F466396

General Info

Members Datasets Scaffolds Average Seq Length
584 227 584 193

Family's Representative Sequence

Representative Sequence 3300046642|Ga0495634_0308535|Ga0495634_0308535_126_791
Length 221
Sequence LAGNAGETLGGYLYTQYYSQHATEMREAMSVRHALLALLSEGPKYGLQLREEFEARTGEVWPLNVGQVYTTLQRLERDGLVESDDDGDDGPQKGFRITSDGAAELAGWLRTPPDLASPPRDELVMKVLVALRVPGTDVHEVIQVHRRYLVELMQQWTRIKESEADXXLGLALVVDAELFRLDAVIRWLDTADGRLKRAATDPPQPASVALPRLRRRVGTRS

Samples

Sample ID Description Type Environment
1 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
4 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
5 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
6 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
7 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
8 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
9 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
10 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
11 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
12 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
13 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
14 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
15 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
16 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
17 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
18 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
19 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
20 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
21 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
22 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
23 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
24 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
25 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
26 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
27 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
28 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
29 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
30 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
31 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
32 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
33 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
34 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
35 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
36 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
37 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
38 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
39 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
40 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
41 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
42 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
43 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
44 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
45 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
46 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
47 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
48 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
49 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
50 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
51 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
52 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
53 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
54 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
55 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
56 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
57 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
58 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
59 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
60 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
61 3300012483 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.yng.040610 Metagenome Rhizosphere
62 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
63 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
64 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
65 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
66 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
67 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
68 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
69 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
70 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
71 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
72 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
73 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
74 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
75 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
106 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
107 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
108 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
109 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
110 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
111 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
112 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
113 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
114 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
115 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
116 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
117 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
118 3300033545 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE4 Metagenome Unclassified
119 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
120 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
121 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
122 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
123 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
124 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
125 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
126 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
127 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
128 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
129 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
130 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
131 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
132 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
133 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
134 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
135 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
136 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
137 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
138 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
139 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
140 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
141 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
142 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
143 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
144 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
145 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
146 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
147 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
148 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
149 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
150 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
151 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
152 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
153 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
154 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
155 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
156 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
157 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
158 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
159 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
160 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
161 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
162 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
163 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
164 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
165 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
166 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
167 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
168 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
169 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
170 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
171 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
172 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
173 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
174 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
175 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
176 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
177 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
178 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
179 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
180 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
181 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
182 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
183 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
184 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
185 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
186 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
187 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
188 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
189 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
190 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
191 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
192 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
193 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
194 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
195 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
196 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
197 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
198 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
199 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
200 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
201 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
202 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
203 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
204 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
205 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
206 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
207 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
208 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
209 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
210 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
211 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
212 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
213 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
214 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
215 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
216 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
217 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
218 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
219 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
220 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
221 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
222 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
223 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
224 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
225 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
226 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
227 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.49
Metatranscriptomes 0.51
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.17
Nodule 0
Rhizoplane 2.91
Rhizosphere 94.86
Stem 0
Stem Tuber 0
Unclassified 2.05

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25404J52841_10034555 3300003659 Bacteria 1077
2 Ga0070683_100035577 3300005329 Bacteria 4552
3 Ga0070666_10057061 3300005335 Bacteria 2638
4 Ga0070682_100037652 3300005337 Bacteria 2963
5 Ga0070682_100594109 3300005337 Bacteria 873
6 Ga0068868_100149561 3300005338 Bacteria 1922
7 Ga0070660_100268318 3300005339 Bacteria 1394
8 Ga0070688_100352420 3300005365 Bacteria 1078
9 Ga0070659_100079788 3300005366 Bacteria 2612
10 Ga0070709_10008315 3300005434 Bacteria 5697
11 Ga0070709_10088077 3300005434 Bacteria 2041
12 Ga0070709_10210591 3300005434 Bacteria 1382
13 Ga0070709_10272228 3300005434 Bacteria 1227
14 Ga0070714_100000816 3300005435 Bacteria 22035
15 Ga0070714_100003313 3300005435 Bacteria 12013
16 Ga0070714_100004225 3300005435 Bacteria 10822
17 Ga0070714_100040608 3300005435 Bacteria 3921
18 Ga0070714_100368254 3300005435 Bacteria 1352
19 Ga0070714_100416350 3300005435 Bacteria 1272
20 Ga0070713_100004504 3300005436 Bacteria 9376
21 Ga0070713_100028242 3300005436 Bacteria 4428
22 Ga0070713_100065844 3300005436 Bacteria 3046
23 Ga0070713_100219723 3300005436 Bacteria 1723
24 Ga0070713_100265382 3300005436 Bacteria 1570
25 Ga0070713_100359548 3300005436 Bacteria 1352
26 Ga0070713_100492876 3300005436 Bacteria 1155
27 Ga0070710_10000845 3300005437 Bacteria 14731
28 Ga0070710_10010551 3300005437 Bacteria 4541
29 Ga0070710_10095083 3300005437 Bacteria 1764
30 Ga0070710_10124369 3300005437 Bacteria 1565
31 Ga0070710_10167521 3300005437 Bacteria 1367
32 Ga0070701_10018169 3300005438 Bacteria 3301
33 Ga0070711_100000819 3300005439 Bacteria 16286
34 Ga0070711_100001007 3300005439 Bacteria 14960
35 Ga0070711_100009684 3300005439 Bacteria 5937
36 Ga0070711_100025523 3300005439 Bacteria 3867
37 Ga0070711_100232642 3300005439 Bacteria 1437
38 Ga0070705_100028799 3300005440 Bacteria 3046
39 Ga0070694_100070536 3300005444 Bacteria 2406
40 Ga0070708_100044986 3300005445 Bacteria 3886
41 Ga0070708_100104622 3300005445 Bacteria 2596
42 Ga0070708_100107907 3300005445 Bacteria 2556
43 Ga0070708_100132755 3300005445 Bacteria 2305
44 Ga0070663_100022299 3300005455 Bacteria 4231
45 Ga0070678_100059736 3300005456 Bacteria 2803
46 Ga0070681_10226916 3300005458 Bacteria 1782
47 Ga0070685_10011144 3300005466 Bacteria 4699
48 Ga0070706_100000866 3300005467 Bacteria 33282
49 Ga0070706_100001268 3300005467 Bacteria 26964
50 Ga0070706_100023901 3300005467 Bacteria 5627
51 Ga0070706_100066687 3300005467 Bacteria 3329
52 Ga0070706_100077044 3300005467 Bacteria 3086
53 Ga0070706_100119476 3300005467 Bacteria 2456
54 Ga0070706_100182466 3300005467 Bacteria 1960
55 Ga0070706_100196192 3300005467 Bacteria 1886
56 Ga0070707_100035966 3300005468 Bacteria 4725
57 Ga0070707_100056451 3300005468 Bacteria 3766
58 Ga0070707_100239144 3300005468 Bacteria 1767
59 Ga0070698_100000317 3300005471 Bacteria 49042
60 Ga0070698_100003511 3300005471 Bacteria 17258
61 Ga0070698_100010296 3300005471 Bacteria 9983
62 Ga0070698_100014530 3300005471 Bacteria 8311
63 Ga0070698_100080267 3300005471 Bacteria 3257
64 Ga0070698_100198667 3300005471 Bacteria 1941
65 Ga0070699_100000213 3300005518 Bacteria 57419
66 Ga0070699_100759005 3300005518 Bacteria 887
67 Ga0070679_100190776 3300005530 Bacteria 2018
68 Ga0070684_100404813 3300005535 Bacteria 1258
69 Ga0070684_101131129 3300005535 Bacteria 736
70 Ga0070697_100003375 3300005536 Bacteria 12283
71 Ga0070697_100072204 3300005536 Bacteria 2832
72 Ga0070697_100710414 3300005536 Bacteria 887
73 Ga0068853_100359218 3300005539 Bacteria 1356
74 Ga0070695_100045435 3300005545 Bacteria 2799
75 Ga0070696_100053585 3300005546 Bacteria 2808
76 Ga0070693_100043662 3300005547 Bacteria 2532
77 Ga0070665_100519476 3300005548 Bacteria 1202
78 Ga0070665_100731901 3300005548 Bacteria 1002
79 Ga0070704_100164797 3300005549 Bacteria 1756
80 Ga0068857_100074597 3300005577 Bacteria 3023
81 Ga0068854_100027007 3300005578 Bacteria 3951
82 Ga0068856_100177284 3300005614 Bacteria 2144
83 Ga0070702_100078709 3300005615 Bacteria 1968
84 Ga0068859_100233302 3300005617 Bacteria 1929
85 Ga0068864_100066951 3300005618 Bacteria 3118
86 Ga0068851_10061786 3300005834 Bacteria 1921
87 Ga0068858_100327682 3300005842 Bacteria 1464
88 Ga0081538_10003166 3300005981 Bacteria 15648
89 Ga0081540_1000356 3300005983 Bacteria 46150
90 Ga0081540_1001036 3300005983 Bacteria 24897
91 Ga0070717_10003182 3300006028 Bacteria 11727
92 Ga0070717_10010846 3300006028 Bacteria 6896
93 Ga0070717_10013199 3300006028 Bacteria 6320
94 Ga0070717_10045250 3300006028 Bacteria 3598
95 Ga0070717_10065919 3300006028 Bacteria 3010
96 Ga0070717_10318275 3300006028 Bacteria 1386
97 Ga0070717_10340171 3300006028 Bacteria 1340
98 Ga0070717_10349196 3300006028 Bacteria 1322
99 Ga0070717_10479951 3300006028 Bacteria 1122
100 Ga0070717_11025752 3300006028 Bacteria 751
101 Ga0070715_10000339 3300006163 Bacteria 11671
102 Ga0070715_10035997 3300006163 Bacteria 2039
103 Ga0070715_10046884 3300006163 Bacteria 1839
104 Ga0070715_10152194 3300006163 Bacteria 1135
105 Ga0070716_100000110 3300006173 Bacteria 32315
106 Ga0070716_100011051 3300006173 Bacteria 4541
107 Ga0070716_100079824 3300006173 Bacteria 1949
108 Ga0070716_100531203 3300006173 Bacteria 873
109 Ga0070712_100003583 3300006175 Bacteria 9567
110 Ga0070712_100011651 3300006175 Bacteria 5584
111 Ga0070712_100071782 3300006175 Bacteria 2478
112 Ga0070712_100082256 3300006175 Bacteria 2335
113 Ga0070712_100148320 3300006175 Bacteria 1798
114 Ga0070712_100480246 3300006175 Unclassified 1039
115 Ga0070712_100554596 3300006175 Bacteria 968
116 Ga0075433_10879805 3300006852 Bacteria 782
117 Ga0075436_100125385 3300006914 Bacteria 1799
118 Ga0075436_100196872 3300006914 Bacteria 1427
119 Ga0097620_100233315 3300006931 Bacteria 1929
120 Ga0075435_100838974 3300007076 Bacteria 801
121 Ga0105251_10199601 3300009011 Bacteria 901
122 Ga0105247_10062743 3300009101 Bacteria 2306
123 Ga0105243_10076310 3300009148 Bacteria 2723
124 Ga0105241_10096385 3300009174 Bacteria 2343
125 Ga0105242_10125075 3300009176 Bacteria 2212
126 Ga0105248_10609899 3300009177 Bacteria 1231
127 Ga0105238_10108612 3300009551 Bacteria 2755
128 Ga0105239_10738648 3300010375 Bacteria 1126
129 Ga0157337_1008687 3300012483 Bacteria 752
130 Ga0157373_10068066 3300013100 Bacteria 2517
131 Ga0157371_10062614 3300013102 Bacteria 2637
132 Ga0157370_10156968 3300013104 Bacteria 2117
133 Ga0157369_10736106 3300013105 Bacteria 1015
134 Ga0157378_10085791 3300013297 Bacteria 2853
135 Ga0157378_11147212 3300013297 Unclassified 815
136 Ga0163162_11083760 3300013306 Bacteria 907
137 Ga0157372_10916456 3300013307 Bacteria 1016
138 Ga0157380_10820979 3300014326 Bacteria 949
139 Ga0157377_10053980 3300014745 Bacteria 2274
140 Ga0163161_10196098 3300017792 Bacteria 1555
141 Ga0206350_11621167 3300020080 Bacteria 1445
142 Ga0213874_10134357 3300021377 Bacteria 852
143 Ga0224572_1018808 3300024225 Bacteria 1328
144 Ga0207692_10000410 3300025898 Bacteria 14976
145 Ga0207692_10006343 3300025898 Bacteria 4795
146 Ga0207692_10033109 3300025898 Bacteria 2490
147 Ga0207692_10068382 3300025898 Bacteria 1862
148 Ga0207692_10094126 3300025898 Bacteria 1631
149 Ga0207692_10128052 3300025898 Bacteria 1430
150 Ga0207688_10012315 3300025901 Bacteria 4655
151 Ga0207685_10037415 3300025905 Bacteria 1787
152 Ga0207699_10000348 3300025906 Bacteria 24580
153 Ga0207699_10000686 3300025906 Bacteria 16245
154 Ga0207699_10042349 3300025906 Bacteria 2637
155 Ga0207699_10572006 3300025906 Bacteria 821
156 Ga0207645_10354582 3300025907 Bacteria 982
157 Ga0207684_10005250 3300025910 Bacteria 12021
158 Ga0207684_10033707 3300025910 Bacteria 4355
159 Ga0207684_10036597 3300025910 Bacteria 4166
160 Ga0207684_10398321 3300025910 Bacteria 1183
161 Ga0207684_10426229 3300025910 Bacteria 1140
162 Ga0207654_10079431 3300025911 Bacteria 1971
163 Ga0207695_10494880 3300025913 Bacteria 1105
164 Ga0207671_10153377 3300025914 Bacteria 1781
165 Ga0207693_10001598 3300025915 Bacteria 20034
166 Ga0207693_10007425 3300025915 Bacteria 9015
167 Ga0207693_10015881 3300025915 Bacteria 6028
168 Ga0207693_10036715 3300025915 Bacteria 3863
169 Ga0207693_10283037 3300025915 Bacteria 1299
170 Ga0207693_10416187 3300025915 Bacteria 1051
171 Ga0207693_10792807 3300025915 Bacteria 730
172 Ga0207663_10000781 3300025916 Bacteria 14255
173 Ga0207663_10011474 3300025916 Bacteria 4756
174 Ga0207663_10216894 3300025916 Bacteria 1390
175 Ga0207646_10008867 3300025922 Bacteria 10016
176 Ga0207646_10013433 3300025922 Bacteria 7832
177 Ga0207646_10076459 3300025922 Bacteria 2992
178 Ga0207646_10085086 3300025922 Bacteria 2829
179 Ga0207646_10267806 3300025922 Bacteria 1544
180 Ga0207659_10038303 3300025926 Bacteria 3334
181 Ga0207700_10000068 3300025928 Bacteria 63290
182 Ga0207700_10009422 3300025928 Bacteria 6098
183 Ga0207700_10012259 3300025928 Bacteria 5519
184 Ga0207700_10025311 3300025928 Bacteria 4119
185 Ga0207700_10028916 3300025928 Bacteria 3906
186 Ga0207700_10060908 3300025928 Bacteria 2860
187 Ga0207700_10387669 3300025928 Bacteria 1223
188 Ga0207700_10404182 3300025928 Bacteria 1197
189 Ga0207700_10406180 3300025928 Unclassified 1194
190 Ga0207664_10002760 3300025929 Bacteria 11663
191 Ga0207664_10009313 3300025929 Bacteria 6884
192 Ga0207664_10012700 3300025929 Bacteria 6028
193 Ga0207664_10017462 3300025929 Bacteria 5262
194 Ga0207664_10026482 3300025929 Bacteria 4384
195 Ga0207664_10044574 3300025929 Bacteria 3474
196 Ga0207664_10046601 3300025929 Bacteria 3403
197 Ga0207690_10265092 3300025932 Bacteria 1332
198 Ga0207706_10040701 3300025933 Bacteria 4119
199 Ga0207665_10000252 3300025939 Bacteria 37009
200 Ga0207665_10006773 3300025939 Bacteria 7590
201 Ga0207665_10016388 3300025939 Bacteria 4865
202 Ga0207665_10325071 3300025939 Bacteria 1155
203 Ga0207689_10007492 3300025942 Bacteria 9567
204 Ga0207661_10125826 3300025944 Bacteria 2189
205 Ga0207651_10301834 3300025960 Bacteria 1332
206 Ga0207677_10361700 3300026023 Bacteria 1219
207 Ga0207678_10030354 3300026067 Bacteria 4719
208 Ga0207702_10508898 3300026078 Bacteria 1174
209 Ga0207641_10203088 3300026088 Bacteria 1828
210 Ga0207676_10140971 3300026095 Bacteria 2063
211 Ga0207674_10065524 3300026116 Bacteria 3661
212 Ga0207675_100096851 3300026118 Bacteria 2778
213 Ga0207683_10004432 3300026121 Bacteria 12132
214 Ga0268266_10219916 3300028379 Bacteria 1745
215 Ga0268266_10403309 3300028379 Bacteria 1293
216 Ga0265319_1120494 3300028563 Bacteria 818
217 Ga0265336_10001399 3300028666 Bacteria 11129
218 Ga0265336_10006766 3300028666 Bacteria 4109
219 Ga0265338_10000522 3300028800 Bacteria 67694
220 Ga0265338_10001979 3300028800 Bacteria 31905
221 Ga0265338_10009893 3300028800 Bacteria 11284
222 Ga0265338_10094251 3300028800 Bacteria 2463
223 Ga0265338_10340977 3300028800 Bacteria 1080
224 Ga0265324_10107910 3300029957 Bacteria 946
225 Ga0265760_10022196 3300031090 Bacteria 1839
226 Ga0265760_10044550 3300031090 Bacteria 1328
227 Ga0265320_10119785 3300031240 Bacteria 1201
228 Ga0265325_10010612 3300031241 Bacteria 5324
229 Ga0265340_10228939 3300031247 Bacteria 831
230 Ga0265316_10042543 3300031344 Bacteria 3630
231 Ga0265313_10088039 3300031595 Bacteria 1399
232 Ga0265314_10032947 3300031711 Bacteria 3806
233 Ga0307516_10079436 3300031730 Bacteria 3125
234 Ga0307510_10138705 3300033180 Bacteria 2082
235 Ga0316214_1015805 3300033545 Bacteria 1042
236 Ga0373948_0049758 3300034817 Bacteria 898
237 Ga0373926_0019178 3300035083 Bacteria 2357
238 Ga0373926_0037495 3300035083 Bacteria 1724
239 Ga0373929_0024258 3300035085 Bacteria 1252
240 Ga0373934_0033562 3300035086 Bacteria 2014
241 Ga0373944_0006082 3300035089 Bacteria 3197
242 Ga0373944_0096871 3300035089 Bacteria 992
243 Ga0373923_0024468 3300035111 Bacteria 2383
244 Ga0373923_0030418 3300035111 Bacteria 2172
245 Ga0373923_0180817 3300035111 Bacteria 969
246 Ga0373936_0005528 3300035113 Bacteria 4771
247 Ga0373936_0012587 3300035113 Bacteria 3220
248 Ga0373936_0022172 3300035113 Bacteria 2473
249 Ga0373939_0067701 3300035114 Bacteria 1154
250 Ga0373939_0202331 3300035114 Bacteria 752
251 Ga0373941_0017037 3300035115 Bacteria 1985
252 Ga0373945_0000319 3300035116 Bacteria 13699
253 Ga0373945_0005101 3300035116 Bacteria 4189
254 Ga0373953_0000499 3300035117 Bacteria 10900
255 Ga0373953_0005118 3300035117 Bacteria 4235
256 Ga0373953_0017260 3300035117 Bacteria 2650
257 Ga0373954_0011494 3300035118 Bacteria 3924
258 Ga0373954_0038601 3300035118 Bacteria 2221
259 Ga0373954_0077204 3300035118 Bacteria 1588
260 Ga0373956_0000507 3300035119 Bacteria 15920
261 Ga0373956_0013526 3300035119 Bacteria 3395
262 Ga0373956_0049301 3300035119 Bacteria 1888
263 Ga0373957_0003893 3300035120 Bacteria 4481
264 Ga0373957_0005818 3300035120 Bacteria 3846
265 Ga0373957_0010371 3300035120 Bacteria 3078
266 Ga0373957_0190961 3300035120 Bacteria 851
267 Ga0373943_0000494 3300035170 Bacteria 16821
268 Ga0373943_0133283 3300035170 Bacteria 1331
269 Ga0373946_0001672 3300035171 Bacteria 7728
270 Ga0373946_0006344 3300035171 Bacteria 4287
271 Ga0373946_0328772 3300035171 Bacteria 761
272 Ga0373955_0000028 3300035172 Bacteria 58050
273 Ga0373955_0005298 3300035172 Bacteria 5789
274 Ga0373955_0009103 3300035172 Bacteria 4638
275 Ga0373955_0010833 3300035172 Bacteria 4323
276 Ga0373955_0151058 3300035172 Bacteria 1367
277 Ga0373955_0417066 3300035172 Bacteria 816
278 Ga0373942_0048640 3300035207 Bacteria 1182
279 Ga0373924_0004734 3300035410 Bacteria 4776
280 Ga0373924_0005988 3300035410 Bacteria 4336
281 Ga0373924_0009402 3300035410 Bacteria 3581
282 Ga0373924_0013032 3300035410 Bacteria 3118
283 Ga0373924_0095804 3300035410 Bacteria 1273
284 Ga0373931_0479901 3300035691 Bacteria 799
285 Ga0373935_0001720 3300035692 Bacteria 12264
286 Ga0373935_0114752 3300035692 Bacteria 1792
287 Ga0373935_0151362 3300035692 Bacteria 1574
288 Ga0373935_0194803 3300035692 Bacteria 1397
289 Ga0373935_0366648 3300035692 Bacteria 1029
290 Ga0373935_0410502 3300035692 Bacteria 974
291 Ga0373935_0471214 3300035692 Bacteria 909
292 Ga0373927_0008164 3300035695 Bacteria 7060
293 Ga0373927_0120162 3300035695 Bacteria 1715
294 Ga0373933_0000004 3300035724 Bacteria 143741
295 Ga0373933_0027338 3300035724 Bacteria 3284
296 Ga0373933_0054706 3300035724 Bacteria 2392
297 Ga0373933_0085943 3300035724 Bacteria 1934
298 Ga0373933_0105244 3300035724 Bacteria 1754
299 Ga0373933_0124644 3300035724 Bacteria 1615
300 Ga0373933_0242027 3300035724 Bacteria 1160
301 Ga0373947_0003253 3300035725 Bacteria 9633
302 Ga0373947_0040507 3300035725 Bacteria 2774
303 Ga0373947_0085254 3300035725 Bacteria 1962
304 Ga0373947_0162665 3300035725 Bacteria 1444
305 Ga0373947_0383441 3300035725 Bacteria 946
306 Ga0373937_0000012 3300036401 Bacteria 159418
307 Ga0373937_0007374 3300036401 Bacteria 9517
308 Ga0373937_0008229 3300036401 Bacteria 9056
309 Ga0373937_0010358 3300036401 Bacteria 8140
310 Ga0373937_0011548 3300036401 Bacteria 7752
311 Ga0373937_0020657 3300036401 Bacteria 5904
312 Ga0373937_0033873 3300036401 Bacteria 4643
313 Ga0373937_0044840 3300036401 Bacteria 4039
314 Ga0373937_0083306 3300036401 Bacteria 2958
315 Ga0373937_0165860 3300036401 Bacteria 2071
316 Ga0373937_0288378 3300036401 Bacteria 1550
317 Ga0373925_0004017 3300037068 Bacteria 11185
318 Ga0373925_0026126 3300037068 Bacteria 4270
319 Ga0373925_0078455 3300037068 Bacteria 2507
320 Ga0373925_0085593 3300037068 Bacteria 2403
321 Ga0373925_0199146 3300037068 Bacteria 1592
322 Ga0373925_0631478 3300037068 Bacteria 882
323 Ga0395899_0076720 3300037312 Bacteria 2439
324 Ga0395900_0038975 3300037418 Bacteria 4898
325 Ga0395898_0148539 3300037466 Bacteria 2243
326 Ga0395905_0097434 3300037471 Bacteria 2761
327 Ga0436364_0997383 3300037853 Bacteria 2754
328 Ga0436364_1404373 3300037853 Bacteria 8917
329 Ga0436364_1446560 3300037853 Bacteria 736
330 Ga0436364_1526997 3300037853 Bacteria 841
331 Ga0395901_0025340 3300038443 Bacteria 6088
332 Ga0436365_0511050 3300039437 Bacteria 1103
333 Ga0436365_0614644 3300039437 Bacteria 1550
334 Ga0436360_1343072 3300039438 Bacteria 1532
335 Ga0436363_0625029 3300039450 Bacteria 968
336 Ga0436363_0943838 3300039450 Bacteria 1143
337 Ga0436362_0743430 3300039453 Bacteria 889
338 Ga0439463_002045 3300042016 Bacteria 5235
339 Ga0466964_0352895 3300044706 Bacteria 756
340 Ga0466959_0084893 3300045049 Bacteria 2279
341 Ga0466958_0474182 3300045836 Bacteria 811
342 Ga0466967_1118608 3300045976 Bacteria 785
343 Ga0495592_0000183 3300046454 Bacteria 55068
344 Ga0495592_0009083 3300046454 Bacteria 7478
345 Ga0495592_0065299 3300046454 Bacteria 2664
346 Ga0495592_0155308 3300046454 Bacteria 1579
347 Ga0495592_0211891 3300046454 Bacteria 1300
348 Ga0495603_0269711 3300046455 Bacteria 979
349 Ga0495629_0011488 3300046459 Bacteria 6432
350 Ga0495629_0281534 3300046459 Bacteria 1141
351 Ga0495629_0296574 3300046459 Bacteria 1107
352 Ga0495641_0010720 3300046461 Bacteria 5282
353 Ga0495641_0050429 3300046461 Bacteria 1902
354 Ga0495641_0168015 3300046461 Bacteria 981
355 Ga0495651_0000020 3300046462 Bacteria 120523
356 Ga0495651_0019984 3300046462 Bacteria 5195
357 Ga0495651_0022414 3300046462 Bacteria 4908
358 Ga0495651_0029497 3300046462 Bacteria 4278
359 Ga0495651_0044435 3300046462 Bacteria 3443
360 Ga0495651_0097944 3300046462 Bacteria 2189
361 Ga0495651_0154883 3300046462 Bacteria 1648
362 Ga0495651_0180285 3300046462 Bacteria 1495
363 Ga0495651_0325764 3300046462 Bacteria 1022
364 Ga0495651_0533468 3300046462 Bacteria 747
365 Ga0495653_0000289 3300046463 Bacteria 40642
366 Ga0495653_0005179 3300046463 Bacteria 10599
367 Ga0495653_0089318 3300046463 Bacteria 2258
368 Ga0495653_0094982 3300046463 Bacteria 2171
369 Ga0495653_0163476 3300046463 Bacteria 1543
370 Ga0495653_0210708 3300046463 Bacteria 1312
371 Ga0495653_0237986 3300046463 Bacteria 1215
372 Ga0495653_0298471 3300046463 Bacteria 1051
373 Ga0495653_0354147 3300046463 Bacteria 943
374 Ga0495653_0694281 3300046463 Bacteria 618
375 Ga0495580_0391701 3300046472 Bacteria 938
376 Ga0495580_0545382 3300046472 Bacteria 770
377 Ga0495582_0008719 3300046473 Bacteria 5591
378 Ga0495582_0066246 3300046473 Bacteria 1995
379 Ga0495639_0000902 3300046475 Bacteria 13408
380 Ga0495639_0127312 3300046475 Bacteria 1217
381 Ga0495662_0010497 3300046476 Bacteria 4533
382 Ga0495662_0017607 3300046476 Bacteria 3458
383 Ga0495662_0208756 3300046476 Bacteria 963
384 Ga0495664_0041216 3300046477 Bacteria 2731
385 Ga0495664_0119580 3300046477 Bacteria 1593
386 Ga0495664_0232097 3300046477 Bacteria 1117
387 Ga0495594_0004077 3300046499 Bacteria 7510
388 Ga0495594_0021039 3300046499 Bacteria 3480
389 Ga0495608_0000015 3300046511 Bacteria 200266
390 Ga0495608_0002340 3300046511 Bacteria 13658
391 Ga0495608_0085740 3300046511 Bacteria 2041
392 Ga0495618_0066872 3300046514 Bacteria 2284
393 Ga0495618_0107991 3300046514 Bacteria 1782
394 Ga0495618_0210039 3300046514 Bacteria 1230
395 Ga0495618_0233907 3300046514 Bacteria 1156
396 Ga0495618_0468710 3300046514 Bacteria 762
397 Ga0495628_0000055 3300046516 Bacteria 89993
398 Ga0495628_0019080 3300046516 Bacteria 5672
399 Ga0495628_0073530 3300046516 Bacteria 2663
400 Ga0495628_0074997 3300046516 Bacteria 2634
401 Ga0495628_0110261 3300046516 Bacteria 2117
402 Ga0495628_0226184 3300046516 Bacteria 1403
403 Ga0495628_0332162 3300046516 Bacteria 1120
404 Ga0495630_0005750 3300046517 Bacteria 8767
405 Ga0495630_0010186 3300046517 Bacteria 6778
406 Ga0495630_0034309 3300046517 Bacteria 3789
407 Ga0495630_0140522 3300046517 Bacteria 1836
408 Ga0495630_0251777 3300046517 Bacteria 1349
409 Ga0495630_0352338 3300046517 Bacteria 1126
410 Ga0495666_0081111 3300046526 Bacteria 1535
411 Ga0495666_0164523 3300046526 Bacteria 1028
412 Ga0495652_0000074 3300046529 Bacteria 105662
413 Ga0495652_0013842 3300046529 Bacteria 7256
414 Ga0495652_0018387 3300046529 Bacteria 6233
415 Ga0495652_0020248 3300046529 Bacteria 5914
416 Ga0495652_0074225 3300046529 Bacteria 2829
417 Ga0495652_0100972 3300046529 Bacteria 2339
418 Ga0495652_0103809 3300046529 Bacteria 2300
419 Ga0495652_0116209 3300046529 Bacteria 2142
420 Ga0495652_0319167 3300046529 Bacteria 1123
421 Ga0495665_0040081 3300046531 Bacteria 2494
422 Ga0495665_0094945 3300046531 Bacteria 1566
423 Ga0495640_0025208 3300046533 Bacteria 4317
424 Ga0495640_0051582 3300046533 Bacteria 2827
425 Ga0495640_0054680 3300046533 Bacteria 2733
426 Ga0495640_0059102 3300046533 Bacteria 2613
427 Ga0495640_0142015 3300046533 Bacteria 1547
428 Ga0495640_0319741 3300046533 Bacteria 961
429 Ga0495586_0013646 3300046535 Bacteria 4310
430 Ga0495586_0235759 3300046535 Bacteria 1042
431 Ga0495586_0390571 3300046535 Bacteria 800
432 Ga0495587_0001591 3300046536 Bacteria 15120
433 Ga0495587_0057356 3300046536 Bacteria 2289
434 Ga0495587_0084546 3300046536 Bacteria 1838
435 Ga0495587_0303466 3300046536 Bacteria 893
436 Ga0495587_0370971 3300046536 Bacteria 796
437 Ga0495645_0008898 3300046543 Bacteria 7015
438 Ga0495645_0075853 3300046543 Bacteria 2420
439 Ga0495645_0117775 3300046543 Bacteria 1873
440 Ga0495645_0442117 3300046543 Bacteria 821
441 Ga0495667_0000033 3300046559 Bacteria 143083
442 Ga0495667_0001616 3300046559 Bacteria 14938
443 Ga0495667_0002074 3300046559 Bacteria 13311
444 Ga0495667_0020210 3300046559 Bacteria 4492
445 Ga0495667_0041872 3300046559 Bacteria 3036
446 Ga0495667_0161665 3300046559 Bacteria 1440
447 Ga0495667_0264505 3300046559 Bacteria 1093
448 Ga0495667_0368513 3300046559 Bacteria 906
449 Ga0495667_0538483 3300046559 Bacteria 730
450 Ga0495634_0106827 3300046642 Bacteria 1803
451 Ga0495634_0237350 3300046642 Bacteria 1119
452 Ga0495634_0308535 3300046642 Bacteria 955
453 Ga0495635_0004115 3300046663 Bacteria 10085
454 Ga0495635_0027780 3300046663 Bacteria 3935
455 Ga0495635_0028518 3300046663 Bacteria 3881
456 Ga0495635_0138451 3300046663 Bacteria 1658
457 Ga0495635_0184037 3300046663 Bacteria 1419
458 Ga0495635_0495968 3300046663 Bacteria 804
459 Ga0495588_0007147 3300046674 Bacteria 5065
460 Ga0495657_0000097 3300046675 Bacteria 76773
461 Ga0495657_0011159 3300046675 Bacteria 6730
462 Ga0495657_0026856 3300046675 Bacteria 4072
463 Ga0495657_0052313 3300046675 Bacteria 2738
464 Ga0495657_0064456 3300046675 Bacteria 2414
465 Ga0495657_0076339 3300046675 Bacteria 2176
466 Ga0495657_0089568 3300046675 Bacteria 1976
467 Ga0495657_0094235 3300046675 Bacteria 1915
468 Ga0495657_0139320 3300046675 Bacteria 1513
469 Ga0495599_0000018 3300046678 Bacteria 144334
470 Ga0495599_0019364 3300046678 Bacteria 4243
471 Ga0495599_0020255 3300046678 Bacteria 4142
472 Ga0495599_0063816 3300046678 Bacteria 2301
473 Ga0495599_0068988 3300046678 Bacteria 2207
474 Ga0495599_0315772 3300046678 Bacteria 941
475 Ga0495623_0000036 3300046679 Bacteria 83368
476 Ga0495623_0042094 3300046679 Bacteria 2910
477 Ga0495623_0058542 3300046679 Bacteria 2422
478 Ga0495623_0059980 3300046679 Bacteria 2388
479 Ga0495623_0080285 3300046679 Bacteria 2019
480 Ga0495646_0039422 3300046680 Bacteria 2912
481 Ga0495646_0064335 3300046680 Bacteria 2174
482 Ga0495646_0085645 3300046680 Bacteria 1829
483 Ga0495646_0088370 3300046680 Bacteria 1795
484 Ga0495646_0157639 3300046680 Bacteria 1258
485 Ga0495646_0176697 3300046680 Bacteria 1174
486 Ga0495647_0022181 3300046681 Bacteria 2292
487 Ga0495647_0254675 3300046681 Bacteria 782
488 Ga0495658_0011799 3300046683 Bacteria 4405
489 Ga0495613_0003433 3300046689 Bacteria 11846
490 Ga0495613_0007035 3300046689 Bacteria 8374
491 Ga0495624_0019942 3300046690 Bacteria 4467
492 Ga0495624_0032165 3300046690 Bacteria 3403
493 Ga0495624_0199329 3300046690 Bacteria 1216
494 Ga0495600_0001562 3300046809 Bacteria 12742
495 Ga0495600_0008342 3300046809 Bacteria 6361
496 Ga0495600_0040896 3300046809 Bacteria 3021
497 Ga0495600_0045087 3300046809 Bacteria 2876
498 Ga0495600_0047171 3300046809 Bacteria 2810
499 Ga0495600_0095048 3300046809 Bacteria 1943
500 Ga0495600_0159736 3300046809 Bacteria 1457
501 Ga0495581_0005320 3300047315 Bacteria 7445
502 Ga0495581_0010471 3300047315 Bacteria 5361
503 Ga0495581_0051685 3300047315 Bacteria 2373
504 Ga0495604_0000025 3300047317 Bacteria 145481
505 Ga0495604_0017889 3300047317 Bacteria 5670
506 Ga0495604_0028890 3300047317 Bacteria 4412
507 Ga0495604_0040138 3300047317 Bacteria 3676
508 Ga0495604_0073276 3300047317 Bacteria 2585
509 Ga0495604_0159735 3300047317 Bacteria 1593
510 Ga0495674_0002231 3300047319 Bacteria 19055
511 Ga0495674_0099087 3300047319 Bacteria 2481
512 Ga0495674_0191495 3300047319 Bacteria 1699
513 Ga0495674_0212573 3300047319 Bacteria 1601
514 Ga0495674_0515951 3300047319 Bacteria 954
515 Ga0495674_0537563 3300047319 Bacteria 931
516 Ga0495674_0721221 3300047319 Bacteria 781
517 Ga0495676_0020738 3300047321 Bacteria 5758
518 Ga0495676_0102382 3300047321 Bacteria 2116
519 Ga0495676_0666805 3300047321 Bacteria 674
520 Ga0495680_0000015 3300047322 Bacteria 131335
521 Ga0495680_0001846 3300047322 Bacteria 22329
522 Ga0495680_0003684 3300047322 Bacteria 14965
523 Ga0495680_0029697 3300047322 Bacteria 4474
524 Ga0495680_0046315 3300047322 Bacteria 3429
525 Ga0495680_0065306 3300047322 Bacteria 2787
526 Ga0495680_0085583 3300047322 Bacteria 2373
527 Ga0495680_0101811 3300047322 Bacteria 2139
528 Ga0495675_0004262 3300047444 Bacteria 8647
529 Ga0495675_0011313 3300047444 Bacteria 5601
530 Ga0495675_0069650 3300047444 Bacteria 2221
531 Ga0495675_0190386 3300047444 Bacteria 1252
532 Ga0495684_0013133 3300047471 Bacteria 6391
533 Ga0495684_0014063 3300047471 Bacteria 6156
534 Ga0495684_0089383 3300047471 Bacteria 2333
535 Ga0495684_0121323 3300047471 Bacteria 1968
536 Ga0495684_0175299 3300047471 Bacteria 1592
537 Ga0495684_0185073 3300047471 Bacteria 1542
538 Ga0495684_0200251 3300047471 Bacteria 1472
539 Ga0495593_0006460 3300047673 Bacteria 6868
540 Ga0495593_0074904 3300047673 Bacteria 1755
541 Ga0495602_0000065 3300048088 Bacteria 104080
542 Ga0495602_0013041 3300048088 Bacteria 8501
543 Ga0495602_0049359 3300048088 Bacteria 3770
544 Ga0495602_0055724 3300048088 Bacteria 3480
545 Ga0495602_0090381 3300048088 Bacteria 2543
546 Ga0495602_0097502 3300048088 Bacteria 2421
547 Ga0495602_0281591 3300048088 Bacteria 1224
548 Ga0495602_0382627 3300048088 Bacteria 1008
549 Ga0495602_0613980 3300048088 Bacteria 746
550 Ga0496101_0635613 3300048904 Bacteria 843
551 Ga0496102_0318761 3300048905 Bacteria 1465
552 Ga0496103_0021372 3300048906 Bacteria 3892
553 Ga0496104_0000404 3300048907 Bacteria 37796
554 Ga0496104_0037090 3300048907 Bacteria 4558
555 Ga0496105_0025736 3300048908 Bacteria 4793
556 Ga0496107_0550520 3300048910 Bacteria 854
557 Ga0496108_0010049 3300048911 Bacteria 7677
558 Ga0496109_0920007 3300048912 Bacteria 812
559 Ga0496110_0131603 3300048913 Bacteria 2259
560 Ga0496110_0285749 3300048913 Bacteria 1502
561 Ga0496112_0000192 3300048915 Bacteria 39599
562 Ga0496113_0012330 3300048916 Bacteria 5742
563 Ga0496113_0077235 3300048916 Bacteria 2545
564 Ga0496114_0041577 3300048917 Bacteria 3810
565 Ga0496115_0058292 3300048918 Bacteria 3107
566 Ga0496115_0098262 3300048918 Bacteria 2397
567 Ga0501047_0009538 3300049581 Bacteria 9174
568 nmdc:mga0n895_777854_c1 3300050512 Bacteria 949
569 nmdc:mga0rr50_327242_c1 3300050513 Bacteria 1286
570 nmdc:mga0rr50_696983_c1 3300050513 Bacteria 867
571 nmdc:mga08x19_198557_c1 3300050514 Bacteria 1374
572 nmdc:mga08x19_302606_c1 3300050514 Bacteria 1111
573 nmdc:mga0a205_231803_c1 3300050515 Bacteria 1729
574 Ga0495601_0010793 3300053077 Bacteria 5451
575 Ga0495601_0015475 3300053077 Bacteria 4609
576 Ga0495601_0113069 3300053077 Bacteria 1759
577 Ga0495601_0301049 3300053077 Bacteria 1045
578 Ga0495612_0009451 3300053078 Bacteria 3954
579 Ga0495595_0001206 3300053084 Bacteria 10046
580 Ga0495595_0002119 3300053084 Bacteria 7705
581 Ga0495619_0010754 3300053085 Bacteria 5759
582 Ga0495619_0220028 3300053085 Bacteria 1315
583 Ga0495619_0236038 3300053085 Bacteria 1267
584 Ga0500646_0000061 3300053090 Bacteria 30364

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300047315 Ga0495581_0051685 Ga0495581_0051685_1562_2080 145
2 3300005437 Ga0070710_10095083 Ga0070710_100950832 168
3 3300006163 Ga0070715_10046884 Ga0070715_100468843 168
4 3300006175 Ga0070712_100011651 Ga0070712_1000116514 168
5 3300025915 Ga0207693_10015881 Ga0207693_100158813 168
6 3300048088 Ga0495602_0613980 Ga0495602_0613980_34_654 173
7 3300046462 Ga0495651_0154883 Ga0495651_0154883_441_1076 174
8 3300005981 Ga0081538_10003166 Ga0081538_100031665 175
9 3300046517 Ga0495630_0034309 Ga0495630_0034309_3142_3747 175
10 3300046463 Ga0495653_0237986 Ga0495653_0237986_399_1004 176
11 3300046516 Ga0495628_0073530 Ga0495628_0073530_1722_2327 176
12 3300046529 Ga0495652_0074225 Ga0495652_0074225_1735_2340 176
13 3300046533 Ga0495640_0059102 Ga0495640_0059102_571_1176 176
14 3300046543 Ga0495645_0008898 Ga0495645_0008898_5591_6196 176
15 3300046678 Ga0495599_0068988 Ga0495599_0068988_679_1284 176
16 3300047319 Ga0495674_0212573 Ga0495674_0212573_351_956 176
17 3300035692 Ga0373935_0471214 Ga0373935_0471214_63_650 178
18 3300037068 Ga0373925_0199146 Ga0373925_0199146_958_1545 178
19 3300046514 Ga0495618_0210039 Ga0495618_0210039_134_721 178
20 3300046529 Ga0495652_0319167 Ga0495652_0319167_60_647 178
21 3300046533 Ga0495640_0054680 Ga0495640_0054680_2076_2663 178
22 3300047319 Ga0495674_0099087 Ga0495674_0099087_1791_2378 178
23 3300047321 Ga0495676_0102382 Ga0495676_0102382_125_712 178
24 3300006914 Ga0075436_100196872 Ga0075436_1001968722 179
25 3300035083 Ga0373926_0037495 Ga0373926_0037495_443_1063 179
26 3300035089 Ga0373944_0096871 Ga0373944_0096871_37_657 179
27 3300035113 Ga0373936_0005528 Ga0373936_0005528_3435_4055 179
28 3300035116 Ga0373945_0000319 Ga0373945_0000319_3918_4538 179
29 3300035170 Ga0373943_0000494 Ga0373943_0000494_6813_7433 179
30 3300035171 Ga0373946_0006344 Ga0373946_0006344_1167_1787 179
31 3300035692 Ga0373935_0001720 Ga0373935_0001720_11472_12092 179
32 3300035695 Ga0373927_0008164 Ga0373927_0008164_2483_3103 179
33 3300035725 Ga0373947_0003253 Ga0373947_0003253_7076_7696 179
34 3300037068 Ga0373925_0078455 Ga0373925_0078455_1269_1889 179
35 3300045049 Ga0466959_0084893 Ga0466959_0084893_1478_2128 179
36 3300046455 Ga0495603_0269711 Ga0495603_0269711_348_968 179
37 3300046461 Ga0495641_0050429 Ga0495641_0050429_627_1247 179
38 3300046463 Ga0495653_0005179 Ga0495653_0005179_1541_2161 179
39 3300046476 Ga0495662_0010497 Ga0495662_0010497_717_1337 179
40 3300046477 Ga0495664_0041216 Ga0495664_0041216_516_1136 179
41 3300046514 Ga0495618_0107991 Ga0495618_0107991_681_1301 179
42 3300046516 Ga0495628_0074997 Ga0495628_0074997_409_1029 179
43 3300046517 Ga0495630_0005750 Ga0495630_0005750_688_1308 179
44 3300046529 Ga0495652_0018387 Ga0495652_0018387_2384_3004 179
45 3300046531 Ga0495665_0094945 Ga0495665_0094945_634_1254 179
46 3300046535 Ga0495586_0235759 Ga0495586_0235759_317_937 179
47 3300046559 Ga0495667_0001616 Ga0495667_0001616_10750_11343 179
48 3300046559 Ga0495667_0002074 Ga0495667_0002074_7355_7975 179
49 3300046663 Ga0495635_0004115 Ga0495635_0004115_2614_3207 179
50 3300046663 Ga0495635_0027780 Ga0495635_0027780_89_709 179
51 3300046675 Ga0495657_0076339 Ga0495657_0076339_549_1169 179
52 3300046678 Ga0495599_0315772 Ga0495599_0315772_144_764 179
53 3300046680 Ga0495646_0176697 Ga0495646_0176697_235_855 179
54 3300046690 Ga0495624_0032165 Ga0495624_0032165_672_1292 179
55 3300046809 Ga0495600_0159736 Ga0495600_0159736_426_1046 179
56 3300047319 Ga0495674_0002231 Ga0495674_0002231_777_1397 179
57 3300047321 Ga0495676_0020738 Ga0495676_0020738_4637_5257 179
58 3300047322 Ga0495680_0001846 Ga0495680_0001846_6043_6663 179
59 3300047471 Ga0495684_0014063 Ga0495684_0014063_963_1583 179
60 3300013297 Ga0157378_11147212 Ga0157378_111472121 180
61 3300035692 Ga0373935_0410502 Ga0373935_0410502_24_605 180
62 3300036401 Ga0373937_0288378 Ga0373937_0288378_911_1492 180
63 3300046516 Ga0495628_0332162 Ga0495628_0332162_358_939 180
64 3300025939 Ga0207665_10325071 Ga0207665_103250712 181
65 3300046477 Ga0495664_0119580 Ga0495664_0119580_928_1515 181
66 3300005434 Ga0070709_10272228 Ga0070709_102722282 182
67 3300005435 Ga0070714_100416350 Ga0070714_1004163502 182
68 3300005467 Ga0070706_100077044 Ga0070706_1000770443 182
69 3300006173 Ga0070716_100531203 Ga0070716_1005312031 182
70 3300006914 Ga0075436_100125385 Ga0075436_1001253851 182
71 3300035114 Ga0373939_0202331 Ga0373939_0202331_45_671 182
72 3300046463 Ga0495653_0298471 Ga0495653_0298471_285_947 182
73 3300046514 Ga0495618_0468710 Ga0495618_0468710_39_677 182
74 3300046517 Ga0495630_0140522 Ga0495630_0140522_651_1289 182
75 3300050514 nmdc:mga08x19_198557_c1 nmdc:mga08x19_198557_c1_632_1246 182
76 3300005436 Ga0070713_100492876 Ga0070713_1004928762 183
77 3300025915 Ga0207693_10283037 Ga0207693_102830371 183
78 3300025922 Ga0207646_10085086 Ga0207646_100850861 183
79 3300035086 Ga0373934_0033562 Ga0373934_0033562_756_1358 183
80 3300035113 Ga0373936_0022172 Ga0373936_0022172_1442_2044 183
81 3300035117 Ga0373953_0017260 Ga0373953_0017260_416_1018 183
82 3300035119 Ga0373956_0049301 Ga0373956_0049301_630_1232 183
83 3300035120 Ga0373957_0003893 Ga0373957_0003893_2303_2905 183
84 3300035410 Ga0373924_0005988 Ga0373924_0005988_1627_2229 183
85 3300035692 Ga0373935_0151362 Ga0373935_0151362_136_738 183
86 3300035724 Ga0373933_0124644 Ga0373933_0124644_972_1574 183
87 3300035725 Ga0373947_0162665 Ga0373947_0162665_249_851 183
88 3300036401 Ga0373937_0010358 Ga0373937_0010358_42_644 183
89 3300037068 Ga0373925_0085593 Ga0373925_0085593_1579_2181 183
90 3300037312 Ga0395899_0076720 Ga0395899_0076720_115_678 183
91 3300037418 Ga0395900_0038975 Ga0395900_0038975_2326_2889 183
92 3300037466 Ga0395898_0148539 Ga0395898_0148539_1535_2098 183
93 3300037471 Ga0395905_0097434 Ga0395905_0097434_1086_1649 183
94 3300038443 Ga0395901_0025340 Ga0395901_0025340_2038_2601 183
95 3300039437 Ga0436365_0511050 Ga0436365_0511050_231_836 183
96 3300039438 Ga0436360_1343072 Ga0436360_1343072_230_859 183
97 3300046454 Ga0495592_0211891 Ga0495592_0211891_42_644 183
98 3300046459 Ga0495629_0011488 Ga0495629_0011488_2441_3043 183
99 3300046461 Ga0495641_0010720 Ga0495641_0010720_3259_3861 183
100 3300046462 Ga0495651_0325764 Ga0495651_0325764_295_897 183
101 3300046463 Ga0495653_0210708 Ga0495653_0210708_416_1018 183
102 3300046473 Ga0495582_0066246 Ga0495582_0066246_422_1024 183
103 3300046475 Ga0495639_0127312 Ga0495639_0127312_331_933 183
104 3300046476 Ga0495662_0017607 Ga0495662_0017607_2430_3032 183
105 3300046477 Ga0495664_0232097 Ga0495664_0232097_100_702 183
106 3300046517 Ga0495630_0352338 Ga0495630_0352338_109_711 183
107 3300046526 Ga0495666_0164523 Ga0495666_0164523_96_698 183
108 3300046529 Ga0495652_0116209 Ga0495652_0116209_785_1387 183
109 3300046531 Ga0495665_0040081 Ga0495665_0040081_476_1078 183
110 3300046533 Ga0495640_0051582 Ga0495640_0051582_316_918 183
111 3300046535 Ga0495586_0013646 Ga0495586_0013646_1713_2315 183
112 3300046536 Ga0495587_0057356 Ga0495587_0057356_251_853 183
113 3300046543 Ga0495645_0117775 Ga0495645_0117775_973_1575 183
114 3300046559 Ga0495667_0264505 Ga0495667_0264505_416_1018 183
115 3300046559 Ga0495667_0368513 Ga0495667_0368513_85_723 183
116 3300046642 Ga0495634_0106827 Ga0495634_0106827_422_1024 183
117 3300046663 Ga0495635_0184037 Ga0495635_0184037_692_1294 183
118 3300046675 Ga0495657_0094235 Ga0495657_0094235_379_981 183
119 3300046678 Ga0495599_0063816 Ga0495599_0063816_1043_1645 183
120 3300046680 Ga0495646_0064335 Ga0495646_0064335_136_738 183
121 3300046689 Ga0495613_0003433 Ga0495613_0003433_6705_7307 183
122 3300046690 Ga0495624_0199329 Ga0495624_0199329_327_929 183
123 3300047315 Ga0495581_0005320 Ga0495581_0005320_313_915 183
124 3300047317 Ga0495604_0159735 Ga0495604_0159735_692_1294 183
125 3300047319 Ga0495674_0537563 Ga0495674_0537563_76_678 183
126 3300047322 Ga0495680_0029697 Ga0495680_0029697_526_1128 183
127 3300047444 Ga0495675_0190386 Ga0495675_0190386_525_1127 183
128 3300047471 Ga0495684_0089383 Ga0495684_0089383_1437_2039 183
129 3300048088 Ga0495602_0097502 Ga0495602_0097502_1778_2380 183
130 3300053077 Ga0495601_0113069 Ga0495601_0113069_501_1103 183
131 3300053078 Ga0495612_0009451 Ga0495612_0009451_3227_3829 183
132 3300053084 Ga0495595_0001206 Ga0495595_0001206_4054_4656 183
133 3300053085 Ga0495619_0010754 Ga0495619_0010754_4241_4843 183
134 3300031090 Ga0265760_10022196 Ga0265760_100221962 184
135 3300033180 Ga0307510_10138705 Ga0307510_101387053 184
136 3300037853 Ga0436364_0997383 Ga0436364_0997383_773_1351 184
137 3300037853 Ga0436364_1526997 Ga0436364_1526997_70_657 184
138 3300039437 Ga0436365_0614644 Ga0436365_0614644_33_611 184
139 3300006175 Ga0070712_100480246 Ga0070712_1004802462 185
140 3300025928 Ga0207700_10406180 Ga0207700_104061802 185
141 3300031090 Ga0265760_10044550 Ga0265760_100445502 185
142 3300035724 Ga0373933_0085943 Ga0373933_0085943_1112_1738 185
143 3300036401 Ga0373937_0083306 Ga0373937_0083306_1182_1808 185
144 3300046462 Ga0495651_0022414 Ga0495651_0022414_1592_2218 185
145 3300046463 Ga0495653_0089318 Ga0495653_0089318_932_1558 185
146 3300046514 Ga0495618_0233907 Ga0495618_0233907_12_638 185
147 3300046516 Ga0495628_0110261 Ga0495628_0110261_568_1194 185
148 3300046543 Ga0495645_0075853 Ga0495645_0075853_981_1607 185
149 3300046675 Ga0495657_0089568 Ga0495657_0089568_145_771 185
150 3300047322 Ga0495680_0101811 Ga0495680_0101811_1205_1831 185
151 3300047471 Ga0495684_0121323 Ga0495684_0121323_503_1129 185
152 3300048088 Ga0495602_0049359 Ga0495602_0049359_2693_3319 185
153 3300005535 Ga0070684_100404813 Ga0070684_1004048132 186
154 3300028666 Ga0265336_10006766 Ga0265336_100067663 186
155 3300028800 Ga0265338_10000522 Ga0265338_1000052221 186
156 3300035172 Ga0373955_0417066 Ga0373955_0417066_131_718 186
157 3300035410 Ga0373924_0013032 Ga0373924_0013032_208_795 186
158 3300035724 Ga0373933_0054706 Ga0373933_0054706_159_746 186
159 3300036401 Ga0373937_0044840 Ga0373937_0044840_418_1005 186
160 3300037068 Ga0373925_0631478 Ga0373925_0631478_173_754 186
161 3300044706 Ga0466964_0352895 Ga0466964_0352895_98_712 186
162 3300045976 Ga0466967_1118608 Ga0466967_1118608_62_721 186
163 3300046454 Ga0495592_0155308 Ga0495592_0155308_535_1122 186
164 3300046459 Ga0495629_0281534 Ga0495629_0281534_15_596 186
165 3300046462 Ga0495651_0029497 Ga0495651_0029497_2869_3456 186
166 3300046463 Ga0495653_0694281 Ga0495653_0694281_10_597 186
167 3300046529 Ga0495652_0103809 Ga0495652_0103809_1187_1774 186
168 3300046536 Ga0495587_0084546 Ga0495587_0084546_932_1519 186
169 3300046559 Ga0495667_0161665 Ga0495667_0161665_772_1359 186
170 3300046675 Ga0495657_0026856 Ga0495657_0026856_2684_3271 186
171 3300046679 Ga0495623_0080285 Ga0495623_0080285_767_1354 186
172 3300046809 Ga0495600_0040896 Ga0495600_0040896_615_1202 186
173 3300047317 Ga0495604_0028890 Ga0495604_0028890_3333_3920 186
174 3300047322 Ga0495680_0065306 Ga0495680_0065306_1075_1662 186
175 3300047471 Ga0495684_0200251 Ga0495684_0200251_846_1433 186
176 3300048088 Ga0495602_0055724 Ga0495602_0055724_1573_2160 186
177 3300006175 Ga0070712_100148320 Ga0070712_1001483202 187
178 3300025929 Ga0207664_10046601 Ga0207664_100466011 187
179 3300035692 Ga0373935_0114752 Ga0373935_0114752_1026_1637 187
180 3300046536 Ga0495587_0303466 Ga0495587_0303466_35_637 187
181 3300005337 Ga0070682_100594109 Ga0070682_1005941092 188
182 3300005434 Ga0070709_10088077 Ga0070709_100880773 188
183 3300005435 Ga0070714_100368254 Ga0070714_1003682542 188
184 3300005436 Ga0070713_100359548 Ga0070713_1003595482 188
185 3300005437 Ga0070710_10010551 Ga0070710_100105514 188
186 3300005439 Ga0070711_100001007 Ga0070711_1000010078 188
187 3300005468 Ga0070707_100239144 Ga0070707_1002391442 188
188 3300005535 Ga0070684_101131129 Ga0070684_1011311291 188
189 3300005548 Ga0070665_100731901 Ga0070665_1007319012 188
190 3300005614 Ga0068856_100177284 Ga0068856_1001772842 188
191 3300006028 Ga0070717_10065919 Ga0070717_100659194 188
192 3300006028 Ga0070717_10349196 Ga0070717_103491962 188
193 3300006163 Ga0070715_10000339 Ga0070715_100003395 188
194 3300006173 Ga0070716_100011051 Ga0070716_1000110511 188
195 3300006175 Ga0070712_100554596 Ga0070712_1005545962 188
196 3300013105 Ga0157369_10736106 Ga0157369_107361061 188
197 3300020080 Ga0206350_11621167 Ga0206350_116211671 188
198 3300025898 Ga0207692_10006343 Ga0207692_100063432 188
199 3300025905 Ga0207685_10037415 Ga0207685_100374152 188
200 3300025906 Ga0207699_10000686 Ga0207699_100006866 188
201 3300025915 Ga0207693_10007425 Ga0207693_100074257 188
202 3300025915 Ga0207693_10416187 Ga0207693_104161871 188
203 3300025916 Ga0207663_10011474 Ga0207663_100114744 188
204 3300025928 Ga0207700_10025311 Ga0207700_100253113 188
205 3300025929 Ga0207664_10009313 Ga0207664_100093132 188
206 3300025939 Ga0207665_10006773 Ga0207665_100067737 188
207 3300026078 Ga0207702_10508898 Ga0207702_105088982 188
208 3300028379 Ga0268266_10403309 Ga0268266_104033092 188
209 3300028563 Ga0265319_1120494 Ga0265319_11204941 188
210 3300028800 Ga0265338_10094251 Ga0265338_100942513 188
211 3300031240 Ga0265320_10119785 Ga0265320_101197852 188
212 3300031241 Ga0265325_10010612 Ga0265325_100106123 188
213 3300031247 Ga0265340_10228939 Ga0265340_102289391 188
214 3300031344 Ga0265316_10042543 Ga0265316_100425432 188
215 3300031595 Ga0265313_10088039 Ga0265313_100880392 188
216 3300031711 Ga0265314_10032947 Ga0265314_100329474 188
217 3300031730 Ga0307516_10079436 Ga0307516_100794363 188
218 3300035111 Ga0373923_0030418 Ga0373923_0030418_1546_2124 188
219 3300035171 Ga0373946_0328772 Ga0373946_0328772_148_726 188
220 3300035695 Ga0373927_0120162 Ga0373927_0120162_725_1303 188
221 3300035725 Ga0373947_0085254 Ga0373947_0085254_153_749 188
222 3300042016 Ga0439463_002045 Ga0439463_002045_1531_2115 188
223 3300046462 Ga0495651_0180285 Ga0495651_0180285_386_964 188
224 3300046463 Ga0495653_0354147 Ga0495653_0354147_281_859 188
225 3300046472 Ga0495580_0391701 Ga0495580_0391701_194_790 188
226 3300046514 Ga0495618_0066872 Ga0495618_0066872_914_1492 188
227 3300046517 Ga0495630_0251777 Ga0495630_0251777_569_1147 188
228 3300046533 Ga0495640_0142015 Ga0495640_0142015_793_1371 188
229 3300046681 Ga0495647_0254675 Ga0495647_0254675_45_623 188
230 3300047321 Ga0495676_0666805 Ga0495676_0666805_55_633 188
231 3300047471 Ga0495684_0185073 Ga0495684_0185073_303_881 188
232 3300047673 Ga0495593_0074904 Ga0495593_0074904_753_1331 188
233 3300048088 Ga0495602_0090381 Ga0495602_0090381_31_609 188
234 3300048907 Ga0496104_0000404 Ga0496104_0000404_20650_21234 188
235 3300048908 Ga0496105_0025736 Ga0496105_0025736_3981_4565 188
236 3300048911 Ga0496108_0010049 Ga0496108_0010049_6421_7005 188
237 3300048913 Ga0496110_0285749 Ga0496110_0285749_91_675 188
238 3300048915 Ga0496112_0000192 Ga0496112_0000192_17341_17925 188
239 3300048916 Ga0496113_0012330 Ga0496113_0012330_2906_3490 188
240 3300048918 Ga0496115_0058292 Ga0496115_0058292_1201_1785 188
241 3300053077 Ga0495601_0010793 Ga0495601_0010793_1122_1700 188
242 3300005329 Ga0070683_100035577 Ga0070683_1000355773 189
243 3300005337 Ga0070682_100037652 Ga0070682_1000376523 189
244 3300005338 Ga0068868_100149561 Ga0068868_1001495612 189
245 3300005366 Ga0070659_100079788 Ga0070659_1000797883 189
246 3300005434 Ga0070709_10210591 Ga0070709_102105911 189
247 3300005435 Ga0070714_100000816 Ga0070714_10000081611 189
248 3300005435 Ga0070714_100003313 Ga0070714_1000033138 189
249 3300005435 Ga0070714_100004225 Ga0070714_1000042252 189
250 3300005436 Ga0070713_100004504 Ga0070713_10000450410 189
251 3300005436 Ga0070713_100028242 Ga0070713_1000282423 189
252 3300005436 Ga0070713_100065844 Ga0070713_1000658442 189
253 3300005437 Ga0070710_10000845 Ga0070710_100008457 189
254 3300005437 Ga0070710_10167521 Ga0070710_101675212 189
255 3300005439 Ga0070711_100000819 Ga0070711_10000081912 189
256 3300005444 Ga0070694_100070536 Ga0070694_1000705362 189
257 3300005445 Ga0070708_100104622 Ga0070708_1001046222 189
258 3300005445 Ga0070708_100107907 Ga0070708_1001079072 189
259 3300005466 Ga0070685_10011144 Ga0070685_100111443 189
260 3300005467 Ga0070706_100000866 Ga0070706_10000086625 189
261 3300005467 Ga0070706_100001268 Ga0070706_1000012685 189
262 3300005467 Ga0070706_100023901 Ga0070706_1000239012 189
263 3300005467 Ga0070706_100066687 Ga0070706_1000666872 189
264 3300005467 Ga0070706_100119476 Ga0070706_1001194764 189
265 3300005467 Ga0070706_100182466 Ga0070706_1001824663 189
266 3300005467 Ga0070706_100196192 Ga0070706_1001961923 189
267 3300005468 Ga0070707_100035966 Ga0070707_1000359662 189
268 3300005471 Ga0070698_100000317 Ga0070698_10000031742 189
269 3300005471 Ga0070698_100003511 Ga0070698_1000035114 189
270 3300005471 Ga0070698_100014530 Ga0070698_1000145302 189
271 3300005471 Ga0070698_100080267 Ga0070698_1000802672 189
272 3300005518 Ga0070699_100759005 Ga0070699_1007590051 189
273 3300005530 Ga0070679_100190776 Ga0070679_1001907764 189
274 3300005536 Ga0070697_100072204 Ga0070697_1000722043 189
275 3300005536 Ga0070697_100710414 Ga0070697_1007104141 189
276 3300005545 Ga0070695_100045435 Ga0070695_1000454351 189
277 3300005548 Ga0070665_100519476 Ga0070665_1005194761 189
278 3300005549 Ga0070704_100164797 Ga0070704_1001647973 189
279 3300005577 Ga0068857_100074597 Ga0068857_1000745973 189
280 3300005578 Ga0068854_100027007 Ga0068854_1000270071 189
281 3300005615 Ga0070702_100078709 Ga0070702_1000787092 189
282 3300005618 Ga0068864_100066951 Ga0068864_1000669513 189
283 3300005842 Ga0068858_100327682 Ga0068858_1003276822 189
284 3300006028 Ga0070717_10003182 Ga0070717_100031828 189
285 3300006028 Ga0070717_10010846 Ga0070717_100108464 189
286 3300006028 Ga0070717_10013199 Ga0070717_100131995 189
287 3300006028 Ga0070717_10045250 Ga0070717_100452503 189
288 3300006028 Ga0070717_10318275 Ga0070717_103182752 189
289 3300006028 Ga0070717_10340171 Ga0070717_103401712 189
290 3300006173 Ga0070716_100000110 Ga0070716_1000001104 189
291 3300006175 Ga0070712_100003583 Ga0070712_1000035832 189
292 3300007076 Ga0075435_100838974 Ga0075435_1008389742 189
293 3300009148 Ga0105243_10076310 Ga0105243_100763103 189
294 3300009174 Ga0105241_10096385 Ga0105241_100963852 189
295 3300009176 Ga0105242_10125075 Ga0105242_101250753 189
296 3300013102 Ga0157371_10062614 Ga0157371_100626143 189
297 3300021377 Ga0213874_10134357 Ga0213874_101343571 189
298 3300024225 Ga0224572_1018808 Ga0224572_10188082 189
299 3300025898 Ga0207692_10000410 Ga0207692_1000041011 189
300 3300025898 Ga0207692_10094126 Ga0207692_100941262 189
301 3300025901 Ga0207688_10012315 Ga0207688_100123151 189
302 3300025906 Ga0207699_10000348 Ga0207699_100003483 189
303 3300025906 Ga0207699_10572006 Ga0207699_105720061 189
304 3300025910 Ga0207684_10005250 Ga0207684_1000525010 189
305 3300025910 Ga0207684_10033707 Ga0207684_100337074 189
306 3300025910 Ga0207684_10036597 Ga0207684_100365974 189
307 3300025910 Ga0207684_10398321 Ga0207684_103983212 189
308 3300025910 Ga0207684_10426229 Ga0207684_104262291 189
309 3300025911 Ga0207654_10079431 Ga0207654_100794313 189
310 3300025915 Ga0207693_10001598 Ga0207693_1000159810 189
311 3300025916 Ga0207663_10000781 Ga0207663_100007819 189
312 3300025922 Ga0207646_10008867 Ga0207646_100088678 189
313 3300025926 Ga0207659_10038303 Ga0207659_100383035 189
314 3300025928 Ga0207700_10000068 Ga0207700_1000006866 189
315 3300025928 Ga0207700_10009422 Ga0207700_100094225 189
316 3300025928 Ga0207700_10387669 Ga0207700_103876692 189
317 3300025928 Ga0207700_10404182 Ga0207700_104041822 189
318 3300025929 Ga0207664_10002760 Ga0207664_1000276010 189
319 3300025929 Ga0207664_10012700 Ga0207664_100127001 189
320 3300025929 Ga0207664_10017462 Ga0207664_100174623 189
321 3300025939 Ga0207665_10000252 Ga0207665_1000025225 189
322 3300025939 Ga0207665_10016388 Ga0207665_100163883 189
323 3300025944 Ga0207661_10125826 Ga0207661_101258261 189
324 3300026023 Ga0207677_10361700 Ga0207677_103617002 189
325 3300026067 Ga0207678_10030354 Ga0207678_100303543 189
326 3300026116 Ga0207674_10065524 Ga0207674_100655243 189
327 3300028379 Ga0268266_10219916 Ga0268266_102199163 189
328 3300028666 Ga0265336_10001399 Ga0265336_100013992 189
329 3300028800 Ga0265338_10001979 Ga0265338_1000197928 189
330 3300028800 Ga0265338_10009893 Ga0265338_100098937 189
331 3300028800 Ga0265338_10340977 Ga0265338_103409771 189
332 3300029957 Ga0265324_10107910 Ga0265324_101079102 189
333 3300035085 Ga0373929_0024258 Ga0373929_0024258_161_787 189
334 3300035111 Ga0373923_0180817 Ga0373923_0180817_196_777 189
335 3300035117 Ga0373953_0000499 Ga0373953_0000499_3857_4438 189
336 3300035118 Ga0373954_0038601 Ga0373954_0038601_1399_1980 189
337 3300035118 Ga0373954_0077204 Ga0373954_0077204_235_816 189
338 3300035119 Ga0373956_0000507 Ga0373956_0000507_13379_13960 189
339 3300035119 Ga0373956_0013526 Ga0373956_0013526_2292_2873 189
340 3300035120 Ga0373957_0010371 Ga0373957_0010371_2320_2901 189
341 3300035120 Ga0373957_0190961 Ga0373957_0190961_175_756 189
342 3300035172 Ga0373955_0000028 Ga0373955_0000028_48109_48690 189
343 3300035172 Ga0373955_0009103 Ga0373955_0009103_2307_2900 189
344 3300035172 Ga0373955_0151058 Ga0373955_0151058_425_1006 189
345 3300035410 Ga0373924_0009402 Ga0373924_0009402_1224_1805 189
346 3300035410 Ga0373924_0095804 Ga0373924_0095804_148_741 189
347 3300035691 Ga0373931_0479901 Ga0373931_0479901_107_748 189
348 3300035724 Ga0373933_0000004 Ga0373933_0000004_48010_48591 189
349 3300035724 Ga0373933_0027338 Ga0373933_0027338_518_1111 189
350 3300035724 Ga0373933_0242027 Ga0373933_0242027_254_835 189
351 3300036401 Ga0373937_0000012 Ga0373937_0000012_7167_7748 189
352 3300036401 Ga0373937_0007374 Ga0373937_0007374_6842_7423 189
353 3300036401 Ga0373937_0008229 Ga0373937_0008229_1109_1690 189
354 3300036401 Ga0373937_0011548 Ga0373937_0011548_5212_5805 189
355 3300037068 Ga0373925_0004017 Ga0373925_0004017_5786_6367 189
356 3300037853 Ga0436364_1404373 Ga0436364_1404373_3766_4368 189
357 3300037853 Ga0436364_1446560 Ga0436364_1446560_22_609 189
358 3300039450 Ga0436363_0625029 Ga0436363_0625029_170_763 189
359 3300039453 Ga0436362_0743430 Ga0436362_0743430_19_606 189
360 3300046454 Ga0495592_0000183 Ga0495592_0000183_26842_27423 189
361 3300046454 Ga0495592_0009083 Ga0495592_0009083_3500_4093 189
362 3300046462 Ga0495651_0000020 Ga0495651_0000020_71806_72387 189
363 3300046462 Ga0495651_0019984 Ga0495651_0019984_813_1406 189
364 3300046462 Ga0495651_0044435 Ga0495651_0044435_1179_1760 189
365 3300046463 Ga0495653_0000289 Ga0495653_0000289_30328_30909 189
366 3300046463 Ga0495653_0163476 Ga0495653_0163476_283_876 189
367 3300046499 Ga0495594_0021039 Ga0495594_0021039_446_1027 189
368 3300046511 Ga0495608_0000015 Ga0495608_0000015_48038_48619 189
369 3300046511 Ga0495608_0002340 Ga0495608_0002340_11071_11664 189
370 3300046511 Ga0495608_0085740 Ga0495608_0085740_301_882 189
371 3300046516 Ga0495628_0000055 Ga0495628_0000055_39542_40123 189
372 3300046516 Ga0495628_0019080 Ga0495628_0019080_1866_2447 189
373 3300046516 Ga0495628_0226184 Ga0495628_0226184_102_695 189
374 3300046529 Ga0495652_0000074 Ga0495652_0000074_11584_12165 189
375 3300046529 Ga0495652_0013842 Ga0495652_0013842_2075_2668 189
376 3300046529 Ga0495652_0020248 Ga0495652_0020248_2793_3374 189
377 3300046533 Ga0495640_0025208 Ga0495640_0025208_50_643 189
378 3300046536 Ga0495587_0001591 Ga0495587_0001591_6903_7484 189
379 3300046543 Ga0495645_0442117 Ga0495645_0442117_200_793 189
380 3300046559 Ga0495667_0000033 Ga0495667_0000033_95526_96107 189
381 3300046559 Ga0495667_0538483 Ga0495667_0538483_78_668 189
382 3300046642 Ga0495634_0308535 Ga0495634_0308535_126_791 189
383 3300046663 Ga0495635_0495968 Ga0495635_0495968_120_701 189
384 3300046675 Ga0495657_0000097 Ga0495657_0000097_26969_27550 189
385 3300046675 Ga0495657_0011159 Ga0495657_0011159_3058_3651 189
386 3300046675 Ga0495657_0052313 Ga0495657_0052313_638_1219 189
387 3300046675 Ga0495657_0139320 Ga0495657_0139320_773_1354 189
388 3300046678 Ga0495599_0000018 Ga0495599_0000018_48432_49013 189
389 3300046678 Ga0495599_0019364 Ga0495599_0019364_2365_2946 189
390 3300046679 Ga0495623_0000036 Ga0495623_0000036_56122_56703 189
391 3300046679 Ga0495623_0058542 Ga0495623_0058542_983_1564 189
392 3300046679 Ga0495623_0059980 Ga0495623_0059980_250_831 189
393 3300046680 Ga0495646_0039422 Ga0495646_0039422_185_766 189
394 3300046680 Ga0495646_0085645 Ga0495646_0085645_119_715 189
395 3300046809 Ga0495600_0001562 Ga0495600_0001562_4128_4709 189
396 3300046809 Ga0495600_0008342 Ga0495600_0008342_5053_5646 189
397 3300046809 Ga0495600_0047171 Ga0495600_0047171_932_1513 189
398 3300047317 Ga0495604_0000025 Ga0495604_0000025_95260_95841 189
399 3300047317 Ga0495604_0017889 Ga0495604_0017889_4680_5273 189
400 3300047317 Ga0495604_0040138 Ga0495604_0040138_2820_3401 189
401 3300047317 Ga0495604_0073276 Ga0495604_0073276_101_682 189
402 3300047319 Ga0495674_0191495 Ga0495674_0191495_630_1223 189
403 3300047319 Ga0495674_0721221 Ga0495674_0721221_167_748 189
404 3300047322 Ga0495680_0000015 Ga0495680_0000015_95367_95948 189
405 3300047322 Ga0495680_0003684 Ga0495680_0003684_3568_4161 189
406 3300047322 Ga0495680_0085583 Ga0495680_0085583_254_835 189
407 3300047444 Ga0495675_0011313 Ga0495675_0011313_4501_5082 189
408 3300047444 Ga0495675_0069650 Ga0495675_0069650_536_1129 189
409 3300047471 Ga0495684_0013133 Ga0495684_0013133_3508_4101 189
410 3300047471 Ga0495684_0175299 Ga0495684_0175299_561_1142 189
411 3300048088 Ga0495602_0000065 Ga0495602_0000065_95352_95933 189
412 3300048088 Ga0495602_0013041 Ga0495602_0013041_587_1168 189
413 3300048088 Ga0495602_0382627 Ga0495602_0382627_332_928 189
414 3300048905 Ga0496102_0318761 Ga0496102_0318761_702_1292 189
415 3300048916 Ga0496113_0077235 Ga0496113_0077235_614_1240 189
416 3300048918 Ga0496115_0098262 Ga0496115_0098262_566_1192 189
417 3300049581 Ga0501047_0009538 Ga0501047_0009538_4674_5276 189
418 3300050513 nmdc:mga0rr50_696983_c1 nmdc:mga0rr50_696983_c1_205_795 189
419 3300053077 Ga0495601_0301049 Ga0495601_0301049_351_944 189
420 3300053084 Ga0495595_0002119 Ga0495595_0002119_4707_5288 189
421 3300053085 Ga0495619_0220028 Ga0495619_0220028_443_1036 189
422 3300053085 Ga0495619_0236038 Ga0495619_0236038_520_1101 189
423 3300053090 Ga0500646_0000061 Ga0500646_0000061_4903_5538 189
424 3300003659 JGI25404J52841_10034555 JGI25404J52841_100345552 190
425 3300005335 Ga0070666_10057061 Ga0070666_100570611 190
426 3300005339 Ga0070660_100268318 Ga0070660_1002683182 190
427 3300005365 Ga0070688_100352420 Ga0070688_1003524202 190
428 3300005434 Ga0070709_10008315 Ga0070709_100083154 190
429 3300005435 Ga0070714_100040608 Ga0070714_1000406083 190
430 3300005436 Ga0070713_100219723 Ga0070713_1002197233 190
431 3300005436 Ga0070713_100265382 Ga0070713_1002653822 190
432 3300005437 Ga0070710_10124369 Ga0070710_101243692 190
433 3300005438 Ga0070701_10018169 Ga0070701_100181693 190
434 3300005439 Ga0070711_100009684 Ga0070711_1000096847 190
435 3300005439 Ga0070711_100025523 Ga0070711_1000255233 190
436 3300005439 Ga0070711_100232642 Ga0070711_1002326422 190
437 3300005440 Ga0070705_100028799 Ga0070705_1000287993 190
438 3300005445 Ga0070708_100044986 Ga0070708_1000449862 190
439 3300005445 Ga0070708_100132755 Ga0070708_1001327553 190
440 3300005455 Ga0070663_100022299 Ga0070663_1000222993 190
441 3300005456 Ga0070678_100059736 Ga0070678_1000597363 190
442 3300005458 Ga0070681_10226916 Ga0070681_102269162 190
443 3300005468 Ga0070707_100056451 Ga0070707_1000564513 190
444 3300005471 Ga0070698_100010296 Ga0070698_1000102963 190
445 3300005471 Ga0070698_100198667 Ga0070698_1001986672 190
446 3300005518 Ga0070699_100000213 Ga0070699_10000021350 190
447 3300005536 Ga0070697_100003375 Ga0070697_10000337512 190
448 3300005539 Ga0068853_100359218 Ga0068853_1003592182 190
449 3300005546 Ga0070696_100053585 Ga0070696_1000535853 190
450 3300005547 Ga0070693_100043662 Ga0070693_1000436622 190
451 3300005617 Ga0068859_100233302 Ga0068859_1002333021 190
452 3300005834 Ga0068851_10061786 Ga0068851_100617863 190
453 3300005983 Ga0081540_1000356 Ga0081540_100035635 190
454 3300005983 Ga0081540_1001036 Ga0081540_100103616 190
455 3300006028 Ga0070717_10479951 Ga0070717_104799512 190
456 3300006028 Ga0070717_11025752 Ga0070717_110257521 190
457 3300006163 Ga0070715_10035997 Ga0070715_100359972 190
458 3300006163 Ga0070715_10152194 Ga0070715_101521941 190
459 3300006173 Ga0070716_100079824 Ga0070716_1000798241 190
460 3300006175 Ga0070712_100071782 Ga0070712_1000717822 190
461 3300006175 Ga0070712_100082256 Ga0070712_1000822561 190
462 3300006852 Ga0075433_10879805 Ga0075433_108798051 190
463 3300006931 Ga0097620_100233315 Ga0097620_1002333151 190
464 3300009011 Ga0105251_10199601 Ga0105251_101996011 190
465 3300009101 Ga0105247_10062743 Ga0105247_100627433 190
466 3300009177 Ga0105248_10609899 Ga0105248_106098992 190
467 3300009551 Ga0105238_10108612 Ga0105238_101086123 190
468 3300010375 Ga0105239_10738648 Ga0105239_107386481 190
469 3300012483 Ga0157337_1008687 Ga0157337_10086871 190
470 3300013100 Ga0157373_10068066 Ga0157373_100680663 190
471 3300013104 Ga0157370_10156968 Ga0157370_101569683 190
472 3300013297 Ga0157378_10085791 Ga0157378_100857912 190
473 3300013306 Ga0163162_11083760 Ga0163162_110837601 190
474 3300013307 Ga0157372_10916456 Ga0157372_109164562 190
475 3300014326 Ga0157380_10820979 Ga0157380_108209791 190
476 3300014745 Ga0157377_10053980 Ga0157377_100539802 190
477 3300017792 Ga0163161_10196098 Ga0163161_101960981 190
478 3300025898 Ga0207692_10033109 Ga0207692_100331093 190
479 3300025898 Ga0207692_10068382 Ga0207692_100683823 190
480 3300025898 Ga0207692_10128052 Ga0207692_101280522 190
481 3300025906 Ga0207699_10042349 Ga0207699_100423493 190
482 3300025907 Ga0207645_10354582 Ga0207645_103545822 190
483 3300025913 Ga0207695_10494880 Ga0207695_104948801 190
484 3300025914 Ga0207671_10153377 Ga0207671_101533772 190
485 3300025915 Ga0207693_10036715 Ga0207693_100367153 190
486 3300025915 Ga0207693_10792807 Ga0207693_107928071 190
487 3300025916 Ga0207663_10216894 Ga0207663_102168942 190
488 3300025922 Ga0207646_10013433 Ga0207646_100134333 190
489 3300025922 Ga0207646_10076459 Ga0207646_100764593 190
490 3300025922 Ga0207646_10267806 Ga0207646_102678062 190
491 3300025928 Ga0207700_10012259 Ga0207700_100122592 190
492 3300025928 Ga0207700_10028916 Ga0207700_100289163 190
493 3300025928 Ga0207700_10060908 Ga0207700_100609082 190
494 3300025929 Ga0207664_10026482 Ga0207664_100264822 190
495 3300025929 Ga0207664_10044574 Ga0207664_100445743 190
496 3300025932 Ga0207690_10265092 Ga0207690_102650922 190
497 3300025933 Ga0207706_10040701 Ga0207706_100407013 190
498 3300025942 Ga0207689_10007492 Ga0207689_100074926 190
499 3300025960 Ga0207651_10301834 Ga0207651_103018342 190
500 3300026088 Ga0207641_10203088 Ga0207641_102030883 190
501 3300026095 Ga0207676_10140971 Ga0207676_101409712 190
502 3300026118 Ga0207675_100096851 Ga0207675_1000968511 190
503 3300026121 Ga0207683_10004432 Ga0207683_100044326 190
504 3300033545 Ga0316214_1015805 Ga0316214_10158052 190
505 3300034817 Ga0373948_0049758 Ga0373948_0049758_65_706 190
506 3300035083 Ga0373926_0019178 Ga0373926_0019178_343_945 190
507 3300035089 Ga0373944_0006082 Ga0373944_0006082_222_824 190
508 3300035111 Ga0373923_0024468 Ga0373923_0024468_520_1122 190
509 3300035113 Ga0373936_0012587 Ga0373936_0012587_1934_2542 190
510 3300035114 Ga0373939_0067701 Ga0373939_0067701_208_849 190
511 3300035115 Ga0373941_0017037 Ga0373941_0017037_1262_1888 190
512 3300035116 Ga0373945_0005101 Ga0373945_0005101_344_946 190
513 3300035117 Ga0373953_0005118 Ga0373953_0005118_1280_1882 190
514 3300035118 Ga0373954_0011494 Ga0373954_0011494_44_646 190
515 3300035120 Ga0373957_0005818 Ga0373957_0005818_3193_3795 190
516 3300035170 Ga0373943_0133283 Ga0373943_0133283_175_777 190
517 3300035171 Ga0373946_0001672 Ga0373946_0001672_721_1323 190
518 3300035172 Ga0373955_0005298 Ga0373955_0005298_3417_4019 190
519 3300035172 Ga0373955_0010833 Ga0373955_0010833_395_1003 190
520 3300035207 Ga0373942_0048640 Ga0373942_0048640_429_1070 190
521 3300035410 Ga0373924_0004734 Ga0373924_0004734_3608_4210 190
522 3300035692 Ga0373935_0194803 Ga0373935_0194803_113_715 190
523 3300035692 Ga0373935_0366648 Ga0373935_0366648_411_1019 190
524 3300035724 Ga0373933_0105244 Ga0373933_0105244_85_687 190
525 3300035725 Ga0373947_0040507 Ga0373947_0040507_274_876 190
526 3300035725 Ga0373947_0383441 Ga0373947_0383441_77_685 190
527 3300036401 Ga0373937_0020657 Ga0373937_0020657_2227_2829 190
528 3300036401 Ga0373937_0033873 Ga0373937_0033873_3936_4544 190
529 3300036401 Ga0373937_0165860 Ga0373937_0165860_135_737 190
530 3300037068 Ga0373925_0026126 Ga0373925_0026126_191_793 190
531 3300039450 Ga0436363_0943838 Ga0436363_0943838_331_927 190
532 3300045836 Ga0466958_0474182 Ga0466958_0474182_206_799 190
533 3300046454 Ga0495592_0065299 Ga0495592_0065299_1641_2243 190
534 3300046459 Ga0495629_0296574 Ga0495629_0296574_191_793 190
535 3300046461 Ga0495641_0168015 Ga0495641_0168015_88_690 190
536 3300046462 Ga0495651_0097944 Ga0495651_0097944_1250_1858 190
537 3300046462 Ga0495651_0533468 Ga0495651_0533468_10_612 190
538 3300046463 Ga0495653_0094982 Ga0495653_0094982_1518_2126 190
539 3300046472 Ga0495580_0545382 Ga0495580_0545382_88_690 190
540 3300046473 Ga0495582_0008719 Ga0495582_0008719_3131_3733 190
541 3300046475 Ga0495639_0000902 Ga0495639_0000902_12464_13066 190
542 3300046476 Ga0495662_0208756 Ga0495662_0208756_164_766 190
543 3300046499 Ga0495594_0004077 Ga0495594_0004077_2117_2719 190
544 3300046517 Ga0495630_0010186 Ga0495630_0010186_2227_2829 190
545 3300046526 Ga0495666_0081111 Ga0495666_0081111_342_944 190
546 3300046529 Ga0495652_0100972 Ga0495652_0100972_658_1260 190
547 3300046533 Ga0495640_0319741 Ga0495640_0319741_312_914 190
548 3300046535 Ga0495586_0390571 Ga0495586_0390571_32_634 190
549 3300046536 Ga0495587_0370971 Ga0495587_0370971_30_632 190
550 3300046559 Ga0495667_0020210 Ga0495667_0020210_265_867 190
551 3300046559 Ga0495667_0041872 Ga0495667_0041872_876_1484 190
552 3300046642 Ga0495634_0237350 Ga0495634_0237350_327_929 190
553 3300046663 Ga0495635_0028518 Ga0495635_0028518_2105_2713 190
554 3300046663 Ga0495635_0138451 Ga0495635_0138451_388_990 190
555 3300046674 Ga0495588_0007147 Ga0495588_0007147_1570_2172 190
556 3300046675 Ga0495657_0064456 Ga0495657_0064456_402_1010 190
557 3300046678 Ga0495599_0020255 Ga0495599_0020255_3350_3952 190
558 3300046679 Ga0495623_0042094 Ga0495623_0042094_1795_2397 190
559 3300046680 Ga0495646_0088370 Ga0495646_0088370_1009_1617 190
560 3300046680 Ga0495646_0157639 Ga0495646_0157639_269_871 190
561 3300046681 Ga0495647_0022181 Ga0495647_0022181_53_655 190
562 3300046683 Ga0495658_0011799 Ga0495658_0011799_945_1547 190
563 3300046689 Ga0495613_0007035 Ga0495613_0007035_3204_3806 190
564 3300046690 Ga0495624_0019942 Ga0495624_0019942_3478_4080 190
565 3300046809 Ga0495600_0045087 Ga0495600_0045087_191_793 190
566 3300046809 Ga0495600_0095048 Ga0495600_0095048_354_962 190
567 3300047315 Ga0495581_0010471 Ga0495581_0010471_4569_5171 190
568 3300047319 Ga0495674_0515951 Ga0495674_0515951_293_895 190
569 3300047322 Ga0495680_0046315 Ga0495680_0046315_1460_2068 190
570 3300047444 Ga0495675_0004262 Ga0495675_0004262_5342_5944 190
571 3300047673 Ga0495593_0006460 Ga0495593_0006460_3144_3746 190
572 3300048088 Ga0495602_0281591 Ga0495602_0281591_93_695 190
573 3300048904 Ga0496101_0635613 Ga0496101_0635613_50_706 190
574 3300048906 Ga0496103_0021372 Ga0496103_0021372_1342_1968 190
575 3300048907 Ga0496104_0037090 Ga0496104_0037090_2931_3557 190
576 3300048910 Ga0496107_0550520 Ga0496107_0550520_117_743 190
577 3300048912 Ga0496109_0920007 Ga0496109_0920007_89_715 190
578 3300048913 Ga0496110_0131603 Ga0496110_0131603_1550_2176 190
579 3300048917 Ga0496114_0041577 Ga0496114_0041577_2158_2799 190
580 3300050512 nmdc:mga0n895_777854_c1 nmdc:mga0n895_777854_c1_145_786 190
581 3300050513 nmdc:mga0rr50_327242_c1 nmdc:mga0rr50_327242_c1_229_855 190
582 3300050514 nmdc:mga08x19_302606_c1 nmdc:mga08x19_302606_c1_326_952 190
583 3300050515 nmdc:mga0a205_231803_c1 nmdc:mga0a205_231803_c1_174_800 190
584 3300053077 Ga0495601_0015475 Ga0495601_0015475_3350_3952 190

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03551

PadR

Transcriptional regulator PadR-like family

35

107

0.96

PF10400

Vir_act_alpha_C

Virulence activator alpha C-term

119

196

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
5j45-assembly1.cif.gz_A crystal structure of shrub, fly ortholog of snf7/chmp4b 0.7648 94 172
4j9y-assembly1.cif.gz_B calcium-calmodulin complexed with the calmodulin binding domain from a small conductance potassium channel splice variant 0.7452 105 173
4abm-assembly1.cif.gz_A crystal structure of chmp4b hairpin 0.6924 94 172
7o0x-assembly1.cif.gz_C2 cryo-em structure (model_2b) of the rc-dlh complex from gemmatimonas phototrophica at 2.44 a 0.6923 114 180
1urf-assembly1.cif.gz_A hr1b domain from prk1 0.6837 105 180
ID Description Score Start End Superfamily
af_A8JNT7_154_237_1.20.1280.20 Mainly Alpha;Up-down Bundle;Monooxygenase;HscB, C-terminal domain 0.7868 94 163 1.20.1280.20
af_Q2QRM4_178_260_1.20.1280.20 Mainly Alpha;Up-down Bundle;Monooxygenase;HscB, C-terminal domain 0.7716 93 162 1.20.1280.20
4qnhB00 Mainly Alpha;Orthogonal Bundle;Helix Hairpins; 0.7481 105 173 1.10.287.70
3l9fC02 Special;Helix non-globular;Helix Hairpins; 0.7459 93 162 6.10.140.1570
3l9fD02 Special;Helix non-globular;Helix Hairpins; 0.7437 93 162 6.10.140.1570
ID Description Score Start End GO Terms
AF-A0A4Z1I164-F1-model_v4 Thioester reductase (TE) domain-containing protein 0.599 92 190 GO:0004222
GO:0005743
GO:0006515
GO:0034982
GO:0046872
AF-A0A0G1QBU9-F1-model_v4 TrbC/VIRB2 family protein 0.5986 69 178 GO:0016020
AF-A0A0G1QBU9-F1-model_v4 TrbC/VIRB2 family protein 0.5933 69 178 GO:0016020
AF-A0A093WPD8-F1-model_v4 histidine kinase (EC 2.7.13.3) 0.5917 53 178 GO:0000155
GO:0004721
GO:0005886
GO:0016036
AF-A0A226M7U1-F1-model_v4 deleted 0.5819 70 181

Feature Viewer

pLDDT pTM Quality
79.19 0.73 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map