | 325 |
| 512 | 3300026089 | Ga0207648_10001602 | Ga0207648_100016022 | 325 |
| 513 | 3300026095 | Ga0207676_10000934 | Ga0207676_100009341 | 325 |
| 514 | 3300026116 | Ga0207674_10009261 | Ga0207674_1000926111 | 325 |
| 515 | 3300026118 | Ga0207675_100000604 | Ga0207675_10000060425 | 325 |
| 516 | 3300026121 | Ga0207683_10000006 | Ga0207683_1000000694 | 325 |
| 517 | 3300026142 | Ga0207698_10000378 | Ga0207698_1000037813 | 325 |
| 518 | 3300027717 | Ga0209998_10000622 | Ga0209998_100006223 | 325 |
| 519 | 3300027866 | Ga0209813_10042793 | Ga0209813_100427932 | 325 |
| 520 | 3300027907 | Ga0207428_10000112 | Ga0207428_100001125 | 325 |
| 521 | 3300028379 | Ga0268266_10008074 | Ga0268266_100080747 | 325 |
| 522 | 3300028380 | Ga0268265_10002652 | Ga0268265_1000265213 | 325 |
| 523 | 3300028381 | Ga0268264_10002426 | Ga0268264_100024262 | 325 |
| 524 | 3300034957 | Ga0373938_0001311 | Ga0373938_0001311_1187_2164 | 325 |
| 525 | 3300035088 | Ga0373940_0020414 | Ga0373940_0020414_247_1224 | 325 |
| 526 | 3300035092 | Ga0373952_0002039 | Ga0373952_0002039_1246_2223 | 325 |
| 527 | 3300035112 | Ga0373932_0002972 | Ga0373932_0002972_1123_2100 | 325 |
| 528 | 3300035113 | Ga0373936_0008843 | Ga0373936_0008843_599_1639 | 325 |
| 529 | 3300035114 | Ga0373939_0002339 | Ga0373939_0002339_1608_2585 | 325 |
| 530 | 3300035115 | Ga0373941_0002973 | Ga0373941_0002973_1229_2206 | 325 |
| 531 | 3300035121 | Ga0373960_0008610 | Ga0373960_0008610_1216_2193 | 325 |
| 532 | 3300035241 | Ga0373961_0003015 | Ga0373961_0003015_2222_3199 | 325 |
| 533 | 3300035691 | Ga0373931_0000687 | Ga0373931_0000687_2389_3366 | 325 |
| 534 | 3300036401 | Ga0373937_0339714 | Ga0373937_0339714_236_1213 | 325 |
| 535 | 3300046455 | Ga0495603_0006198 | Ga0495603_0006198_191_1231 | 325 |
| 536 | 3300046461 | Ga0495641_0094294 | Ga0495641_0094294_48_1034 | 325 |
| 537 | 3300046476 | Ga0495662_0022103 | Ga0495662_0022103_1231_2271 | 325 |
| 538 | 3300046491 | Ga0495584_0099783 | Ga0495584_0099783_199_1176 | 325 |
| 539 | 3300046492 | Ga0495585_0011090 | Ga0495585_0011090_2270_3247 | 325 |
| 540 | 3300046499 | Ga0495594_0034622 | Ga0495594_0034622_1477_2517 | 325 |
| 541 | 3300046500 | Ga0495596_0032329 | Ga0495596_0032329_59_1036 | 325 |
| 542 | 3300046514 | Ga0495618_0105173 | Ga0495618_0105173_650_1627 | 325 |
| 543 | 3300046518 | Ga0495631_0045847 | Ga0495631_0045847_118_1095 | 325 |
| 544 | 3300046537 | Ga0495598_0001385 | Ga0495598_0001385_3533_4510 | 325 |
| 545 | 3300046538 | Ga0495609_0117289 | Ga0495609_0117289_38_1078 | 325 |
| 546 | 3300046684 | Ga0495669_0057031 | Ga0495669_0057031_470_1447 | 325 |
| 547 | 3300046691 | Ga0495670_0021075 | Ga0495670_0021075_2206_3183 | 325 |
| 548 | 3300046692 | Ga0495671_0052045 | Ga0495671_0052045_329_1306 | 325 |
| 549 | 3300047446 | Ga0495679_019841 | Ga0495679_019841_46_1023 | 325 |
| 550 | 3300047471 | Ga0495684_0220573 | Ga0495684_0220573_259_1236 | 325 |
| 551 | 3300048903 | Ga0496100_0001037 | Ga0496100_0001037_5683_6660 | 325 |
| 552 | 3300048904 | Ga0496101_0002660 | Ga0496101_0002660_1952_2929 | 325 |
| 553 | 3300048905 | Ga0496102_0001120 | Ga0496102_0001120_6746_7723 | 325 |
| 554 | 3300048906 | Ga0496103_0000611 | Ga0496103_0000611_7872_8849 | 325 |
| 555 | 3300048907 | Ga0496104_0000383 | Ga0496104_0000383_5174_6151 | 325 |
| 556 | 3300048909 | Ga0496106_0000541 | Ga0496106_0000541_19102_20079 | 325 |
| 557 | 3300048909 | Ga0496106_0040908 | Ga0496106_0040908_1047_2024 | 325 |
| 558 | 3300048910 | Ga0496107_0000493 | Ga0496107_0000493_10315_11292 | 325 |
| 559 | 3300048910 | Ga0496107_0056207 | Ga0496107_0056207_1587_2564 | 325 |
| 560 | 3300048911 | Ga0496108_0093195 | Ga0496108_0093195_872_1849 | 325 |
| 561 | 3300048912 | Ga0496109_0002920 | Ga0496109_0002920_13044_14021 | 325 |
| 562 | 3300048912 | Ga0496109_0077652 | Ga0496109_0077652_875_1852 | 325 |
| 563 | 3300048913 | Ga0496110_0208981 | Ga0496110_0208981_245_1222 | 325 |
| 564 | 3300048914 | Ga0496111_0131812 | Ga0496111_0131812_154_1131 | 325 |
| 565 | 3300048915 | Ga0496112_0051062 | Ga0496112_0051062_2956_3933 | 325 |
| 566 | 3300048916 | Ga0496113_0036261 | Ga0496113_0036261_393_1370 | 325 |
| 567 | 3300048916 | Ga0496113_0068971 | Ga0496113_0068971_1487_2464 | 325 |
| 568 | 3300048917 | Ga0496114_0003043 | Ga0496114_0003043_4443_5420 | 325 |
| 569 | 3300048918 | Ga0496115_0003177 | Ga0496115_0003177_6765_7742 | 325 |
| 570 | 3300048918 | Ga0496115_0048785 | Ga0496115_0048785_1037_2014 | 325 |
| 571 | 3300049576 | Ga0501040_0143140 | Ga0501040_0143140_471_1448 | 325 |
| 572 | 3300049580 | Ga0501046_0206920 | Ga0501046_0206920_441_1418 | 325 |
| 573 | 3300049822 | Ga0501035_0064120 | Ga0501035_0064120_1820_2821 | 325 |
| 574 | 3300049823 | Ga0501044_0036008 | Ga0501044_0036008_2630_3631 | 325 |
| 575 | 3300050489 | nmdc:mga03683_27101_c1 | nmdc:mga03683_27101_c1_179_1156 | 325 |
| 576 | 3300050491 | nmdc:mga00v17_79253_c1 | nmdc:mga00v17_79253_c1_786_1763 | 325 |
| 577 | 3300050492 | nmdc:mga0yw44_132323_c1 | nmdc:mga0yw44_132323_c1_139_1116 | 325 |
| 578 | 3300050494 | nmdc:mga06z11_25983_c1 | nmdc:mga06z11_25983_c1_301_1278 | 325 |
| 579 | 3300050495 | nmdc:mga04h51_49486_c1 | nmdc:mga04h51_49486_c1_303_1280 | 325 |
| 580 | 3300050507 | nmdc:mga05p37_297552_c1 | nmdc:mga05p37_297552_c1_823_1800 | 325 |
| 581 | 3300050508 | nmdc:mga09592_277806_c1 | nmdc:mga09592_277806_c1_451_1428 | 325 |
| 582 | 3300050510 | nmdc:mga06r32_139195_c1 | nmdc:mga06r32_139195_c1_126_1103 | 325 |
| 583 | 3300050511 | nmdc:mga08y16_802_c1 | nmdc:mga08y16_802_c1_4966_5943 | 325 |
| 584 | 3300050512 | nmdc:mga0n895_291_c1 | nmdc:mga0n895_291_c1_17768_18745 | 325 |
| 585 | 3300050515 | nmdc:mga0a205_1940_c1 | nmdc:mga0a205_1940_c1_14456_15433 | 325 |
| 586 | 3300053077 | Ga0495601_0036988 | Ga0495601_0036988_513_1493 | 325 |
| 587 | 3300061734 | Ga0530510_0169060 | Ga0530510_0169060_253_1230 | 325 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5oku-assembly1.cif.gz_A | r. palustris rpa4515 with adipate | 0.9663 | 29 | 323 |
| 8hkb-assembly1.cif.gz_A | tpa bound-form of periplasmic terephthalate binding protein (tbp) from ideonella sakaiensis mutant k184d | 0.9598 | 34 | 325 |
| 2dvz-assembly1.cif.gz_A | structure of a periplasmic transporter | 0.9579 | 30 | 325 |
| 2f5x-assembly3.cif.gz_C | structure of periplasmic binding protein bugd | 0.9525 | 30 | 323 |
| 5oku-assembly1.cif.gz_A | r. palustris rpa4515 with adipate | 0.9506 | 29 | 323 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 2dvzA02 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II | 0.9549 | 129 | 244 | 3.40.190.10 |
| 6hkeC02 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II | 0.9426 | 128 | 250 | 3.40.190.10 |
| 4x9tA02 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II | 0.9425 | 128 | 244 | 3.40.190.10 |
| 2qpqC02 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II | 0.942 | 128 | 250 | 3.40.190.10 |
| 2qpqB01 | Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Bordetella uptake gene, domain 1 | 0.9356 | 30 | 325 | 3.40.190.150 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A537DML3-F1-model_v4 | Tripartite tricarboxylate transporter substrate binding protein | 0.9784 | 38 | 323 |
|
| AF-A0A1J5PQ67-F1-model_v4 | Tripartite tricarboxylate transporter family receptor | 0.9778 | 67 | 323 |
|
| AF-A0A1F4AHA8-F1-model_v4 | Tripartite tricarboxylate transporter substrate binding protein | 0.9764 | 55 | 322 |
|
| AF-A0A5C8CF86-F1-model_v4 | deleted | 0.9753 | 41 | 325 |
|
| AF-A0A4Q2L567-F1-model_v4 | deleted | 0.9695 | 67 | 220 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar