F466339

General Info

Members Datasets Scaffolds Average Seq Length
584 252 584 168

Family's Representative Sequence

Representative Sequence 3300005459|Ga0068867_100203796|Ga0068867_1002037961
Length 197
Sequence MSAMRRRPHPNQDAQKKPEVPAAASAPKNNPISNIRKPIEGIRKFVTRRPAIEEVVHETTSGGIVFRRNQKSNELEILLIKDAKNRWTIPKGHVEEGEEPKDTAEREIREETGLQEMLVRDWLGKVNFRYRRNHTLVLMTMHIYLVQGQGNTDRLHPEDWLSDIQWLPATKAVDSIAYEDIGKLMLLGMKKIRDQKL

Samples

Sample ID Description Type Environment
1 2162886011 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) Metagenome Rhizosphere
2 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
3 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
4 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
5 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
6 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
7 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
8 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
9 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
10 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
11 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
12 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
13 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
14 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
15 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
16 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
17 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
18 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
19 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
20 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
21 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
22 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
23 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
24 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
25 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
26 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
27 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
28 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
29 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
30 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
31 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
32 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
33 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
34 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
35 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
36 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
37 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
38 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
39 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
40 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
41 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
42 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
43 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
44 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
45 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
46 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
47 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
48 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
49 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
50 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
51 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
52 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
53 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
54 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
55 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
56 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
57 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
58 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
59 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
60 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
61 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
62 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
63 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
64 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
65 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
66 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
67 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
68 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
69 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
70 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
71 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
72 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
73 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
74 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
75 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
76 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
77 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
78 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
79 3300009979 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_126 metaG Metagenome Rhizosphere
80 3300009984 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_127 metaG Metagenome Rhizosphere
81 3300009993 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_106 metaG Metagenome Rhizosphere
82 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
83 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
84 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
85 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
86 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
87 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
88 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
89 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
90 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
91 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
92 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
93 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
94 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
95 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
136 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
137 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
138 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
142 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
143 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
144 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
145 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
146 3300030734 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 5 Metagenome Rhizosphere
147 3300030736 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 Metagenome Rhizosphere
148 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
149 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
150 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
151 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
152 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
153 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
154 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
155 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
156 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
157 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
158 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
159 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
160 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
161 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
162 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
163 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
164 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
165 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
166 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
167 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
168 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
169 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
170 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
171 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
172 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
173 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
174 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
175 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
176 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
177 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
178 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
179 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
180 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
181 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
182 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
183 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
184 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
185 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
186 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
187 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
188 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
189 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
190 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
191 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
192 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
193 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
194 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
195 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
196 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
197 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
198 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
199 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
200 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
201 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
202 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
203 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
204 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
205 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
206 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
207 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
208 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
209 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
210 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
211 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
212 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
213 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
214 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
215 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
216 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
217 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
218 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
219 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
220 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
221 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
222 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
223 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
224 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
225 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
226 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
227 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
228 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
229 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
230 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
231 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
232 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
233 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
234 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
235 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
236 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
237 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
238 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
239 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
240 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
241 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
242 3300053143 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 endosphere Metagenome Endosphere
243 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
244 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
245 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
246 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
247 3300053722 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 endosphere Metagenome Endosphere
248 3300053724 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere Metagenome Endosphere
249 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
250 3300053732 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 endosphere Metagenome Endosphere
251 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
252 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 23.63
Nodule 0
Rhizoplane 0.68
Rhizosphere 74.14
Stem 0
Stem Tuber 0
Unclassified 1.54

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 MRS1b_contig_4084217 2162886011 Bacteria 929
2 MBSR1b_contig_1799290 2162886012 Bacteria 856
3 JGI24740J21852_10004913 3300001979 Bacteria 5690
4 JGI24740J21852_10005605 3300001979 Bacteria 5288
5 JGI24740J21852_10015481 3300001979 Bacteria 2783
6 JGI24740J21852_10019351 3300001979 Bacteria 2399
7 JGI24740J21852_10047586 3300001979 Bacteria 1251
8 JGI24739J22299_10005141 3300001989 Bacteria 4982
9 JGI24739J22299_10065986 3300001989 Bacteria 1134
10 JGI24737J22298_10002203 3300001990 Bacteria 6943
11 JGI24743J22301_10000630 3300001991 Bacteria 4295
12 JGI24735J21928_10000075 3300002067 Bacteria 41276
13 JGI24735J21928_10000149 3300002067 Bacteria 24660
14 JGI24738J21930_10001791 3300002075 Bacteria 5840
15 rootH2_10000244 3300003320 Bacteria 697651
16 rootH2_10006847 3300003320 Bacteria 155484
17 rootH2_10206709 3300003320 Unclassified 1173
18 rootH2_10224747 3300003320 Bacteria 1913
19 rootL2_10247150 3300003322 Bacteria 2022
20 rootH1_10311088 3300003323 Bacteria 4960
21 JGI25405J52794_10004809 3300003911 Bacteria 2422
22 JGI25405J52794_10007214 3300003911 Unclassified 2046
23 Ga0065712_10265754 3300005290 Bacteria 927
24 Ga0065715_10099813 3300005293 Bacteria 3366
25 Ga0070658_10000015 3300005327 Bacteria 230579
26 Ga0070658_10000020 3300005327 Bacteria 188851
27 Ga0070658_10000024 3300005327 Bacteria 175873
28 Ga0070658_10006516 3300005327 Bacteria 9470
29 Ga0070658_10034417 3300005327 Bacteria 4075
30 Ga0070658_10059696 3300005327 Bacteria 3106
31 Ga0070658_10143421 3300005327 Bacteria 1996
32 Ga0070676_10006637 3300005328 Bacteria 6195
33 Ga0070676_10239783 3300005328 Bacteria 1205
34 Ga0070676_10295997 3300005328 Bacteria 1095
35 Ga0070683_100000505 3300005329 Bacteria 27371
36 Ga0070683_100010750 3300005329 Bacteria 7874
37 Ga0070683_100428918 3300005329 Bacteria 1261
38 Ga0070683_100810260 3300005329 Bacteria 898
39 Ga0070683_100853205 3300005329 Bacteria 873
40 Ga0070683_101218198 3300005329 Bacteria 723
41 Ga0070670_100738903 3300005331 Bacteria 886
42 Ga0070666_10004519 3300005335 Bacteria 8480
43 Ga0070666_10128410 3300005335 Bacteria 1760
44 Ga0070680_100038020 3300005336 Bacteria 3891
45 Ga0070680_100053143 3300005336 Unclassified 3306
46 Ga0070680_100092015 3300005336 Unclassified 2511
47 Ga0070680_100129715 3300005336 Bacteria 2109
48 Ga0070660_100000316 3300005339 Bacteria 31842
49 Ga0070660_100000346 3300005339 Bacteria 30918
50 Ga0070660_100027199 3300005339 Bacteria 4266
51 Ga0070660_100045343 3300005339 Bacteria 3365
52 Ga0070660_100158272 3300005339 Bacteria 1824
53 Ga0070661_100056640 3300005344 Bacteria 2872
54 Ga0070692_10048571 3300005345 Bacteria 2199
55 Ga0070668_100135648 3300005347 Bacteria 1979
56 Ga0070675_101120741 3300005354 Unclassified 724
57 Ga0070671_100000001 3300005355 Bacteria 1228151
58 Ga0070671_100022194 3300005355 Bacteria 5185
59 Ga0070671_100228642 3300005355 Bacteria 1578
60 Ga0070674_100002912 3300005356 Bacteria 9483
61 Ga0070674_100005409 3300005356 Bacteria 7373
62 Ga0070674_101533982 3300005356 Unclassified 599
63 Ga0070673_100000033 3300005364 Bacteria 60744
64 Ga0070688_100622557 3300005365 Bacteria 828
65 Ga0070659_100099914 3300005366 Bacteria 2334
66 Ga0070659_100115307 3300005366 Bacteria 2171
67 Ga0070659_100359880 3300005366 Bacteria 1222
68 Ga0070659_101706293 3300005366 Unclassified 563
69 Ga0070667_100000001 3300005367 Bacteria 1108638
70 Ga0070667_100281074 3300005367 Bacteria 1494
71 Ga0070678_100000201 3300005456 Bacteria 26383
72 Ga0070662_100009029 3300005457 Bacteria 6502
73 Ga0070681_10000608 3300005458 Bacteria 29517
74 Ga0070681_10111539 3300005458 Bacteria 2674
75 Ga0070681_10143721 3300005458 Bacteria 2315
76 Ga0068867_100203796 3300005459 Bacteria 1585
77 Ga0070685_10000690 3300005466 Bacteria 18276
78 Ga0070685_10003963 3300005466 Bacteria 7482
79 Ga0070699_100829465 3300005518 Unclassified 846
80 Ga0070679_100045653 3300005530 Bacteria 4365
81 Ga0070679_100113775 3300005530 Unclassified 2691
82 Ga0070679_100438440 3300005530 Bacteria 1251
83 Ga0070684_100000049 3300005535 Bacteria 79768
84 Ga0070684_100013686 3300005535 Bacteria 6546
85 Ga0070684_100094775 3300005535 Bacteria 2659
86 Ga0070686_100228546 3300005544 Bacteria 1348
87 Ga0070665_100085636 3300005548 Bacteria 3157
88 Ga0070665_100124630 3300005548 Bacteria 2578
89 Ga0070665_101378630 3300005548 Unclassified 714
90 Ga0068855_100000663 3300005563 Bacteria 41994
91 Ga0068855_100004286 3300005563 Bacteria 17425
92 Ga0068855_100042951 3300005563 Bacteria 5356
93 Ga0068855_100770916 3300005563 Bacteria 1024
94 Ga0068855_101775138 3300005563 Unclassified 627
95 Ga0070664_100003334 3300005564 Bacteria 12978
96 Ga0070664_100277615 3300005564 Bacteria 1510
97 Ga0070664_100728018 3300005564 Bacteria 925
98 Ga0068857_100000441 3300005577 Bacteria 29474
99 Ga0068857_100000829 3300005577 Bacteria 23132
100 Ga0068857_100039775 3300005577 Bacteria 4167
101 Ga0068857_100102988 3300005577 Bacteria 2563
102 Ga0068857_100128291 3300005577 Unclassified 2286
103 Ga0068857_100777493 3300005577 Bacteria 913
104 Ga0068854_100026707 3300005578 Bacteria 3971
105 Ga0068856_100000027 3300005614 Bacteria 133290
106 Ga0068856_100000200 3300005614 Bacteria 63772
107 Ga0068856_100000445 3300005614 Bacteria 45664
108 Ga0068856_100073196 3300005614 Bacteria 3393
109 Ga0068856_100082335 3300005614 Bacteria 3194
110 Ga0068856_100106228 3300005614 Bacteria 2802
111 Ga0068852_100000001 3300005616 Bacteria 716526
112 Ga0068852_100000155 3300005616 Bacteria 45515
113 Ga0068859_100345560 3300005617 Unclassified 1582
114 Ga0068861_100103735 3300005719 Unclassified 2267
115 Ga0068861_100918014 3300005719 Bacteria 830
116 Ga0068858_100918270 3300005842 Unclassified 856
117 Ga0068860_100004772 3300005843 Bacteria 13816
118 Ga0068860_100013616 3300005843 Bacteria 7972
119 Ga0068862_100134154 3300005844 Bacteria 2193
120 Ga0081455_10000001 3300005937 Bacteria 603871
121 Ga0081455_10000008 3300005937 Bacteria 256558
122 Ga0070717_10058886 3300006028 Bacteria 3177
123 Ga0075365_10000001 3300006038 Bacteria 371589
124 Ga0075365_10000009 3300006038 Bacteria 111957
125 Ga0075365_10000014 3300006038 Bacteria 79945
126 Ga0075365_10004786 3300006038 Bacteria 7224
127 Ga0075365_10007875 3300006038 Bacteria 6002
128 Ga0075365_10092905 3300006038 Bacteria 2057
129 Ga0075365_10390927 3300006038 Bacteria 981
130 Ga0075365_10391815 3300006038 Bacteria 980
131 Ga0075368_10002082 3300006042 Bacteria 6462
132 Ga0075363_100019278 3300006048 Bacteria 3409
133 Ga0075363_100112350 3300006048 Bacteria 1515
134 Ga0075364_10002700 3300006051 Bacteria 9968
135 Ga0075364_10003371 3300006051 Bacteria 9072
136 Ga0075364_10064884 3300006051 Unclassified 2397
137 Ga0075364_10137566 3300006051 Bacteria 1642
138 Ga0075364_10214920 3300006051 Bacteria 1304
139 Ga0075364_10271444 3300006051 Unclassified 1154
140 Ga0075362_10000063 3300006177 Bacteria 31783
141 Ga0075367_10000093 3300006178 Bacteria 24511
142 Ga0075367_10008164 3300006178 Bacteria 5409
143 Ga0075367_10078335 3300006178 Bacteria 1996
144 Ga0075367_10261139 3300006178 Bacteria 1087
145 Ga0075367_10287429 3300006178 Unclassified 1034
146 Ga0075369_10000001 3300006186 Bacteria 299616
147 Ga0075369_10000010 3300006186 Bacteria 77564
148 Ga0075369_10039210 3300006186 Bacteria 2023
149 Ga0075369_10042664 3300006186 Bacteria 1945
150 Ga0075366_10000001 3300006195 Bacteria 569172
151 Ga0075366_10001109 3300006195 Bacteria 13248
152 Ga0075366_10001938 3300006195 Bacteria 10463
153 Ga0075366_10010874 3300006195 Bacteria 5120
154 Ga0075366_10019344 3300006195 Bacteria 3939
155 Ga0075366_10056325 3300006195 Bacteria 2335
156 Ga0075366_10169845 3300006195 Bacteria 1323
157 Ga0097621_100000009 3300006237 Bacteria 114089
158 Ga0097621_100558325 3300006237 Bacteria 1043
159 Ga0075370_10031490 3300006353 Bacteria 2961
160 Ga0075370_10081614 3300006353 Bacteria 1859
161 Ga0075370_10103382 3300006353 Bacteria 1650
162 Ga0068871_100000232 3300006358 Bacteria 39467
163 Ga0068871_100234417 3300006358 Bacteria 1594
164 Ga0068871_100506948 3300006358 Unclassified 1088
165 Ga0068871_101099834 3300006358 Unclassified 743
166 Ga0075428_100001999 3300006844 Bacteria 21962
167 Ga0068865_100000307 3300006881 Bacteria 27001
168 Ga0097620_100345553 3300006931 Unclassified 1582
169 Ga0105240_10000003 3300009093 Bacteria 1183681
170 Ga0105240_10000004 3300009093 Bacteria 708156
171 Ga0105240_10000050 3300009093 Bacteria 236144
172 Ga0105240_10001357 3300009093 Bacteria 42000
173 Ga0105240_10002332 3300009093 Bacteria 30702
174 Ga0105240_10118938 3300009093 Bacteria 3184
175 Ga0105240_11323262 3300009093 Unclassified 759
176 Ga0105245_10000002 3300009098 Bacteria 634374
177 Ga0105245_10000200 3300009098 Bacteria 57196
178 Ga0105245_10061919 3300009098 Unclassified 3375
179 Ga0105245_10173800 3300009098 Bacteria 2053
180 Ga0105245_10373504 3300009098 Bacteria 1418
181 Ga0105247_10185438 3300009101 Unclassified 1391
182 Ga0105243_10000001 3300009148 Bacteria 1156578
183 Ga0105243_10032209 3300009148 Unclassified 4048
184 Ga0105241_10000003 3300009174 Bacteria 839043
185 Ga0105241_10000842 3300009174 Bacteria 23254
186 Ga0105241_10082024 3300009174 Bacteria 2527
187 Ga0105241_10263637 3300009174 Bacteria 1465
188 Ga0105241_10448771 3300009174 Bacteria 1140
189 Ga0105242_10000001 3300009176 Bacteria 574039
190 Ga0105242_10002087 3300009176 Bacteria 15739
191 Ga0105242_10013893 3300009176 Bacteria 6231
192 Ga0105248_10201081 3300009177 Bacteria 2245
193 Ga0105248_10434691 3300009177 Bacteria 1478
194 Ga0105248_10789385 3300009177 Bacteria 1072
195 Ga0105248_11612672 3300009177 Bacteria 735
196 Ga0105237_10000001 3300009545 Bacteria 1009213
197 Ga0105237_10000002 3300009545 Bacteria 702357
198 Ga0105237_10009293 3300009545 Bacteria 10533
199 Ga0105237_10044114 3300009545 Bacteria 4490
200 Ga0105237_10061315 3300009545 Bacteria 3761
201 Ga0105237_11130283 3300009545 Unclassified 790
202 Ga0105237_11683392 3300009545 Unclassified 641
203 Ga0105238_10020346 3300009551 Bacteria 6755
204 Ga0105238_10100206 3300009551 Bacteria 2880
205 Ga0105238_10140584 3300009551 Bacteria 2391
206 Ga0105249_10131763 3300009553 Bacteria 2388
207 Ga0105249_10351772 3300009553 Bacteria 1493
208 Ga0105032_100001 3300009979 Bacteria 472394
209 Ga0105032_100020 3300009979 Bacteria 43175
210 Ga0105029_100086 3300009984 Bacteria 4492
211 Ga0105028_100263 3300009993 Bacteria 5723
212 Ga0105239_10001223 3300010375 Bacteria 35012
213 Ga0105239_10031923 3300010375 Bacteria 5787
214 Ga0105239_10038093 3300010375 Bacteria 5268
215 Ga0105239_10039896 3300010375 Bacteria 5143
216 Ga0105239_10610835 3300010375 Bacteria 1244
217 Ga0105239_10853134 3300010375 Bacteria 1044
218 Ga0105246_10010028 3300011119 Bacteria 5845
219 Ga0105246_10014924 3300011119 Bacteria 4896
220 Ga0105246_10052123 3300011119 Bacteria 2811
221 Ga0157373_10000061 3300013100 Bacteria 95718
222 Ga0157373_10043985 3300013100 Bacteria 3188
223 Ga0157373_10094199 3300013100 Bacteria 2109
224 Ga0157373_10104613 3300013100 Unclassified 1991
225 Ga0157373_10936581 3300013100 Bacteria 644
226 Ga0157371_10007527 3300013102 Bacteria 8809
227 Ga0157371_10077928 3300013102 Bacteria 2347
228 Ga0157371_10109435 3300013102 Unclassified 1961
229 Ga0157370_10002357 3300013104 Bacteria 22781
230 Ga0157370_10012318 3300013104 Bacteria 8877
231 Ga0157370_10137441 3300013104 Bacteria 2277
232 Ga0157370_10379496 3300013104 Bacteria 1302
233 Ga0157370_10479916 3300013104 Bacteria 1142
234 Ga0157369_10000029 3300013105 Bacteria 206955
235 Ga0157369_10000151 3300013105 Bacteria 98331
236 Ga0157369_10000190 3300013105 Bacteria 85077
237 Ga0157369_10000567 3300013105 Bacteria 48628
238 Ga0157369_10119188 3300013105 Bacteria 2801
239 Ga0157369_10262848 3300013105 Bacteria 1800
240 Ga0157369_10451879 3300013105 Bacteria 1331
241 Ga0157374_10000073 3300013296 Bacteria 100517
242 Ga0157374_10000096 3300013296 Bacteria 82179
243 Ga0157374_10000389 3300013296 Bacteria 40308
244 Ga0157374_10001423 3300013296 Bacteria 20253
245 Ga0157374_10004073 3300013296 Bacteria 12275
246 Ga0157378_10037888 3300013297 Bacteria 4273
247 Ga0157378_10327382 3300013297 Bacteria 1490
248 Ga0157378_10402379 3300013297 Bacteria 1349
249 Ga0157372_10000002 3300013307 Bacteria 687862
250 Ga0157372_10000086 3300013307 Bacteria 96247
251 Ga0157372_10002447 3300013307 Bacteria 20124
252 Ga0157372_10025726 3300013307 Bacteria 6402
253 Ga0157372_10140272 3300013307 Unclassified 2784
254 Ga0157372_10257262 3300013307 Bacteria 2027
255 Ga0157375_10074210 3300013308 Bacteria 3422
256 Ga0157375_10640535 3300013308 Bacteria 1220
257 Ga0157375_11044856 3300013308 Bacteria 955
258 Ga0157375_11161074 3300013308 Unclassified 905
259 Ga0163163_10251669 3300014325 Bacteria 1817
260 Ga0157377_10000920 3300014745 Bacteria 12288
261 Ga0157377_10001177 3300014745 Bacteria 11110
262 Ga0157377_10622027 3300014745 Unclassified 773
263 Ga0157376_10000001 3300014969 Bacteria 842910
264 Ga0157376_10000027 3300014969 Bacteria 204157
265 Ga0157376_10945670 3300014969 Bacteria 882
266 Ga0207697_10044198 3300025315 Bacteria 1832
267 Ga0207710_10095235 3300025900 Unclassified 1398
268 Ga0207680_10096370 3300025903 Unclassified 1892
269 Ga0207680_10197512 3300025903 Unclassified 1369
270 Ga0207647_10001245 3300025904 Bacteria 19575
271 Ga0207699_10144502 3300025906 Bacteria 1567
272 Ga0207645_10038847 3300025907 Bacteria 3051
273 Ga0207645_10236498 3300025907 Bacteria 1206
274 Ga0207645_10286483 3300025907 Bacteria 1095
275 Ga0207705_10000011 3300025909 Bacteria 517768
276 Ga0207705_10000047 3300025909 Bacteria 175887
277 Ga0207705_10000115 3300025909 Bacteria 89955
278 Ga0207705_10074336 3300025909 Bacteria 2467
279 Ga0207705_10090408 3300025909 Bacteria 2241
280 Ga0207705_10112718 3300025909 Bacteria 2011
281 Ga0207705_10432439 3300025909 Bacteria 1020
282 Ga0207654_10000002 3300025911 Bacteria 1460142
283 Ga0207654_10002956 3300025911 Bacteria 8617
284 Ga0207654_10047071 3300025911 Bacteria 2462
285 Ga0207654_10157340 3300025911 Bacteria 1464
286 Ga0207707_10025748 3300025912 Bacteria 5145
287 Ga0207695_10000005 3300025913 Bacteria 1196715
288 Ga0207695_10000009 3300025913 Bacteria 1034276
289 Ga0207695_10000158 3300025913 Bacteria 201891
290 Ga0207695_10072681 3300025913 Bacteria 3507
291 Ga0207695_10076332 3300025913 Bacteria 3406
292 Ga0207695_10247811 3300025913 Bacteria 1681
293 Ga0207671_10000003 3300025914 Bacteria 1065461
294 Ga0207671_10000008 3300025914 Bacteria 798229
295 Ga0207671_10003661 3300025914 Bacteria 15170
296 Ga0207671_10033531 3300025914 Bacteria 3818
297 Ga0207660_10020375 3300025917 Bacteria 4448
298 Ga0207660_10055049 3300025917 Bacteria 2841
299 Ga0207660_10057958 3300025917 Unclassified 2776
300 Ga0207657_10000712 3300025919 Bacteria 35358
301 Ga0207657_10002562 3300025919 Bacteria 19664
302 Ga0207657_10011048 3300025919 Bacteria 8976
303 Ga0207657_10038978 3300025919 Bacteria 4225
304 Ga0207657_10430137 3300025919 Bacteria 1037
305 Ga0207652_10041373 3300025921 Unclassified 3917
306 Ga0207652_10161876 3300025921 Bacteria 2006
307 Ga0207694_10088559 3300025924 Bacteria 2440
308 Ga0207694_10112347 3300025924 Bacteria 2168
309 Ga0207659_10091373 3300025926 Bacteria 2274
310 Ga0207687_10000001 3300025927 Bacteria 1130810
311 Ga0207687_10000004 3300025927 Bacteria 841177
312 Ga0207687_10001932 3300025927 Bacteria 14250
313 Ga0207687_10075495 3300025927 Unclassified 2419
314 Ga0207687_10209830 3300025927 Bacteria 1527
315 Ga0207644_10000001 3300025931 Bacteria 1243214
316 Ga0207644_10022204 3300025931 Bacteria 4334
317 Ga0207690_10002652 3300025932 Bacteria 10785
318 Ga0207690_10125620 3300025932 Unclassified 1870
319 Ga0207706_10000073 3300025933 Bacteria 103803
320 Ga0207686_10000001 3300025934 Bacteria 1169580
321 Ga0207686_10061860 3300025934 Unclassified 2375
322 Ga0207709_10000002 3300025935 Bacteria 1171536
323 Ga0207709_10049943 3300025935 Unclassified 2555
324 Ga0207670_11398663 3300025936 Unclassified 594
325 Ga0207669_10006666 3300025937 Bacteria 5292
326 Ga0207669_10024885 3300025937 Bacteria 3225
327 Ga0207704_10001468 3300025938 Bacteria 10545
328 Ga0207711_10135448 3300025941 Bacteria 2212
329 Ga0207661_10000077 3300025944 Bacteria 67190
330 Ga0207661_10000129 3300025944 Bacteria 47940
331 Ga0207661_10002445 3300025944 Bacteria 12778
332 Ga0207679_10000124 3300025945 Bacteria 63038
333 Ga0207679_10316443 3300025945 Bacteria 1350
334 Ga0207679_10507067 3300025945 Unclassified 1077
335 Ga0207679_10844895 3300025945 Unclassified 836
336 Ga0207667_10000003 3300025949 Bacteria 822935
337 Ga0207667_10000756 3300025949 Bacteria 42002
338 Ga0207667_10004357 3300025949 Bacteria 17337
339 Ga0207667_10062876 3300025949 Bacteria 3880
340 Ga0207667_10195280 3300025949 Unclassified 2076
341 Ga0207667_10280915 3300025949 Bacteria 1701
342 Ga0207651_10000141 3300025960 Bacteria 31367
343 Ga0207712_10003874 3300025961 Bacteria 9451
344 Ga0207712_10309436 3300025961 Bacteria 1299
345 Ga0207668_10121136 3300025972 Bacteria 1981
346 Ga0207668_11427994 3300025972 Bacteria 624
347 Ga0207640_10019721 3300025981 Bacteria 3989
348 Ga0207658_10000003 3300025986 Bacteria 1151934
349 Ga0207703_10508632 3300026035 Bacteria 1131
350 Ga0207639_10011466 3300026041 Bacteria 6157
351 Ga0207702_10000015 3300026078 Bacteria 250830
352 Ga0207702_10000034 3300026078 Bacteria 164965
353 Ga0207702_10000057 3300026078 Bacteria 131118
354 Ga0207702_10000739 3300026078 Bacteria 34921
355 Ga0207702_10061822 3300026078 Bacteria 3196
356 Ga0207702_10681970 3300026078 Bacteria 1012
357 Ga0207674_10000439 3300026116 Bacteria 53818
358 Ga0207674_10000878 3300026116 Bacteria 39325
359 Ga0207674_10119816 3300026116 Bacteria 2600
360 Ga0207674_10143475 3300026116 Bacteria 2347
361 Ga0207674_10149562 3300026116 Bacteria 2292
362 Ga0207674_10259094 3300026116 Bacteria 1686
363 Ga0207674_11305110 3300026116 Unclassified 695
364 Ga0207683_10030359 3300026121 Bacteria 4684
365 Ga0207698_10000001 3300026142 Bacteria 625389
366 Ga0207698_10000048 3300026142 Bacteria 90201
367 Ga0207698_11249590 3300026142 Bacteria 757
368 Ga0209998_10043572 3300027717 Bacteria 1024
369 Ga0209813_10000335 3300027866 Bacteria 12250
370 Ga0207428_10083905 3300027907 Bacteria 2483
371 Ga0268266_10021620 3300028379 Bacteria 5480
372 Ga0268265_11072907 3300028380 Bacteria 798
373 Ga0268264_10007105 3300028381 Bacteria 9383
374 Ga0265337_1014219 3300028556 Unclassified 2644
375 Ga0265319_1056368 3300028563 Bacteria 1284
376 Ga0265334_10000106 3300028573 Bacteria 55987
377 Ga0265338_10000181 3300028800 Bacteria 117792
378 Ga0265338_10000625 3300028800 Bacteria 61650
379 Ga0265338_10052669 3300028800 Bacteria 3649
380 Ga0314311_1122390 3300030733 Bacteria 4613
381 Ga0316179_1064424 3300030734 Bacteria 12008
382 Ga0316180_1071123 3300030736 Bacteria 1944
383 Ga0316183_1041045 3300030742 Bacteria 1390
384 Ga0316183_1192095 3300030742 Bacteria 16108
385 Ga0316181_1019399 3300030744 Bacteria 3114
386 Ga0316182_1017501 3300030745 Bacteria 11122
387 Ga0316182_1175280 3300030745 Bacteria 2574
388 Ga0316182_1326517 3300030745 Bacteria 4444
389 Ga0316182_1396058 3300030745 Bacteria 6284
390 Ga0265340_10000445 3300031247 Bacteria 22294
391 Ga0265327_10000017 3300031251 Bacteria 445264
392 Ga0265327_10035518 3300031251 Bacteria 2753
393 Ga0265342_10121422 3300031712 Bacteria 1471
394 Ga0307516_10008182 3300031730 Bacteria 11877
395 Ga0307405_10051169 3300031731 Unclassified 2562
396 Ga0307412_10122601 3300031911 Bacteria 1874
397 Ga0395899_0013685 3300037312 Bacteria 6202
398 Ga0395899_0039022 3300037312 Bacteria 3556
399 Ga0395899_0144552 3300037312 Bacteria 1690
400 Ga0395900_0000001 3300037418 Bacteria 931146
401 Ga0395900_0002513 3300037418 Bacteria 20134
402 Ga0395900_0010811 3300037418 Bacteria 9337
403 Ga0395900_0035071 3300037418 Bacteria 5167
404 Ga0395900_0138321 3300037418 Bacteria 2495
405 Ga0395900_0155063 3300037418 Bacteria 2339
406 Ga0395900_0475537 3300037418 Bacteria 1203
407 Ga0395898_0000002 3300037466 Bacteria 931013
408 Ga0395898_0025806 3300037466 Bacteria 5917
409 Ga0395898_0038857 3300037466 Unclassified 4714
410 Ga0395898_0165359 3300037466 Unclassified 2116
411 Ga0395905_0002429 3300037471 Bacteria 20672
412 Ga0395905_0019326 3300037471 Bacteria 6459
413 Ga0395905_0055986 3300037471 Unclassified 3691
414 Ga0395905_0309971 3300037471 Bacteria 1467
415 Ga0395901_0000006 3300038443 Bacteria 514112
416 Ga0395901_0006327 3300038443 Bacteria 11992
417 Ga0395901_0010187 3300038443 Bacteria 9524
418 Ga0395901_0032625 3300038443 Bacteria 5371
419 Ga0395901_0132250 3300038443 Bacteria 2622
420 Ga0439461_0002738 3300041410 Bacteria 2848
421 Ga0451853_0102201 3300041512 Bacteria 559
422 Ga0451853_0725875 3300041512 Bacteria 703
423 Ga0439445_0005738 3300042004 Bacteria 2836
424 Ga0439448_0214674 3300042005 Bacteria 676
425 Ga0439432_007573 3300042006 Bacteria 3842
426 Ga0450920_000808 3300042122 Bacteria 5051
427 Ga0450906_005983 3300042145 Bacteria 2476
428 Ga0439446_0000001 3300042156 Bacteria 275840
429 Ga0450909_001971 3300042185 Bacteria 2897
430 Ga0439464_0000130 3300042439 Bacteria 11960
431 Ga0439464_0036928 3300042439 Bacteria 1384
432 Ga0450918_000617 3300042531 Bacteria 7630
433 Ga0466970_0123694 3300044765 Bacteria 1418
434 Ga0495629_0298073 3300046459 Bacteria 1104
435 Ga0495638_0000132 3300046460 Bacteria 120039
436 Ga0495638_0000551 3300046460 Bacteria 42775
437 Ga0495582_0056117 3300046473 Bacteria 2171
438 Ga0495597_0030047 3300046542 Bacteria 2478
439 Ga0495622_0000502 3300046557 Bacteria 24435
440 Ga0495634_0096185 3300046642 Bacteria 1918
441 Ga0495588_0000171 3300046674 Bacteria 83176
442 Ga0495658_0000641 3300046683 Bacteria 18915
443 Ga0495671_0065105 3300046692 Bacteria 1794
444 Ga0495671_0269845 3300046692 Unclassified 820
445 Ga0495600_0008925 3300046809 Bacteria 6175
446 Ga0495660_0000005 3300046810 Bacteria 574567
447 Ga0495672_0000694 3300047320 Bacteria 37308
448 Ga0495676_0745076 3300047321 Bacteria 633
449 Ga0495681_0201217 3300047470 Bacteria 808
450 Ga0495686_0005549 3300047472 Bacteria 9924
451 Ga0495686_0159155 3300047472 Bacteria 1321
452 Ga0495593_0109795 3300047673 Bacteria 1409
453 Ga0495615_0092397 3300048090 Bacteria 845
454 Ga0496100_0017761 3300048903 Bacteria 4208
455 Ga0496104_0574219 3300048907 Bacteria 1038
456 Ga0496112_0072167 3300048915 Bacteria 3412
457 Ga0496113_0025550 3300048916 Bacteria 4212
458 Ga0501031_0002442 3300049568 Bacteria 11833
459 Ga0501032_0000624 3300049569 Bacteria 28751
460 Ga0501033_0421571 3300049570 Bacteria 929
461 Ga0501034_0000028 3300049571 Bacteria 255803
462 Ga0501034_0006453 3300049571 Bacteria 12628
463 Ga0501034_0009503 3300049571 Bacteria 10178
464 Ga0501034_0868664 3300049571 Bacteria 791
465 Ga0501036_0001666 3300049572 Bacteria 17221
466 Ga0501037_0000001 3300049573 Bacteria 753276
467 Ga0501037_0000031 3300049573 Bacteria 133137
468 Ga0501038_0070790 3300049574 Bacteria 2960
469 Ga0501043_0000366 3300049579 Bacteria 40919
470 Ga0501046_0000138 3300049580 Bacteria 77052
471 Ga0501047_0000032 3300049581 Bacteria 208294
472 Ga0501048_0000013 3300049582 Bacteria 76554
473 Ga0501068_0341900 3300049584 Bacteria 961
474 Ga0501070_0081893 3300049586 Bacteria 2671
475 Ga0501073_0037892 3300049589 Bacteria 3422
476 Ga0501073_0282905 3300049589 Bacteria 1144
477 Ga0501234_003057 3300049707 Bacteria 2628
478 Ga0501083_0011227 3300049744 Bacteria 6286
479 Ga0501083_0025578 3300049744 Bacteria 4086
480 Ga0501035_0000799 3300049822 Bacteria 33519
481 Ga0501044_0037308 3300049823 Bacteria 5081
482 nmdc:mga03683_32384_c1 3300050489 Bacteria 2103
483 nmdc:mga03683_42674_c2 3300050489 Unclassified 562
484 nmdc:mga03683_80_c1 3300050489 Bacteria 35991
485 nmdc:mga00v17_120_c1 3300050491 Bacteria 46472
486 nmdc:mga00v17_162499_c1 3300050491 Bacteria 1438
487 nmdc:mga00v17_177221_c1 3300050491 Bacteria 1375
488 nmdc:mga00v17_2630_c1 3300050491 Bacteria 8611
489 nmdc:mga00v17_293530_c1 3300050491 Bacteria 1056
490 nmdc:mga00v17_3801_c1 3300050491 Bacteria 5606
491 nmdc:mga00v17_461019_c1 3300050491 Unclassified 825
492 nmdc:mga00v17_5335_c1 3300050491 Bacteria 6314
493 nmdc:mga00v17_56476_c1 3300050491 Unclassified 2400
494 nmdc:mga0yw44_112386_c1 3300050492 Bacteria 1747
495 nmdc:mga0yw44_128525_c1 3300050492 Bacteria 1638
496 nmdc:mga0yw44_16_c1 3300050492 Bacteria 80085
497 nmdc:mga0yw44_1_c1 3300050492 Bacteria 702221
498 nmdc:mga0yw44_21337_c1 3300050492 Bacteria 3611
499 nmdc:mga0yw44_2_c1 3300050492 Bacteria 586884
500 nmdc:mga0yw44_3147_c1 3300050492 Bacteria 7247
501 nmdc:mga0yw44_4_c1 3300050492 Bacteria 450247
502 nmdc:mga0yw44_523976_c1 3300050492 Bacteria 804
503 nmdc:mga0yw44_703768_c1 3300050492 Unclassified 686
504 nmdc:mga0yw44_84798_c1 3300050492 Unclassified 1992
505 nmdc:mga0k408_118_c1 3300050493 Bacteria 11075
506 nmdc:mga0k408_159617_c1 3300050493 Bacteria 1343
507 nmdc:mga0k408_1_c1 3300050493 Bacteria 1089059
508 nmdc:mga0k408_214_c1 3300050493 Bacteria 31125
509 nmdc:mga0k408_2889_c1 3300050493 Bacteria 9112
510 nmdc:mga0k408_3696_c1 3300050493 Bacteria 7332
511 nmdc:mga0k408_3708_c1 3300050493 Bacteria 8095
512 nmdc:mga0k408_4209_c3 3300050493 Bacteria 2379
513 nmdc:mga06z11_127_c1 3300050494 Bacteria 25603
514 nmdc:mga06z11_198_c1 3300050494 Bacteria 24266
515 nmdc:mga06z11_249319_c1 3300050494 Unclassified 1045
516 nmdc:mga06z11_58210_c1 3300050494 Bacteria 2004
517 nmdc:mga06z11_728833_c1 3300050494 Unclassified 604
518 nmdc:mga04h51_202516_c1 3300050495 Bacteria 780
519 nmdc:mga04h51_251_c1 3300050495 Bacteria 14040
520 nmdc:mga07m45_10022_c1 3300050496 Bacteria 4932
521 nmdc:mga07m45_148205_c1 3300050496 Bacteria 1360
522 nmdc:mga07m45_248674_c1 3300050496 Bacteria 1035
523 nmdc:mga08y16_5295_c1 3300050511 Bacteria 13491
524 nmdc:mga0sz30_13016_c1 3300050516 Bacteria 3248
525 nmdc:mga0sz30_1978_c2 3300050516 Bacteria 2048
526 nmdc:mga0sz30_1_c1 3300050516 Bacteria 796501
527 nmdc:mga0sz30_256333_c1 3300050516 Unclassified 779
528 nmdc:mga0sz30_3_c9 3300050516 Bacteria 81468
529 Ga0500610_0051662 3300053079 Unclassified 2141
530 Ga0500643_000022 3300053087 Bacteria 277519
531 Ga0500643_000148 3300053087 Bacteria 71560
532 Ga0500643_003568 3300053087 Bacteria 7402
533 Ga0500644_0001037 3300053088 Bacteria 8346
534 Ga0500644_0007239 3300053088 Bacteria 2883
535 Ga0500644_0012144 3300053088 Bacteria 2374
536 Ga0500644_0472856 3300053088 Unclassified 550
537 Ga0500646_0000007 3300053090 Bacteria 115744
538 Ga0500646_0000805 3300053090 Bacteria 8705
539 Ga0500646_0046835 3300053090 Bacteria 1235
540 Ga0500583_0000082 3300053092 Bacteria 54810
541 Ga0500583_0011114 3300053092 Bacteria 3378
542 Ga0500583_0014634 3300053092 Bacteria 3079
543 Ga0500583_0015409 3300053092 Bacteria 3023
544 Ga0500583_0291472 3300053092 Bacteria 800
545 Ga0500651_0000191 3300053093 Bacteria 39269
546 Ga0500651_0009366 3300053093 Bacteria 5812
547 Ga0500651_0287179 3300053093 Unclassified 947
548 Ga0500566_0000001 3300053094 Bacteria 1101031
549 Ga0500641_0000001 3300053096 Bacteria 1115973
550 Ga0500650_0000001 3300053098 Bacteria 818797
551 Ga0500555_000001 3300053103 Bacteria 1353713
552 Ga0500555_000009 3300053103 Bacteria 263998
553 Ga0500562_009692 3300053108 Bacteria 2435
554 Ga0500569_000018 3300053109 Bacteria 42775
555 Ga0500594_0000001 3300053118 Bacteria 1178472
556 Ga0500614_000001 3300053123 Bacteria 1274484
557 Ga0500614_002185 3300053123 Unclassified 4442
558 Ga0500642_0016865 3300053130 Bacteria 2785
559 Ga0500652_000001 3300053131 Bacteria 946868
560 Ga0500652_136312 3300053131 Bacteria 1023
561 Ga0500655_001617 3300053133 Bacteria 4244
562 Ga0500559_0006860 3300053136 Bacteria 5104
563 Ga0500568_0031933 3300053139 Bacteria 2168
564 Ga0500577_0000528 3300053142 Bacteria 9883
565 Ga0500577_0014179 3300053142 Bacteria 2456
566 Ga0500577_0054346 3300053142 Bacteria 1517
567 Ga0500579_000781 3300053143 Bacteria 18261
568 Ga0500588_0000752 3300053146 Bacteria 5553
569 Ga0500589_000013 3300053147 Bacteria 109118
570 Ga0500589_025605 3300053147 Bacteria 2734
571 Ga0500589_202833 3300053147 Bacteria 760
572 Ga0500604_0014397 3300053151 Bacteria 2154
573 Ga0500604_0049606 3300053151 Bacteria 1291
574 Ga0500616_0000005 3300053153 Bacteria 961725
575 Ga0500616_0000012 3300053153 Bacteria 681798
576 Ga0500616_0015635 3300053153 Bacteria 4334
577 Ga0500616_0025837 3300053153 Bacteria 3256
578 Ga0500649_000004 3300053722 Bacteria 139374
579 Ga0500570_008150 3300053724 Bacteria 5773
580 Ga0500570_070171 3300053724 Bacteria 1639
581 Ga0500611_004452 3300053727 Bacteria 1891
582 Ga0500656_002995 3300053732 Bacteria 1558
583 Ga0590077_054771 3300059426 Bacteria 899
584 Ga0501082_0152578 3300060353 Bacteria 2007

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005336 Ga0070680_100129715 Ga0070680_1001297152 148
2 3300005458 Ga0070681_10143721 Ga0070681_101437213 148
3 3300005530 Ga0070679_100045653 Ga0070679_1000456533 148
4 3300025917 Ga0207660_10055049 Ga0207660_100550493 148
5 3300025921 Ga0207652_10161876 Ga0207652_101618763 148
6 3300025927 Ga0207687_10000004 Ga0207687_10000004768 148
7 3300037312 Ga0395899_0013685 Ga0395899_0013685_1683_2186 148
8 3300037418 Ga0395900_0010811 Ga0395900_0010811_2692_3195 148
9 3300037466 Ga0395898_0038857 Ga0395898_0038857_591_1094 148
10 3300037471 Ga0395905_0055986 Ga0395905_0055986_1989_2492 148
11 3300038443 Ga0395901_0032625 Ga0395901_0032625_215_718 148
12 3300003911 JGI25405J52794_10007214 JGI25405J52794_100072143 149
13 3300005327 Ga0070658_10000015 Ga0070658_10000015176 149
14 3300005327 Ga0070658_10034417 Ga0070658_100344174 149
15 3300005336 Ga0070680_100053143 Ga0070680_1000531435 149
16 3300005339 Ga0070660_100000346 Ga0070660_10000034616 149
17 3300005339 Ga0070660_100027199 Ga0070660_1000271992 149
18 3300005366 Ga0070659_100359880 Ga0070659_1003598802 149
19 3300005530 Ga0070679_100113775 Ga0070679_1001137752 149
20 3300005614 Ga0068856_100106228 Ga0068856_1001062285 149
21 3300005937 Ga0081455_10000008 Ga0081455_1000000810 149
22 3300013296 Ga0157374_10000389 Ga0157374_1000038940 149
23 3300013307 Ga0157372_10140272 Ga0157372_101402723 149
24 3300014745 Ga0157377_10001177 Ga0157377_1000117714 149
25 3300025909 Ga0207705_10000011 Ga0207705_10000011170 149
26 3300025909 Ga0207705_10090408 Ga0207705_100904082 149
27 3300025917 Ga0207660_10057958 Ga0207660_100579583 149
28 3300025919 Ga0207657_10000712 Ga0207657_100007124 149
29 3300025919 Ga0207657_10038978 Ga0207657_100389786 149
30 3300025921 Ga0207652_10041373 Ga0207652_100413733 149
31 3300031251 Ga0265327_10000017 Ga0265327_100000176 149
32 3300031251 Ga0265327_10035518 Ga0265327_100355185 149
33 3300037418 Ga0395900_0002513 Ga0395900_0002513_16654_17157 149
34 3300037418 Ga0395900_0035071 Ga0395900_0035071_1757_2263 149
35 3300037418 Ga0395900_0155063 Ga0395900_0155063_329_832 149
36 3300037466 Ga0395898_0025806 Ga0395898_0025806_3085_3591 149
37 3300037466 Ga0395898_0165359 Ga0395898_0165359_85_588 149
38 3300037471 Ga0395905_0002429 Ga0395905_0002429_14184_14690 149
39 3300037471 Ga0395905_0309971 Ga0395905_0309971_872_1375 149
40 3300038443 Ga0395901_0010187 Ga0395901_0010187_4587_5090 149
41 3300049568 Ga0501031_0002442 Ga0501031_0002442_9091_9591 149
42 3300049569 Ga0501032_0000624 Ga0501032_0000624_3980_4480 149
43 3300049570 Ga0501033_0421571 Ga0501033_0421571_184_684 149
44 3300049571 Ga0501034_0006453 Ga0501034_0006453_10376_10876 149
45 3300049572 Ga0501036_0001666 Ga0501036_0001666_3120_3620 149
46 3300049573 Ga0501037_0000031 Ga0501037_0000031_114888_115388 149
47 3300049579 Ga0501043_0000366 Ga0501043_0000366_10561_11061 149
48 3300049580 Ga0501046_0000138 Ga0501046_0000138_3356_3856 149
49 3300049581 Ga0501047_0000032 Ga0501047_0000032_35035_35535 149
50 3300049582 Ga0501048_0000013 Ga0501048_0000013_42622_43122 149
51 3300049584 Ga0501068_0341900 Ga0501068_0341900_67_567 149
52 3300049586 Ga0501070_0081893 Ga0501070_0081893_1962_2462 149
53 3300049589 Ga0501073_0037892 Ga0501073_0037892_2687_3187 149
54 3300049744 Ga0501083_0025578 Ga0501083_0025578_2204_2704 149
55 3300049822 Ga0501035_0000799 Ga0501035_0000799_24096_24596 149
56 3300049823 Ga0501044_0037308 Ga0501044_0037308_1353_1853 149
57 3300060353 Ga0501082_0152578 Ga0501082_0152578_504_1004 149
58 3300001979 JGI24740J21852_10005605 JGI24740J21852_100056053 150
59 3300001979 JGI24740J21852_10047586 JGI24740J21852_100475861 150
60 3300002067 JGI24735J21928_10000075 JGI24735J21928_1000007537 150
61 3300003320 rootH2_10000244 rootH2_10000244538 150
62 3300005328 Ga0070676_10239783 Ga0070676_102397832 150
63 3300005329 Ga0070683_100000505 Ga0070683_1000005057 150
64 3300005329 Ga0070683_100428918 Ga0070683_1004289181 150
65 3300005331 Ga0070670_100738903 Ga0070670_1007389031 150
66 3300005335 Ga0070666_10004519 Ga0070666_1000451910 150
67 3300005335 Ga0070666_10128410 Ga0070666_101284104 150
68 3300005336 Ga0070680_100038020 Ga0070680_1000380204 150
69 3300005336 Ga0070680_100092015 Ga0070680_1000920152 150
70 3300005354 Ga0070675_101120741 Ga0070675_1011207411 150
71 3300005355 Ga0070671_100000001 Ga0070671_100000001650 150
72 3300005356 Ga0070674_101533982 Ga0070674_1015339821 150
73 3300005366 Ga0070659_101706293 Ga0070659_1017062931 150
74 3300005367 Ga0070667_100000001 Ga0070667_100000001612 150
75 3300005458 Ga0070681_10111539 Ga0070681_101115394 150
76 3300005530 Ga0070679_100438440 Ga0070679_1004384402 150
77 3300005535 Ga0070684_100013686 Ga0070684_1000136866 150
78 3300005563 Ga0068855_100042951 Ga0068855_1000429517 150
79 3300005563 Ga0068855_100770916 Ga0068855_1007709162 150
80 3300005577 Ga0068857_100102988 Ga0068857_1001029882 150
81 3300005614 Ga0068856_100000445 Ga0068856_10000044551 150
82 3300005617 Ga0068859_100345560 Ga0068859_1003455604 150
83 3300005719 Ga0068861_100103735 Ga0068861_1001037354 150
84 3300005719 Ga0068861_100918014 Ga0068861_1009180142 150
85 3300005843 Ga0068860_100004772 Ga0068860_10000477215 150
86 3300006038 Ga0075365_10000009 Ga0075365_1000000967 150
87 3300006038 Ga0075365_10390927 Ga0075365_103909272 150
88 3300006048 Ga0075363_100112350 Ga0075363_1001123502 150
89 3300006051 Ga0075364_10003371 Ga0075364_100033715 150
90 3300006051 Ga0075364_10064884 Ga0075364_100648844 150
91 3300006051 Ga0075364_10214920 Ga0075364_102149202 150
92 3300006177 Ga0075362_10000063 Ga0075362_1000006320 150
93 3300006178 Ga0075367_10000093 Ga0075367_1000009321 150
94 3300006178 Ga0075367_10261139 Ga0075367_102611392 150
95 3300006178 Ga0075367_10287429 Ga0075367_102874292 150
96 3300006186 Ga0075369_10000001 Ga0075369_1000000110 150
97 3300006186 Ga0075369_10000010 Ga0075369_100000106 150
98 3300006195 Ga0075366_10000001 Ga0075366_10000001561 150
99 3300006195 Ga0075366_10001109 Ga0075366_100011097 150
100 3300006195 Ga0075366_10001938 Ga0075366_1000193813 150
101 3300006195 Ga0075366_10019344 Ga0075366_100193445 150
102 3300006237 Ga0097621_100000009 Ga0097621_100000009107 150
103 3300006353 Ga0075370_10081614 Ga0075370_100816142 150
104 3300006358 Ga0068871_100000232 Ga0068871_10000023212 150
105 3300006358 Ga0068871_100506948 Ga0068871_1005069482 150
106 3300006931 Ga0097620_100345553 Ga0097620_1003455534 150
107 3300009093 Ga0105240_10002332 Ga0105240_1000233228 150
108 3300009098 Ga0105245_10000002 Ga0105245_1000000213 150
109 3300009148 Ga0105243_10032209 Ga0105243_100322094 150
110 3300009174 Ga0105241_10000003 Ga0105241_10000003345 150
111 3300009174 Ga0105241_10000842 Ga0105241_1000084220 150
112 3300009545 Ga0105237_10044114 Ga0105237_100441144 150
113 3300009551 Ga0105238_10100206 Ga0105238_101002062 150
114 3300009553 Ga0105249_10131763 Ga0105249_101317632 150
115 3300009553 Ga0105249_10351772 Ga0105249_103517722 150
116 3300009993 Ga0105028_100263 Ga0105028_1002632 150
117 3300010375 Ga0105239_10039896 Ga0105239_100398965 150
118 3300010375 Ga0105239_10610835 Ga0105239_106108352 150
119 3300013100 Ga0157373_10000061 Ga0157373_1000006150 150
120 3300013100 Ga0157373_10104613 Ga0157373_101046132 150
121 3300013104 Ga0157370_10379496 Ga0157370_103794962 150
122 3300013104 Ga0157370_10479916 Ga0157370_104799162 150
123 3300013105 Ga0157369_10262848 Ga0157369_102628482 150
124 3300013296 Ga0157374_10000073 Ga0157374_1000007390 150
125 3300013296 Ga0157374_10001423 Ga0157374_1000142322 150
126 3300013297 Ga0157378_10402379 Ga0157378_104023792 150
127 3300013307 Ga0157372_10002447 Ga0157372_1000244710 150
128 3300013308 Ga0157375_11044856 Ga0157375_110448562 150
129 3300013308 Ga0157375_11161074 Ga0157375_111610742 150
130 3300014745 Ga0157377_10622027 Ga0157377_106220272 150
131 3300025903 Ga0207680_10096370 Ga0207680_100963704 150
132 3300025903 Ga0207680_10197512 Ga0207680_101975121 150
133 3300025907 Ga0207645_10236498 Ga0207645_102364982 150
134 3300025911 Ga0207654_10000002 Ga0207654_10000002862 150
135 3300025911 Ga0207654_10002956 Ga0207654_100029562 150
136 3300025913 Ga0207695_10072681 Ga0207695_100726815 150
137 3300025917 Ga0207660_10020375 Ga0207660_100203753 150
138 3300025927 Ga0207687_10000001 Ga0207687_100000011197 150
139 3300025931 Ga0207644_10000001 Ga0207644_10000001786 150
140 3300025935 Ga0207709_10049943 Ga0207709_100499434 150
141 3300025936 Ga0207670_11398663 Ga0207670_113986631 150
142 3300025944 Ga0207661_10000129 Ga0207661_100001297 150
143 3300025945 Ga0207679_10844895 Ga0207679_108448952 150
144 3300025949 Ga0207667_10000003 Ga0207667_1000000348 150
145 3300025949 Ga0207667_10062876 Ga0207667_100628764 150
146 3300025961 Ga0207712_10003874 Ga0207712_1000387412 150
147 3300025961 Ga0207712_10309436 Ga0207712_103094362 150
148 3300025972 Ga0207668_11427994 Ga0207668_114279942 150
149 3300025986 Ga0207658_10000003 Ga0207658_10000003769 150
150 3300026078 Ga0207702_10000739 Ga0207702_1000073922 150
151 3300026116 Ga0207674_10259094 Ga0207674_102590943 150
152 3300027717 Ga0209998_10043572 Ga0209998_100435722 150
153 3300027907 Ga0207428_10083905 Ga0207428_100839052 150
154 3300028381 Ga0268264_10007105 Ga0268264_100071058 150
155 3300028563 Ga0265319_1056368 Ga0265319_10563682 150
156 3300046459 Ga0495629_0298073 Ga0495629_0298073_416_916 150
157 3300046473 Ga0495582_0056117 Ga0495582_0056117_1049_1549 150
158 3300046557 Ga0495622_0000502 Ga0495622_0000502_23230_23730 150
159 3300046674 Ga0495588_0000171 Ga0495588_0000171_3547_4047 150
160 3300046683 Ga0495658_0000641 Ga0495658_0000641_11236_11736 150
161 3300046692 Ga0495671_0269845 Ga0495671_0269845_103_606 150
162 3300046809 Ga0495600_0008925 Ga0495600_0008925_2044_2544 150
163 3300047320 Ga0495672_0000694 Ga0495672_0000694_29886_30386 150
164 3300047321 Ga0495676_0745076 Ga0495676_0745076_39_539 150
165 3300047472 Ga0495686_0159155 Ga0495686_0159155_754_1254 150
166 3300047673 Ga0495593_0109795 Ga0495593_0109795_570_1070 150
167 3300049571 Ga0501034_0868664 Ga0501034_0868664_132_641 150
168 3300049589 Ga0501073_0282905 Ga0501073_0282905_539_1039 150
169 3300049744 Ga0501083_0011227 Ga0501083_0011227_5287_5787 150
170 3300050489 nmdc:mga03683_42674_c2 nmdc:mga03683_42674_c2_38_538 150
171 3300050489 nmdc:mga03683_80_c1 nmdc:mga03683_80_c1_18313_18813 150
172 3300050491 nmdc:mga00v17_177221_c1 nmdc:mga00v17_177221_c1_103_603 150
173 3300050491 nmdc:mga00v17_2630_c1 nmdc:mga00v17_2630_c1_7801_8301 150
174 3300050491 nmdc:mga00v17_293530_c1 nmdc:mga00v17_293530_c1_195_698 150
175 3300050491 nmdc:mga00v17_3801_c1 nmdc:mga00v17_3801_c1_320_838 150
176 3300050491 nmdc:mga00v17_461019_c1 nmdc:mga00v17_461019_c1_168_668 150
177 3300050491 nmdc:mga00v17_5335_c1 nmdc:mga00v17_5335_c1_161_664 150
178 3300050491 nmdc:mga00v17_56476_c1 nmdc:mga00v17_56476_c1_99_602 150
179 3300050492 nmdc:mga0yw44_112386_c1 nmdc:mga0yw44_112386_c1_141_644 150
180 3300050492 nmdc:mga0yw44_21337_c1 nmdc:mga0yw44_21337_c1_1088_1591 150
181 3300050492 nmdc:mga0yw44_2_c1 nmdc:mga0yw44_2_c1_81486_81986 150
182 3300050492 nmdc:mga0yw44_703768_c1 nmdc:mga0yw44_703768_c1_150_653 150
183 3300050492 nmdc:mga0yw44_84798_c1 nmdc:mga0yw44_84798_c1_1331_1849 150
184 3300050493 nmdc:mga0k408_118_c1 nmdc:mga0k408_118_c1_1661_2164 150
185 3300050493 nmdc:mga0k408_1_c1 nmdc:mga0k408_1_c1_565557_566057 150
186 3300050493 nmdc:mga0k408_214_c1 nmdc:mga0k408_214_c1_3174_3677 150
187 3300050493 nmdc:mga0k408_2889_c1 nmdc:mga0k408_2889_c1_2584_3078 150
188 3300050493 nmdc:mga0k408_3708_c1 nmdc:mga0k408_3708_c1_7142_7645 150
189 3300050494 nmdc:mga06z11_127_c1 nmdc:mga06z11_127_c1_6098_6601 150
190 3300050494 nmdc:mga06z11_249319_c1 nmdc:mga06z11_249319_c1_424_924 150
191 3300050494 nmdc:mga06z11_728833_c1 nmdc:mga06z11_728833_c1_84_578 150
192 3300050511 nmdc:mga08y16_5295_c1 nmdc:mga08y16_5295_c1_7171_7668 150
193 3300050516 nmdc:mga0sz30_1_c1 nmdc:mga0sz30_1_c1_68433_68933 150
194 3300050516 nmdc:mga0sz30_256333_c1 nmdc:mga0sz30_256333_c1_33_536 150
195 3300050516 nmdc:mga0sz30_3_c9 nmdc:mga0sz30_3_c9_74016_74516 150
196 3300053079 Ga0500610_0051662 Ga0500610_0051662_1239_1739 150
197 3300053087 Ga0500643_000148 Ga0500643_000148_13233_13736 150
198 3300053088 Ga0500644_0001037 Ga0500644_0001037_4810_5310 150
199 3300053092 Ga0500583_0000082 Ga0500583_0000082_29641_30141 150
200 3300053092 Ga0500583_0015409 Ga0500583_0015409_701_1204 150
201 3300053094 Ga0500566_0000001 Ga0500566_0000001_526739_527239 150
202 3300053103 Ga0500555_000001 Ga0500555_000001_573239_573739 150
203 3300053123 Ga0500614_000001 Ga0500614_000001_438142_438642 150
204 3300053130 Ga0500642_0016865 Ga0500642_0016865_608_1108 150
205 3300053136 Ga0500559_0006860 Ga0500559_0006860_3046_3546 150
206 3300053142 Ga0500577_0000528 Ga0500577_0000528_7498_7998 150
207 3300053147 Ga0500589_000013 Ga0500589_000013_73994_74494 150
208 3300053147 Ga0500589_025605 Ga0500589_025605_1256_1759 150
209 3300053147 Ga0500589_202833 Ga0500589_202833_48_557 150
210 3300053151 Ga0500604_0014397 Ga0500604_0014397_980_1480 150
211 3300053722 Ga0500649_000004 Ga0500649_000004_106544_107044 150
212 3300053727 Ga0500611_004452 Ga0500611_004452_60_560 150
213 3300003320 rootH2_10206709 rootH2_102067091 151
214 3300003322 rootL2_10247150 rootL2_102471503 151
215 3300003323 rootH1_10311088 rootH1_103110888 151
216 3300005327 Ga0070658_10000020 Ga0070658_1000002053 151
217 3300005327 Ga0070658_10006516 Ga0070658_100065163 151
218 3300005327 Ga0070658_10059696 Ga0070658_100596962 151
219 3300005328 Ga0070676_10006637 Ga0070676_100066374 151
220 3300005329 Ga0070683_100853205 Ga0070683_1008532051 151
221 3300005329 Ga0070683_101218198 Ga0070683_1012181981 151
222 3300005339 Ga0070660_100158272 Ga0070660_1001582725 151
223 3300005355 Ga0070671_100022194 Ga0070671_1000221945 151
224 3300005355 Ga0070671_100228642 Ga0070671_1002286422 151
225 3300005356 Ga0070674_100002912 Ga0070674_1000029126 151
226 3300005356 Ga0070674_100005409 Ga0070674_1000054094 151
227 3300005364 Ga0070673_100000033 Ga0070673_10000003341 151
228 3300005365 Ga0070688_100622557 Ga0070688_1006225571 151
229 3300005456 Ga0070678_100000201 Ga0070678_1000002018 151
230 3300005458 Ga0070681_10000608 Ga0070681_1000060833 151
231 3300005459 Ga0068867_100203796 Ga0068867_1002037961 151
232 3300005466 Ga0070685_10000690 Ga0070685_1000069013 151
233 3300005466 Ga0070685_10003963 Ga0070685_100039635 151
234 3300005535 Ga0070684_100000049 Ga0070684_1000000494 151
235 3300005548 Ga0070665_100085636 Ga0070665_1000856364 151
236 3300005548 Ga0070665_100124630 Ga0070665_1001246304 151
237 3300005548 Ga0070665_101378630 Ga0070665_1013786302 151
238 3300005563 Ga0068855_100004286 Ga0068855_10000428616 151
239 3300005564 Ga0070664_100728018 Ga0070664_1007280182 151
240 3300005577 Ga0068857_100039775 Ga0068857_1000397753 151
241 3300005614 Ga0068856_100082335 Ga0068856_1000823355 151
242 3300006358 Ga0068871_100234417 Ga0068871_1002344172 151
243 3300009093 Ga0105240_10000003 Ga0105240_10000003603 151
244 3300009093 Ga0105240_10118938 Ga0105240_101189382 151
245 3300009098 Ga0105245_10000200 Ga0105245_1000020039 151
246 3300009098 Ga0105245_10061919 Ga0105245_100619194 151
247 3300009098 Ga0105245_10373504 Ga0105245_103735042 151
248 3300009148 Ga0105243_10000001 Ga0105243_10000001690 151
249 3300009174 Ga0105241_10448771 Ga0105241_104487711 151
250 3300009176 Ga0105242_10000001 Ga0105242_10000001573 151
251 3300009176 Ga0105242_10002087 Ga0105242_1000208725 151
252 3300009176 Ga0105242_10013893 Ga0105242_100138939 151
253 3300009177 Ga0105248_11612672 Ga0105248_116126721 151
254 3300009545 Ga0105237_10009293 Ga0105237_100092932 151
255 3300010375 Ga0105239_10031923 Ga0105239_100319234 151
256 3300010375 Ga0105239_10038093 Ga0105239_100380934 151
257 3300010375 Ga0105239_10853134 Ga0105239_108531341 151
258 3300013296 Ga0157374_10000096 Ga0157374_1000009659 151
259 3300013297 Ga0157378_10037888 Ga0157378_100378885 151
260 3300013297 Ga0157378_10327382 Ga0157378_103273822 151
261 3300013307 Ga0157372_10025726 Ga0157372_100257265 151
262 3300013308 Ga0157375_10640535 Ga0157375_106405351 151
263 3300014969 Ga0157376_10000001 Ga0157376_10000001362 151
264 3300025907 Ga0207645_10038847 Ga0207645_100388475 151
265 3300025909 Ga0207705_10000115 Ga0207705_1000011547 151
266 3300025909 Ga0207705_10074336 Ga0207705_100743363 151
267 3300025909 Ga0207705_10432439 Ga0207705_104324392 151
268 3300025912 Ga0207707_10025748 Ga0207707_100257485 151
269 3300025913 Ga0207695_10000005 Ga0207695_10000005611 151
270 3300025913 Ga0207695_10076332 Ga0207695_100763324 151
271 3300025914 Ga0207671_10003661 Ga0207671_1000366120 151
272 3300025919 Ga0207657_10430137 Ga0207657_104301372 151
273 3300025927 Ga0207687_10001932 Ga0207687_1000193219 151
274 3300025927 Ga0207687_10075495 Ga0207687_100754954 151
275 3300025927 Ga0207687_10209830 Ga0207687_102098302 151
276 3300025931 Ga0207644_10022204 Ga0207644_100222044 151
277 3300025934 Ga0207686_10000001 Ga0207686_10000001454 151
278 3300025934 Ga0207686_10061860 Ga0207686_100618604 151
279 3300025935 Ga0207709_10000002 Ga0207709_10000002570 151
280 3300025937 Ga0207669_10006666 Ga0207669_100066668 151
281 3300025937 Ga0207669_10024885 Ga0207669_100248853 151
282 3300025944 Ga0207661_10000077 Ga0207661_1000007754 151
283 3300025949 Ga0207667_10004357 Ga0207667_100043577 151
284 3300025949 Ga0207667_10195280 Ga0207667_101952802 151
285 3300025960 Ga0207651_10000141 Ga0207651_1000014120 151
286 3300026041 Ga0207639_10011466 Ga0207639_100114665 151
287 3300026078 Ga0207702_10061822 Ga0207702_100618225 151
288 3300026116 Ga0207674_10119816 Ga0207674_101198164 151
289 3300026121 Ga0207683_10030359 Ga0207683_100303594 151
290 3300028379 Ga0268266_10021620 Ga0268266_100216205 151
291 3300028556 Ga0265337_1014219 Ga0265337_10142191 151
292 3300028573 Ga0265334_10000106 Ga0265334_1000010619 151
293 3300028800 Ga0265338_10000181 Ga0265338_1000018156 151
294 3300028800 Ga0265338_10000625 Ga0265338_1000062534 151
295 3300028800 Ga0265338_10052669 Ga0265338_100526693 151
296 3300031247 Ga0265340_10000445 Ga0265340_100004453 151
297 3300031712 Ga0265342_10121422 Ga0265342_101214222 151
298 3300037418 Ga0395900_0138321 Ga0395900_0138321_1541_2134 151
299 3300037418 Ga0395900_0475537 Ga0395900_0475537_47_547 151
300 3300037471 Ga0395905_0019326 Ga0395905_0019326_2639_3205 151
301 3300038443 Ga0395901_0006327 Ga0395901_0006327_2548_3111 151
302 3300038443 Ga0395901_0132250 Ga0395901_0132250_477_1040 151
303 3300048903 Ga0496100_0017761 Ga0496100_0017761_224_793 151
304 3300048907 Ga0496104_0574219 Ga0496104_0574219_421_984 151
305 3300048915 Ga0496112_0072167 Ga0496112_0072167_1434_1934 151
306 3300049571 Ga0501034_0009503 Ga0501034_0009503_2673_3167 151
307 3300049707 Ga0501234_003057 Ga0501234_003057_1456_2031 151
308 3300053088 Ga0500644_0012144 Ga0500644_0012144_1072_1644 151
309 3300053090 Ga0500646_0000805 Ga0500646_0000805_7885_8457 151
310 3300053093 Ga0500651_0000191 Ga0500651_0000191_1035_1598 151
311 3300053093 Ga0500651_0009366 Ga0500651_0009366_4218_4778 151
312 3300053093 Ga0500651_0287179 Ga0500651_0287179_303_875 151
313 3300053098 Ga0500650_0000001 Ga0500650_0000001_295436_296008 151
314 3300053108 Ga0500562_009692 Ga0500562_009692_1519_2091 151
315 3300053118 Ga0500594_0000001 Ga0500594_0000001_959869_960441 151
316 3300053123 Ga0500614_002185 Ga0500614_002185_1055_1618 151
317 3300053133 Ga0500655_001617 Ga0500655_001617_3048_3620 151
318 3300053142 Ga0500577_0014179 Ga0500577_0014179_1635_2207 151
319 3300053143 Ga0500579_000781 Ga0500579_000781_9397_9969 151
320 2162886011 MRS1b_contig_4084217 MRS1b_0407.00002990 152
321 2162886012 MBSR1b_contig_1799290 MBSR1b_0934.00002860 152
322 3300001979 JGI24740J21852_10004913 JGI24740J21852_100049135 152
323 3300001979 JGI24740J21852_10015481 JGI24740J21852_100154812 152
324 3300001979 JGI24740J21852_10019351 JGI24740J21852_100193513 152
325 3300001989 JGI24739J22299_10005141 JGI24739J22299_100051415 152
326 3300001989 JGI24739J22299_10065986 JGI24739J22299_100659862 152
327 3300001990 JGI24737J22298_10002203 JGI24737J22298_100022039 152
328 3300001991 JGI24743J22301_10000630 JGI24743J22301_100006306 152
329 3300002067 JGI24735J21928_10000149 JGI24735J21928_100001496 152
330 3300002075 JGI24738J21930_10001791 JGI24738J21930_100017919 152
331 3300003320 rootH2_10006847 rootH2_1000684719 152
332 3300003320 rootH2_10224747 rootH2_102247472 152
333 3300003911 JGI25405J52794_10004809 JGI25405J52794_100048092 152
334 3300005290 Ga0065712_10265754 Ga0065712_102657541 152
335 3300005293 Ga0065715_10099813 Ga0065715_100998134 152
336 3300005327 Ga0070658_10000024 Ga0070658_10000024144 152
337 3300005327 Ga0070658_10143421 Ga0070658_101434212 152
338 3300005328 Ga0070676_10295997 Ga0070676_102959971 152
339 3300005329 Ga0070683_100010750 Ga0070683_1000107503 152
340 3300005329 Ga0070683_100810260 Ga0070683_1008102601 152
341 3300005339 Ga0070660_100000316 Ga0070660_10000031616 152
342 3300005339 Ga0070660_100045343 Ga0070660_1000453435 152
343 3300005344 Ga0070661_100056640 Ga0070661_1000566403 152
344 3300005345 Ga0070692_10048571 Ga0070692_100485715 152
345 3300005347 Ga0070668_100135648 Ga0070668_1001356482 152
346 3300005366 Ga0070659_100099914 Ga0070659_1000999143 152
347 3300005366 Ga0070659_100115307 Ga0070659_1001153073 152
348 3300005367 Ga0070667_100281074 Ga0070667_1002810743 152
349 3300005457 Ga0070662_100009029 Ga0070662_1000090295 152
350 3300005518 Ga0070699_100829465 Ga0070699_1008294652 152
351 3300005535 Ga0070684_100094775 Ga0070684_1000947752 152
352 3300005544 Ga0070686_100228546 Ga0070686_1002285462 152
353 3300005563 Ga0068855_100000663 Ga0068855_10000066342 152
354 3300005563 Ga0068855_101775138 Ga0068855_1017751382 152
355 3300005564 Ga0070664_100003334 Ga0070664_1000033344 152
356 3300005564 Ga0070664_100277615 Ga0070664_1002776152 152
357 3300005577 Ga0068857_100000441 Ga0068857_10000044114 152
358 3300005577 Ga0068857_100000829 Ga0068857_10000082930 152
359 3300005577 Ga0068857_100128291 Ga0068857_1001282912 152
360 3300005577 Ga0068857_100777493 Ga0068857_1007774932 152
361 3300005578 Ga0068854_100026707 Ga0068854_1000267074 152
362 3300005614 Ga0068856_100000027 Ga0068856_10000002715 152
363 3300005614 Ga0068856_100000200 Ga0068856_1000002003 152
364 3300005614 Ga0068856_100073196 Ga0068856_1000731964 152
365 3300005616 Ga0068852_100000001 Ga0068852_100000001459 152
366 3300005616 Ga0068852_100000155 Ga0068852_10000015553 152
367 3300005842 Ga0068858_100918270 Ga0068858_1009182702 152
368 3300005843 Ga0068860_100013616 Ga0068860_1000136164 152
369 3300005844 Ga0068862_100134154 Ga0068862_1001341542 152
370 3300005937 Ga0081455_10000001 Ga0081455_10000001320 152
371 3300006028 Ga0070717_10058886 Ga0070717_100588865 152
372 3300006038 Ga0075365_10000001 Ga0075365_1000000183 152
373 3300006038 Ga0075365_10000014 Ga0075365_1000001415 152
374 3300006038 Ga0075365_10004786 Ga0075365_100047863 152
375 3300006038 Ga0075365_10007875 Ga0075365_100078754 152
376 3300006038 Ga0075365_10092905 Ga0075365_100929053 152
377 3300006038 Ga0075365_10391815 Ga0075365_103918152 152
378 3300006042 Ga0075368_10002082 Ga0075368_100020822 152
379 3300006048 Ga0075363_100019278 Ga0075363_1000192782 152
380 3300006051 Ga0075364_10002700 Ga0075364_1000270016 152
381 3300006051 Ga0075364_10137566 Ga0075364_101375662 152
382 3300006051 Ga0075364_10271444 Ga0075364_102714442 152
383 3300006178 Ga0075367_10008164 Ga0075367_100081646 152
384 3300006178 Ga0075367_10078335 Ga0075367_100783352 152
385 3300006186 Ga0075369_10039210 Ga0075369_100392102 152
386 3300006186 Ga0075369_10042664 Ga0075369_100426643 152
387 3300006195 Ga0075366_10010874 Ga0075366_100108745 152
388 3300006195 Ga0075366_10056325 Ga0075366_100563253 152
389 3300006195 Ga0075366_10169845 Ga0075366_101698451 152
390 3300006237 Ga0097621_100558325 Ga0097621_1005583252 152
391 3300006353 Ga0075370_10031490 Ga0075370_100314905 152
392 3300006353 Ga0075370_10103382 Ga0075370_101033822 152
393 3300006358 Ga0068871_101099834 Ga0068871_1010998342 152
394 3300006844 Ga0075428_100001999 Ga0075428_10000199920 152
395 3300006881 Ga0068865_100000307 Ga0068865_10000030723 152
396 3300009093 Ga0105240_10000004 Ga0105240_10000004166 152
397 3300009093 Ga0105240_10000050 Ga0105240_10000050126 152
398 3300009093 Ga0105240_10001357 Ga0105240_1000135741 152
399 3300009093 Ga0105240_11323262 Ga0105240_113232621 152
400 3300009098 Ga0105245_10173800 Ga0105245_101738005 152
401 3300009101 Ga0105247_10185438 Ga0105247_101854383 152
402 3300009174 Ga0105241_10082024 Ga0105241_100820243 152
403 3300009174 Ga0105241_10263637 Ga0105241_102636372 152
404 3300009177 Ga0105248_10201081 Ga0105248_102010813 152
405 3300009177 Ga0105248_10434691 Ga0105248_104346912 152
406 3300009177 Ga0105248_10789385 Ga0105248_107893851 152
407 3300009545 Ga0105237_10000001 Ga0105237_10000001599 152
408 3300009545 Ga0105237_10000002 Ga0105237_10000002353 152
409 3300009545 Ga0105237_10061315 Ga0105237_100613155 152
410 3300009545 Ga0105237_11130283 Ga0105237_111302832 152
411 3300009545 Ga0105237_11683392 Ga0105237_116833922 152
412 3300009551 Ga0105238_10020346 Ga0105238_100203463 152
413 3300009551 Ga0105238_10140584 Ga0105238_101405842 152
414 3300009979 Ga0105032_100001 Ga0105032_100001317 152
415 3300009979 Ga0105032_100020 Ga0105032_1000207 152
416 3300009984 Ga0105029_100086 Ga0105029_1000864 152
417 3300010375 Ga0105239_10001223 Ga0105239_1000122333 152
418 3300011119 Ga0105246_10010028 Ga0105246_100100282 152
419 3300011119 Ga0105246_10014924 Ga0105246_100149242 152
420 3300011119 Ga0105246_10052123 Ga0105246_100521234 152
421 3300013100 Ga0157373_10043985 Ga0157373_100439853 152
422 3300013100 Ga0157373_10094199 Ga0157373_100941992 152
423 3300013100 Ga0157373_10936581 Ga0157373_109365812 152
424 3300013102 Ga0157371_10007527 Ga0157371_100075279 152
425 3300013102 Ga0157371_10077928 Ga0157371_100779282 152
426 3300013102 Ga0157371_10109435 Ga0157371_101094352 152
427 3300013104 Ga0157370_10002357 Ga0157370_1000235716 152
428 3300013104 Ga0157370_10012318 Ga0157370_100123182 152
429 3300013104 Ga0157370_10137441 Ga0157370_101374412 152
430 3300013105 Ga0157369_10000029 Ga0157369_10000029224 152
431 3300013105 Ga0157369_10000151 Ga0157369_1000015179 152
432 3300013105 Ga0157369_10000190 Ga0157369_100001903 152
433 3300013105 Ga0157369_10000567 Ga0157369_1000056753 152
434 3300013105 Ga0157369_10119188 Ga0157369_101191885 152
435 3300013105 Ga0157369_10451879 Ga0157369_104518793 152
436 3300013296 Ga0157374_10004073 Ga0157374_100040736 152
437 3300013307 Ga0157372_10000002 Ga0157372_10000002144 152
438 3300013307 Ga0157372_10000086 Ga0157372_1000008619 152
439 3300013307 Ga0157372_10257262 Ga0157372_102572624 152
440 3300013308 Ga0157375_10074210 Ga0157375_100742104 152
441 3300014325 Ga0163163_10251669 Ga0163163_102516694 152
442 3300014745 Ga0157377_10000920 Ga0157377_1000092013 152
443 3300014969 Ga0157376_10000027 Ga0157376_100000273 152
444 3300014969 Ga0157376_10945670 Ga0157376_109456701 152
445 3300025315 Ga0207697_10044198 Ga0207697_100441983 152
446 3300025900 Ga0207710_10095235 Ga0207710_100952351 152
447 3300025904 Ga0207647_10001245 Ga0207647_1000124521 152
448 3300025906 Ga0207699_10144502 Ga0207699_101445022 152
449 3300025907 Ga0207645_10286483 Ga0207645_102864833 152
450 3300025909 Ga0207705_10000047 Ga0207705_1000004763 152
451 3300025909 Ga0207705_10112718 Ga0207705_101127182 152
452 3300025911 Ga0207654_10047071 Ga0207654_100470714 152
453 3300025911 Ga0207654_10157340 Ga0207654_101573402 152
454 3300025913 Ga0207695_10000009 Ga0207695_10000009546 152
455 3300025913 Ga0207695_10000158 Ga0207695_10000158105 152
456 3300025913 Ga0207695_10247811 Ga0207695_102478113 152
457 3300025914 Ga0207671_10000003 Ga0207671_10000003602 152
458 3300025914 Ga0207671_10000008 Ga0207671_10000008457 152
459 3300025914 Ga0207671_10033531 Ga0207671_100335315 152
460 3300025919 Ga0207657_10002562 Ga0207657_1000256216 152
461 3300025919 Ga0207657_10011048 Ga0207657_100110488 152
462 3300025924 Ga0207694_10088559 Ga0207694_100885592 152
463 3300025924 Ga0207694_10112347 Ga0207694_101123475 152
464 3300025926 Ga0207659_10091373 Ga0207659_100913733 152
465 3300025932 Ga0207690_10002652 Ga0207690_100026525 152
466 3300025932 Ga0207690_10125620 Ga0207690_101256202 152
467 3300025933 Ga0207706_10000073 Ga0207706_1000007351 152
468 3300025938 Ga0207704_10001468 Ga0207704_100014686 152
469 3300025941 Ga0207711_10135448 Ga0207711_101354483 152
470 3300025944 Ga0207661_10002445 Ga0207661_1000244518 152
471 3300025945 Ga0207679_10000124 Ga0207679_1000012464 152
472 3300025945 Ga0207679_10316443 Ga0207679_103164432 152
473 3300025945 Ga0207679_10507067 Ga0207679_105070672 152
474 3300025949 Ga0207667_10000756 Ga0207667_1000075641 152
475 3300025949 Ga0207667_10280915 Ga0207667_102809153 152
476 3300025972 Ga0207668_10121136 Ga0207668_101211362 152
477 3300025981 Ga0207640_10019721 Ga0207640_100197214 152
478 3300026035 Ga0207703_10508632 Ga0207703_105086322 152
479 3300026078 Ga0207702_10000015 Ga0207702_10000015104 152
480 3300026078 Ga0207702_10000034 Ga0207702_10000034104 152
481 3300026078 Ga0207702_10000057 Ga0207702_1000005796 152
482 3300026078 Ga0207702_10681970 Ga0207702_106819702 152
483 3300026116 Ga0207674_10000439 Ga0207674_100004392 152
484 3300026116 Ga0207674_10000878 Ga0207674_1000087814 152
485 3300026116 Ga0207674_10143475 Ga0207674_101434754 152
486 3300026116 Ga0207674_10149562 Ga0207674_101495622 152
487 3300026116 Ga0207674_11305110 Ga0207674_113051102 152
488 3300026142 Ga0207698_10000001 Ga0207698_10000001410 152
489 3300026142 Ga0207698_10000048 Ga0207698_1000004815 152
490 3300026142 Ga0207698_11249590 Ga0207698_112495902 152
491 3300027866 Ga0209813_10000335 Ga0209813_1000033519 152
492 3300028380 Ga0268265_11072907 Ga0268265_110729072 152
493 3300030733 Ga0314311_1122390 Ga0314311_11223904 152
494 3300030734 Ga0316179_1064424 Ga0316179_10644247 152
495 3300030736 Ga0316180_1071123 Ga0316180_10711234 152
496 3300030742 Ga0316183_1041045 Ga0316183_10410453 152
497 3300030742 Ga0316183_1192095 Ga0316183_11920957 152
498 3300030744 Ga0316181_1019399 Ga0316181_10193995 152
499 3300030745 Ga0316182_1017501 Ga0316182_10175018 152
500 3300030745 Ga0316182_1175280 Ga0316182_11752802 152
501 3300030745 Ga0316182_1326517 Ga0316182_13265172 152
502 3300030745 Ga0316182_1396058 Ga0316182_13960587 152
503 3300031730 Ga0307516_10008182 Ga0307516_100081824 152
504 3300031731 Ga0307405_10051169 Ga0307405_100511693 152
505 3300031911 Ga0307412_10122601 Ga0307412_101226012 152
506 3300037312 Ga0395899_0039022 Ga0395899_0039022_1673_2131 152
507 3300037312 Ga0395899_0144552 Ga0395899_0144552_489_983 152
508 3300037418 Ga0395900_0000001 Ga0395900_0000001_261338_261796 152
509 3300037466 Ga0395898_0000002 Ga0395898_0000002_844150_844668 152
510 3300038443 Ga0395901_0000006 Ga0395901_0000006_489826_490344 152
511 3300041410 Ga0439461_0002738 Ga0439461_0002738_339_833 152
512 3300041512 Ga0451853_0102201 Ga0451853_0102201_35_529 152
513 3300041512 Ga0451853_0725875 Ga0451853_0725875_82_576 152
514 3300042004 Ga0439445_0005738 Ga0439445_0005738_90_584 152
515 3300042005 Ga0439448_0214674 Ga0439448_0214674_46_564 152
516 3300042006 Ga0439432_007573 Ga0439432_007573_331_825 152
517 3300042122 Ga0450920_000808 Ga0450920_000808_4036_4530 152
518 3300042145 Ga0450906_005983 Ga0450906_005983_1152_1646 152
519 3300042156 Ga0439446_0000001 Ga0439446_0000001_15676_16170 152
520 3300042185 Ga0450909_001971 Ga0450909_001971_1243_1737 152
521 3300042439 Ga0439464_0000130 Ga0439464_0000130_9304_9762 152
522 3300042439 Ga0439464_0036928 Ga0439464_0036928_106_600 152
523 3300042531 Ga0450918_000617 Ga0450918_000617_2538_3035 152
524 3300044765 Ga0466970_0123694 Ga0466970_0123694_627_1121 152
525 3300046460 Ga0495638_0000132 Ga0495638_0000132_95904_96398 152
526 3300046460 Ga0495638_0000551 Ga0495638_0000551_35887_36381 152
527 3300046542 Ga0495597_0030047 Ga0495597_0030047_1126_1620 152
528 3300046642 Ga0495634_0096185 Ga0495634_0096185_826_1320 152
529 3300046692 Ga0495671_0065105 Ga0495671_0065105_923_1417 152
530 3300046810 Ga0495660_0000005 Ga0495660_0000005_126691_127185 152
531 3300047470 Ga0495681_0201217 Ga0495681_0201217_244_738 152
532 3300047472 Ga0495686_0005549 Ga0495686_0005549_2260_2754 152
533 3300048090 Ga0495615_0092397 Ga0495615_0092397_119_613 152
534 3300048916 Ga0496113_0025550 Ga0496113_0025550_1678_2136 152
535 3300049571 Ga0501034_0000028 Ga0501034_0000028_977_1471 152
536 3300049573 Ga0501037_0000001 Ga0501037_0000001_189104_189598 152
537 3300049574 Ga0501038_0070790 Ga0501038_0070790_2282_2776 152
538 3300050489 nmdc:mga03683_32384_c1 nmdc:mga03683_32384_c1_33_527 152
539 3300050491 nmdc:mga00v17_120_c1 nmdc:mga00v17_120_c1_26858_27352 152
540 3300050491 nmdc:mga00v17_162499_c1 nmdc:mga00v17_162499_c1_769_1227 152
541 3300050492 nmdc:mga0yw44_128525_c1 nmdc:mga0yw44_128525_c1_662_1156 152
542 3300050492 nmdc:mga0yw44_16_c1 nmdc:mga0yw44_16_c1_67126_67620 152
543 3300050492 nmdc:mga0yw44_1_c1 nmdc:mga0yw44_1_c1_179764_180258 152
544 3300050492 nmdc:mga0yw44_3147_c1 nmdc:mga0yw44_3147_c1_5823_6332 152
545 3300050492 nmdc:mga0yw44_4_c1 nmdc:mga0yw44_4_c1_320149_320643 152
546 3300050492 nmdc:mga0yw44_523976_c1 nmdc:mga0yw44_523976_c1_164_658 152
547 3300050493 nmdc:mga0k408_159617_c1 nmdc:mga0k408_159617_c1_29_523 152
548 3300050493 nmdc:mga0k408_3696_c1 nmdc:mga0k408_3696_c1_6821_7279 152
549 3300050493 nmdc:mga0k408_4209_c3 nmdc:mga0k408_4209_c3_1012_1506 152
550 3300050494 nmdc:mga06z11_198_c1 nmdc:mga06z11_198_c1_12892_13386 152
551 3300050494 nmdc:mga06z11_58210_c1 nmdc:mga06z11_58210_c1_1282_1740 152
552 3300050495 nmdc:mga04h51_202516_c1 nmdc:mga04h51_202516_c1_205_663 152
553 3300050495 nmdc:mga04h51_251_c1 nmdc:mga04h51_251_c1_13371_13865 152
554 3300050496 nmdc:mga07m45_10022_c1 nmdc:mga07m45_10022_c1_1387_1845 152
555 3300050496 nmdc:mga07m45_148205_c1 nmdc:mga07m45_148205_c1_810_1304 152
556 3300050496 nmdc:mga07m45_248674_c1 nmdc:mga07m45_248674_c1_403_897 152
557 3300050516 nmdc:mga0sz30_13016_c1 nmdc:mga0sz30_13016_c1_1259_1717 152
558 3300050516 nmdc:mga0sz30_1978_c2 nmdc:mga0sz30_1978_c2_238_732 152
559 3300053087 Ga0500643_000022 Ga0500643_000022_89901_90398 152
560 3300053087 Ga0500643_003568 Ga0500643_003568_5853_6347 152
561 3300053088 Ga0500644_0007239 Ga0500644_0007239_1847_2341 152
562 3300053088 Ga0500644_0472856 Ga0500644_0472856_18_512 152
563 3300053090 Ga0500646_0000007 Ga0500646_0000007_27122_27616 152
564 3300053090 Ga0500646_0046835 Ga0500646_0046835_172_666 152
565 3300053092 Ga0500583_0011114 Ga0500583_0011114_2394_2888 152
566 3300053092 Ga0500583_0014634 Ga0500583_0014634_2192_2686 152
567 3300053092 Ga0500583_0291472 Ga0500583_0291472_32_526 152
568 3300053096 Ga0500641_0000001 Ga0500641_0000001_71483_71977 152
569 3300053103 Ga0500555_000009 Ga0500555_000009_256319_256813 152
570 3300053109 Ga0500569_000018 Ga0500569_000018_35887_36381 152
571 3300053131 Ga0500652_000001 Ga0500652_000001_290496_290990 152
572 3300053131 Ga0500652_136312 Ga0500652_136312_400_894 152
573 3300053139 Ga0500568_0031933 Ga0500568_0031933_909_1406 152
574 3300053142 Ga0500577_0054346 Ga0500577_0054346_239_733 152
575 3300053146 Ga0500588_0000752 Ga0500588_0000752_343_837 152
576 3300053151 Ga0500604_0049606 Ga0500604_0049606_466_963 152
577 3300053153 Ga0500616_0000005 Ga0500616_0000005_268469_268969 152
578 3300053153 Ga0500616_0000012 Ga0500616_0000012_395863_396357 152
579 3300053153 Ga0500616_0015635 Ga0500616_0015635_2784_3278 152
580 3300053153 Ga0500616_0025837 Ga0500616_0025837_477_971 152
581 3300053724 Ga0500570_008150 Ga0500570_008150_2274_2768 152
582 3300053724 Ga0500570_070171 Ga0500570_070171_1106_1600 152
583 3300053732 Ga0500656_002995 Ga0500656_002995_294_788 152
584 3300059426 Ga0590077_054771 Ga0590077_054771_107_601 152

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00293

NUDIX

NUDIX domain

57

186

0.72

Structural Annotation

Top 5 Hits

ID Description Score Start End
3i7u-assembly1.cif.gz_B crystal structure of ap4a hydrolase (aq_158) from aquifex aeolicus vf5 0.9486 12 149
1vc9-assembly2.cif.gz_B crystal structure of a t.thermophilus hb8 ap6a hydrolase e50q mutant-mg2+-atp complex 0.9284 14 146
1vcd-assembly1.cif.gz_A crystal structure of a t.thermophilus hb8 ap6a hydrolase ndx1 0.9271 14 147
3i7u-assembly1.cif.gz_B crystal structure of ap4a hydrolase (aq_158) from aquifex aeolicus vf5 0.9214 12 149
6m6y-assembly1.cif.gz_A crystal structure of mycobacterium smegmatis mutt1 in complex with 8-oxo-dgtp 0.9138 13 140
ID Description Score Start End Superfamily
2pbtB01 Alpha Beta;Alpha-Beta Complex;Nucleoside Triphosphate Pyrophosphohydrolase;Nucleoside Triphosphate Pyrophosphohydrolase 0.9499 16 145 3.90.79.10
1vcdB01 Alpha Beta;Alpha-Beta Complex;Nucleoside Triphosphate Pyrophosphohydrolase;Nucleoside Triphosphate Pyrophosphohydrolase 0.9197 16 146 3.90.79.10
2pbtB01 Alpha Beta;Alpha-Beta Complex;Nucleoside Triphosphate Pyrophosphohydrolase;Nucleoside Triphosphate Pyrophosphohydrolase 0.9139 16 145 3.90.79.10
1vcdB01 Alpha Beta;Alpha-Beta Complex;Nucleoside Triphosphate Pyrophosphohydrolase;Nucleoside Triphosphate Pyrophosphohydrolase 0.8982 16 146 3.90.79.10
af_P9WIY3_15_154_3.90.79.10 Alpha Beta;Alpha-Beta Complex;Nucleoside Triphosphate Pyrophosphohydrolase;Nucleoside Triphosphate Pyrophosphohydrolase 0.8912 13 141 3.90.79.10
ID Description Score Start End GO Terms
AF-A0A7W4HU80-F1-model_v4 NUDIX domain-containing protein 0.9954 23 152 GO:0004081
GO:0006167
GO:0006754
AF-A0A660M028-F1-model_v4 NUDIX domain-containing protein 0.9895 2 152 GO:0004081
GO:0006167
GO:0006754
AF-A0A7W4HU80-F1-model_v4 NUDIX domain-containing protein 0.9878 23 152 GO:0004081
GO:0006167
GO:0006754
AF-A0A7C7HV55-F1-model_v4 NUDIX domain-containing protein 0.9822 2 152 GO:0004081
GO:0006167
GO:0006754
AF-A0A7W1KHD8-F1-model_v4 NUDIX domain-containing protein 0.9815 1 152 GO:0004081
GO:0006167
GO:0006754

Feature Viewer

pLDDT pTM Quality
94.77 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map