F466339
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 584 | 252 | 584 | 168 |
Family's Representative Sequence
| Representative Sequence | 3300005459|Ga0068867_100203796|Ga0068867_1002037961 |
| Length | 197 |
| Sequence | MSAMRRRPHPNQDAQKKPEVPAAASAPKNNPISNIRKPIEGIRKFVTRRPAIEEVVHETTSGGIVFRRNQKSNELEILLIKDAKNRWTIPKGHVEEGEEPKDTAEREIREETGLQEMLVRDWLGKVNFRYRRNHTLVLMTMHIYLVQGQGNTDRLHPEDWLSDIQWLPATKAVDSIAYEDIGKLMLLGMKKIRDQKL |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886011 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 2 | 2162886012 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 | Metagenome | Rhizosphere |
| 3 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 4 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 5 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 6 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 7 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 8 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 9 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 10 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 11 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 12 | 3300003911 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 13 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 14 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 15 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 18 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 21 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 24 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 30 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 35 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 36 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 37 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 39 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 40 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 41 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 43 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 45 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 46 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 47 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 48 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 49 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 50 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 51 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 52 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 53 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 54 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 56 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 57 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 58 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 59 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 60 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 61 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 62 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 63 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 65 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 66 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 67 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 68 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 70 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 71 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300009979 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_126 metaG | Metagenome | Rhizosphere |
| 80 | 3300009984 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_127 metaG | Metagenome | Rhizosphere |
| 81 | 3300009993 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_106 metaG | Metagenome | Rhizosphere |
| 82 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 137 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 138 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 142 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 143 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 144 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 145 | 3300030733 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 | Metagenome | Rhizosphere |
| 146 | 3300030734 | Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 5 | Metagenome | Rhizosphere |
| 147 | 3300030736 | Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 | Metagenome | Rhizosphere |
| 148 | 3300030742 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 | Metagenome | Rhizosphere |
| 149 | 3300030744 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 | Metagenome | Rhizosphere |
| 150 | 3300030745 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 | Metagenome | Rhizosphere |
| 151 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 152 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 153 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 154 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 155 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 156 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 157 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 158 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 159 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 160 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 161 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 162 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 163 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 164 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 165 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 166 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 167 | 3300042122 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 | Metagenome | Rhizosphere |
| 168 | 3300042145 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 | Metagenome | Rhizosphere |
| 169 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 170 | 3300042185 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 | Metagenome | Rhizosphere |
| 171 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 172 | 3300042531 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 | Metagenome | Rhizosphere |
| 173 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 174 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 192 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 193 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 194 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 195 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 196 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 197 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 198 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 199 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 200 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 201 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 202 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 203 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 204 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 205 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 206 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 207 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 208 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 209 | 3300049707 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought | Metagenome | Rhizosphere |
| 210 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 211 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 212 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 213 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 214 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 215 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 216 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 217 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 218 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 219 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 220 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 221 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 222 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 223 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 224 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 225 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 226 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 227 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 228 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 229 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 230 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 231 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 232 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 233 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 234 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 235 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 236 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 237 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 238 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 239 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 240 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 241 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 242 | 3300053143 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 endosphere | Metagenome | Endosphere |
| 243 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 244 | 3300053147 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere | Metagenome | Endosphere |
| 245 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 246 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 247 | 3300053722 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 endosphere | Metagenome | Endosphere |
| 248 | 3300053724 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere | Metagenome | Endosphere |
| 249 | 3300053727 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere | Metagenome | Endosphere |
| 250 | 3300053732 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 endosphere | Metagenome | Endosphere |
| 251 | 3300059426 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 252 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 23.63 |
| Nodule | 0 |
| Rhizoplane | 0.68 |
| Rhizosphere | 74.14 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 1.54 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | MRS1b_contig_4084217 | 2162886011 | Bacteria | 929 |
| 2 | MBSR1b_contig_1799290 | 2162886012 | Bacteria | 856 |
| 3 | JGI24740J21852_10004913 | 3300001979 | Bacteria | 5690 |
| 4 | JGI24740J21852_10005605 | 3300001979 | Bacteria | 5288 |
| 5 | JGI24740J21852_10015481 | 3300001979 | Bacteria | 2783 |
| 6 | JGI24740J21852_10019351 | 3300001979 | Bacteria | 2399 |
| 7 | JGI24740J21852_10047586 | 3300001979 | Bacteria | 1251 |
| 8 | JGI24739J22299_10005141 | 3300001989 | Bacteria | 4982 |
| 9 | JGI24739J22299_10065986 | 3300001989 | Bacteria | 1134 |
| 10 | JGI24737J22298_10002203 | 3300001990 | Bacteria | 6943 |
| 11 | JGI24743J22301_10000630 | 3300001991 | Bacteria | 4295 |
| 12 | JGI24735J21928_10000075 | 3300002067 | Bacteria | 41276 |
| 13 | JGI24735J21928_10000149 | 3300002067 | Bacteria | 24660 |
| 14 | JGI24738J21930_10001791 | 3300002075 | Bacteria | 5840 |
| 15 | rootH2_10000244 | 3300003320 | Bacteria | 697651 |
| 16 | rootH2_10006847 | 3300003320 | Bacteria | 155484 |
| 17 | rootH2_10206709 | 3300003320 | Unclassified | 1173 |
| 18 | rootH2_10224747 | 3300003320 | Bacteria | 1913 |
| 19 | rootL2_10247150 | 3300003322 | Bacteria | 2022 |
| 20 | rootH1_10311088 | 3300003323 | Bacteria | 4960 |
| 21 | JGI25405J52794_10004809 | 3300003911 | Bacteria | 2422 |
| 22 | JGI25405J52794_10007214 | 3300003911 | Unclassified | 2046 |
| 23 | Ga0065712_10265754 | 3300005290 | Bacteria | 927 |
| 24 | Ga0065715_10099813 | 3300005293 | Bacteria | 3366 |
| 25 | Ga0070658_10000015 | 3300005327 | Bacteria | 230579 |
| 26 | Ga0070658_10000020 | 3300005327 | Bacteria | 188851 |
| 27 | Ga0070658_10000024 | 3300005327 | Bacteria | 175873 |
| 28 | Ga0070658_10006516 | 3300005327 | Bacteria | 9470 |
| 29 | Ga0070658_10034417 | 3300005327 | Bacteria | 4075 |
| 30 | Ga0070658_10059696 | 3300005327 | Bacteria | 3106 |
| 31 | Ga0070658_10143421 | 3300005327 | Bacteria | 1996 |
| 32 | Ga0070676_10006637 | 3300005328 | Bacteria | 6195 |
| 33 | Ga0070676_10239783 | 3300005328 | Bacteria | 1205 |
| 34 | Ga0070676_10295997 | 3300005328 | Bacteria | 1095 |
| 35 | Ga0070683_100000505 | 3300005329 | Bacteria | 27371 |
| 36 | Ga0070683_100010750 | 3300005329 | Bacteria | 7874 |
| 37 | Ga0070683_100428918 | 3300005329 | Bacteria | 1261 |
| 38 | Ga0070683_100810260 | 3300005329 | Bacteria | 898 |
| 39 | Ga0070683_100853205 | 3300005329 | Bacteria | 873 |
| 40 | Ga0070683_101218198 | 3300005329 | Bacteria | 723 |
| 41 | Ga0070670_100738903 | 3300005331 | Bacteria | 886 |
| 42 | Ga0070666_10004519 | 3300005335 | Bacteria | 8480 |
| 43 | Ga0070666_10128410 | 3300005335 | Bacteria | 1760 |
| 44 | Ga0070680_100038020 | 3300005336 | Bacteria | 3891 |
| 45 | Ga0070680_100053143 | 3300005336 | Unclassified | 3306 |
| 46 | Ga0070680_100092015 | 3300005336 | Unclassified | 2511 |
| 47 | Ga0070680_100129715 | 3300005336 | Bacteria | 2109 |
| 48 | Ga0070660_100000316 | 3300005339 | Bacteria | 31842 |
| 49 | Ga0070660_100000346 | 3300005339 | Bacteria | 30918 |
| 50 | Ga0070660_100027199 | 3300005339 | Bacteria | 4266 |
| 51 | Ga0070660_100045343 | 3300005339 | Bacteria | 3365 |
| 52 | Ga0070660_100158272 | 3300005339 | Bacteria | 1824 |
| 53 | Ga0070661_100056640 | 3300005344 | Bacteria | 2872 |
| 54 | Ga0070692_10048571 | 3300005345 | Bacteria | 2199 |
| 55 | Ga0070668_100135648 | 3300005347 | Bacteria | 1979 |
| 56 | Ga0070675_101120741 | 3300005354 | Unclassified | 724 |
| 57 | Ga0070671_100000001 | 3300005355 | Bacteria | 1228151 |
| 58 | Ga0070671_100022194 | 3300005355 | Bacteria | 5185 |
| 59 | Ga0070671_100228642 | 3300005355 | Bacteria | 1578 |
| 60 | Ga0070674_100002912 | 3300005356 | Bacteria | 9483 |
| 61 | Ga0070674_100005409 | 3300005356 | Bacteria | 7373 |
| 62 | Ga0070674_101533982 | 3300005356 | Unclassified | 599 |
| 63 | Ga0070673_100000033 | 3300005364 | Bacteria | 60744 |
| 64 | Ga0070688_100622557 | 3300005365 | Bacteria | 828 |
| 65 | Ga0070659_100099914 | 3300005366 | Bacteria | 2334 |
| 66 | Ga0070659_100115307 | 3300005366 | Bacteria | 2171 |
| 67 | Ga0070659_100359880 | 3300005366 | Bacteria | 1222 |
| 68 | Ga0070659_101706293 | 3300005366 | Unclassified | 563 |
| 69 | Ga0070667_100000001 | 3300005367 | Bacteria | 1108638 |
| 70 | Ga0070667_100281074 | 3300005367 | Bacteria | 1494 |
| 71 | Ga0070678_100000201 | 3300005456 | Bacteria | 26383 |
| 72 | Ga0070662_100009029 | 3300005457 | Bacteria | 6502 |
| 73 | Ga0070681_10000608 | 3300005458 | Bacteria | 29517 |
| 74 | Ga0070681_10111539 | 3300005458 | Bacteria | 2674 |
| 75 | Ga0070681_10143721 | 3300005458 | Bacteria | 2315 |
| 76 | Ga0068867_100203796 | 3300005459 | Bacteria | 1585 |
| 77 | Ga0070685_10000690 | 3300005466 | Bacteria | 18276 |
| 78 | Ga0070685_10003963 | 3300005466 | Bacteria | 7482 |
| 79 | Ga0070699_100829465 | 3300005518 | Unclassified | 846 |
| 80 | Ga0070679_100045653 | 3300005530 | Bacteria | 4365 |
| 81 | Ga0070679_100113775 | 3300005530 | Unclassified | 2691 |
| 82 | Ga0070679_100438440 | 3300005530 | Bacteria | 1251 |
| 83 | Ga0070684_100000049 | 3300005535 | Bacteria | 79768 |
| 84 | Ga0070684_100013686 | 3300005535 | Bacteria | 6546 |
| 85 | Ga0070684_100094775 | 3300005535 | Bacteria | 2659 |
| 86 | Ga0070686_100228546 | 3300005544 | Bacteria | 1348 |
| 87 | Ga0070665_100085636 | 3300005548 | Bacteria | 3157 |
| 88 | Ga0070665_100124630 | 3300005548 | Bacteria | 2578 |
| 89 | Ga0070665_101378630 | 3300005548 | Unclassified | 714 |
| 90 | Ga0068855_100000663 | 3300005563 | Bacteria | 41994 |
| 91 | Ga0068855_100004286 | 3300005563 | Bacteria | 17425 |
| 92 | Ga0068855_100042951 | 3300005563 | Bacteria | 5356 |
| 93 | Ga0068855_100770916 | 3300005563 | Bacteria | 1024 |
| 94 | Ga0068855_101775138 | 3300005563 | Unclassified | 627 |
| 95 | Ga0070664_100003334 | 3300005564 | Bacteria | 12978 |
| 96 | Ga0070664_100277615 | 3300005564 | Bacteria | 1510 |
| 97 | Ga0070664_100728018 | 3300005564 | Bacteria | 925 |
| 98 | Ga0068857_100000441 | 3300005577 | Bacteria | 29474 |
| 99 | Ga0068857_100000829 | 3300005577 | Bacteria | 23132 |
| 100 | Ga0068857_100039775 | 3300005577 | Bacteria | 4167 |
| 101 | Ga0068857_100102988 | 3300005577 | Bacteria | 2563 |
| 102 | Ga0068857_100128291 | 3300005577 | Unclassified | 2286 |
| 103 | Ga0068857_100777493 | 3300005577 | Bacteria | 913 |
| 104 | Ga0068854_100026707 | 3300005578 | Bacteria | 3971 |
| 105 | Ga0068856_100000027 | 3300005614 | Bacteria | 133290 |
| 106 | Ga0068856_100000200 | 3300005614 | Bacteria | 63772 |
| 107 | Ga0068856_100000445 | 3300005614 | Bacteria | 45664 |
| 108 | Ga0068856_100073196 | 3300005614 | Bacteria | 3393 |
| 109 | Ga0068856_100082335 | 3300005614 | Bacteria | 3194 |
| 110 | Ga0068856_100106228 | 3300005614 | Bacteria | 2802 |
| 111 | Ga0068852_100000001 | 3300005616 | Bacteria | 716526 |
| 112 | Ga0068852_100000155 | 3300005616 | Bacteria | 45515 |
| 113 | Ga0068859_100345560 | 3300005617 | Unclassified | 1582 |
| 114 | Ga0068861_100103735 | 3300005719 | Unclassified | 2267 |
| 115 | Ga0068861_100918014 | 3300005719 | Bacteria | 830 |
| 116 | Ga0068858_100918270 | 3300005842 | Unclassified | 856 |
| 117 | Ga0068860_100004772 | 3300005843 | Bacteria | 13816 |
| 118 | Ga0068860_100013616 | 3300005843 | Bacteria | 7972 |
| 119 | Ga0068862_100134154 | 3300005844 | Bacteria | 2193 |
| 120 | Ga0081455_10000001 | 3300005937 | Bacteria | 603871 |
| 121 | Ga0081455_10000008 | 3300005937 | Bacteria | 256558 |
| 122 | Ga0070717_10058886 | 3300006028 | Bacteria | 3177 |
| 123 | Ga0075365_10000001 | 3300006038 | Bacteria | 371589 |
| 124 | Ga0075365_10000009 | 3300006038 | Bacteria | 111957 |
| 125 | Ga0075365_10000014 | 3300006038 | Bacteria | 79945 |
| 126 | Ga0075365_10004786 | 3300006038 | Bacteria | 7224 |
| 127 | Ga0075365_10007875 | 3300006038 | Bacteria | 6002 |
| 128 | Ga0075365_10092905 | 3300006038 | Bacteria | 2057 |
| 129 | Ga0075365_10390927 | 3300006038 | Bacteria | 981 |
| 130 | Ga0075365_10391815 | 3300006038 | Bacteria | 980 |
| 131 | Ga0075368_10002082 | 3300006042 | Bacteria | 6462 |
| 132 | Ga0075363_100019278 | 3300006048 | Bacteria | 3409 |
| 133 | Ga0075363_100112350 | 3300006048 | Bacteria | 1515 |
| 134 | Ga0075364_10002700 | 3300006051 | Bacteria | 9968 |
| 135 | Ga0075364_10003371 | 3300006051 | Bacteria | 9072 |
| 136 | Ga0075364_10064884 | 3300006051 | Unclassified | 2397 |
| 137 | Ga0075364_10137566 | 3300006051 | Bacteria | 1642 |
| 138 | Ga0075364_10214920 | 3300006051 | Bacteria | 1304 |
| 139 | Ga0075364_10271444 | 3300006051 | Unclassified | 1154 |
| 140 | Ga0075362_10000063 | 3300006177 | Bacteria | 31783 |
| 141 | Ga0075367_10000093 | 3300006178 | Bacteria | 24511 |
| 142 | Ga0075367_10008164 | 3300006178 | Bacteria | 5409 |
| 143 | Ga0075367_10078335 | 3300006178 | Bacteria | 1996 |
| 144 | Ga0075367_10261139 | 3300006178 | Bacteria | 1087 |
| 145 | Ga0075367_10287429 | 3300006178 | Unclassified | 1034 |
| 146 | Ga0075369_10000001 | 3300006186 | Bacteria | 299616 |
| 147 | Ga0075369_10000010 | 3300006186 | Bacteria | 77564 |
| 148 | Ga0075369_10039210 | 3300006186 | Bacteria | 2023 |
| 149 | Ga0075369_10042664 | 3300006186 | Bacteria | 1945 |
| 150 | Ga0075366_10000001 | 3300006195 | Bacteria | 569172 |
| 151 | Ga0075366_10001109 | 3300006195 | Bacteria | 13248 |
| 152 | Ga0075366_10001938 | 3300006195 | Bacteria | 10463 |
| 153 | Ga0075366_10010874 | 3300006195 | Bacteria | 5120 |
| 154 | Ga0075366_10019344 | 3300006195 | Bacteria | 3939 |
| 155 | Ga0075366_10056325 | 3300006195 | Bacteria | 2335 |
| 156 | Ga0075366_10169845 | 3300006195 | Bacteria | 1323 |
| 157 | Ga0097621_100000009 | 3300006237 | Bacteria | 114089 |
| 158 | Ga0097621_100558325 | 3300006237 | Bacteria | 1043 |
| 159 | Ga0075370_10031490 | 3300006353 | Bacteria | 2961 |
| 160 | Ga0075370_10081614 | 3300006353 | Bacteria | 1859 |
| 161 | Ga0075370_10103382 | 3300006353 | Bacteria | 1650 |
| 162 | Ga0068871_100000232 | 3300006358 | Bacteria | 39467 |
| 163 | Ga0068871_100234417 | 3300006358 | Bacteria | 1594 |
| 164 | Ga0068871_100506948 | 3300006358 | Unclassified | 1088 |
| 165 | Ga0068871_101099834 | 3300006358 | Unclassified | 743 |
| 166 | Ga0075428_100001999 | 3300006844 | Bacteria | 21962 |
| 167 | Ga0068865_100000307 | 3300006881 | Bacteria | 27001 |
| 168 | Ga0097620_100345553 | 3300006931 | Unclassified | 1582 |
| 169 | Ga0105240_10000003 | 3300009093 | Bacteria | 1183681 |
| 170 | Ga0105240_10000004 | 3300009093 | Bacteria | 708156 |
| 171 | Ga0105240_10000050 | 3300009093 | Bacteria | 236144 |
| 172 | Ga0105240_10001357 | 3300009093 | Bacteria | 42000 |
| 173 | Ga0105240_10002332 | 3300009093 | Bacteria | 30702 |
| 174 | Ga0105240_10118938 | 3300009093 | Bacteria | 3184 |
| 175 | Ga0105240_11323262 | 3300009093 | Unclassified | 759 |
| 176 | Ga0105245_10000002 | 3300009098 | Bacteria | 634374 |
| 177 | Ga0105245_10000200 | 3300009098 | Bacteria | 57196 |
| 178 | Ga0105245_10061919 | 3300009098 | Unclassified | 3375 |
| 179 | Ga0105245_10173800 | 3300009098 | Bacteria | 2053 |
| 180 | Ga0105245_10373504 | 3300009098 | Bacteria | 1418 |
| 181 | Ga0105247_10185438 | 3300009101 | Unclassified | 1391 |
| 182 | Ga0105243_10000001 | 3300009148 | Bacteria | 1156578 |
| 183 | Ga0105243_10032209 | 3300009148 | Unclassified | 4048 |
| 184 | Ga0105241_10000003 | 3300009174 | Bacteria | 839043 |
| 185 | Ga0105241_10000842 | 3300009174 | Bacteria | 23254 |
| 186 | Ga0105241_10082024 | 3300009174 | Bacteria | 2527 |
| 187 | Ga0105241_10263637 | 3300009174 | Bacteria | 1465 |
| 188 | Ga0105241_10448771 | 3300009174 | Bacteria | 1140 |
| 189 | Ga0105242_10000001 | 3300009176 | Bacteria | 574039 |
| 190 | Ga0105242_10002087 | 3300009176 | Bacteria | 15739 |
| 191 | Ga0105242_10013893 | 3300009176 | Bacteria | 6231 |
| 192 | Ga0105248_10201081 | 3300009177 | Bacteria | 2245 |
| 193 | Ga0105248_10434691 | 3300009177 | Bacteria | 1478 |
| 194 | Ga0105248_10789385 | 3300009177 | Bacteria | 1072 |
| 195 | Ga0105248_11612672 | 3300009177 | Bacteria | 735 |
| 196 | Ga0105237_10000001 | 3300009545 | Bacteria | 1009213 |
| 197 | Ga0105237_10000002 | 3300009545 | Bacteria | 702357 |
| 198 | Ga0105237_10009293 | 3300009545 | Bacteria | 10533 |
| 199 | Ga0105237_10044114 | 3300009545 | Bacteria | 4490 |
| 200 | Ga0105237_10061315 | 3300009545 | Bacteria | 3761 |
| 201 | Ga0105237_11130283 | 3300009545 | Unclassified | 790 |
| 202 | Ga0105237_11683392 | 3300009545 | Unclassified | 641 |
| 203 | Ga0105238_10020346 | 3300009551 | Bacteria | 6755 |
| 204 | Ga0105238_10100206 | 3300009551 | Bacteria | 2880 |
| 205 | Ga0105238_10140584 | 3300009551 | Bacteria | 2391 |
| 206 | Ga0105249_10131763 | 3300009553 | Bacteria | 2388 |
| 207 | Ga0105249_10351772 | 3300009553 | Bacteria | 1493 |
| 208 | Ga0105032_100001 | 3300009979 | Bacteria | 472394 |
| 209 | Ga0105032_100020 | 3300009979 | Bacteria | 43175 |
| 210 | Ga0105029_100086 | 3300009984 | Bacteria | 4492 |
| 211 | Ga0105028_100263 | 3300009993 | Bacteria | 5723 |
| 212 | Ga0105239_10001223 | 3300010375 | Bacteria | 35012 |
| 213 | Ga0105239_10031923 | 3300010375 | Bacteria | 5787 |
| 214 | Ga0105239_10038093 | 3300010375 | Bacteria | 5268 |
| 215 | Ga0105239_10039896 | 3300010375 | Bacteria | 5143 |
| 216 | Ga0105239_10610835 | 3300010375 | Bacteria | 1244 |
| 217 | Ga0105239_10853134 | 3300010375 | Bacteria | 1044 |
| 218 | Ga0105246_10010028 | 3300011119 | Bacteria | 5845 |
| 219 | Ga0105246_10014924 | 3300011119 | Bacteria | 4896 |
| 220 | Ga0105246_10052123 | 3300011119 | Bacteria | 2811 |
| 221 | Ga0157373_10000061 | 3300013100 | Bacteria | 95718 |
| 222 | Ga0157373_10043985 | 3300013100 | Bacteria | 3188 |
| 223 | Ga0157373_10094199 | 3300013100 | Bacteria | 2109 |
| 224 | Ga0157373_10104613 | 3300013100 | Unclassified | 1991 |
| 225 | Ga0157373_10936581 | 3300013100 | Bacteria | 644 |
| 226 | Ga0157371_10007527 | 3300013102 | Bacteria | 8809 |
| 227 | Ga0157371_10077928 | 3300013102 | Bacteria | 2347 |
| 228 | Ga0157371_10109435 | 3300013102 | Unclassified | 1961 |
| 229 | Ga0157370_10002357 | 3300013104 | Bacteria | 22781 |
| 230 | Ga0157370_10012318 | 3300013104 | Bacteria | 8877 |
| 231 | Ga0157370_10137441 | 3300013104 | Bacteria | 2277 |
| 232 | Ga0157370_10379496 | 3300013104 | Bacteria | 1302 |
| 233 | Ga0157370_10479916 | 3300013104 | Bacteria | 1142 |
| 234 | Ga0157369_10000029 | 3300013105 | Bacteria | 206955 |
| 235 | Ga0157369_10000151 | 3300013105 | Bacteria | 98331 |
| 236 | Ga0157369_10000190 | 3300013105 | Bacteria | 85077 |
| 237 | Ga0157369_10000567 | 3300013105 | Bacteria | 48628 |
| 238 | Ga0157369_10119188 | 3300013105 | Bacteria | 2801 |
| 239 | Ga0157369_10262848 | 3300013105 | Bacteria | 1800 |
| 240 | Ga0157369_10451879 | 3300013105 | Bacteria | 1331 |
| 241 | Ga0157374_10000073 | 3300013296 | Bacteria | 100517 |
| 242 | Ga0157374_10000096 | 3300013296 | Bacteria | 82179 |
| 243 | Ga0157374_10000389 | 3300013296 | Bacteria | 40308 |
| 244 | Ga0157374_10001423 | 3300013296 | Bacteria | 20253 |
| 245 | Ga0157374_10004073 | 3300013296 | Bacteria | 12275 |
| 246 | Ga0157378_10037888 | 3300013297 | Bacteria | 4273 |
| 247 | Ga0157378_10327382 | 3300013297 | Bacteria | 1490 |
| 248 | Ga0157378_10402379 | 3300013297 | Bacteria | 1349 |
| 249 | Ga0157372_10000002 | 3300013307 | Bacteria | 687862 |
| 250 | Ga0157372_10000086 | 3300013307 | Bacteria | 96247 |
| 251 | Ga0157372_10002447 | 3300013307 | Bacteria | 20124 |
| 252 | Ga0157372_10025726 | 3300013307 | Bacteria | 6402 |
| 253 | Ga0157372_10140272 | 3300013307 | Unclassified | 2784 |
| 254 | Ga0157372_10257262 | 3300013307 | Bacteria | 2027 |
| 255 | Ga0157375_10074210 | 3300013308 | Bacteria | 3422 |
| 256 | Ga0157375_10640535 | 3300013308 | Bacteria | 1220 |
| 257 | Ga0157375_11044856 | 3300013308 | Bacteria | 955 |
| 258 | Ga0157375_11161074 | 3300013308 | Unclassified | 905 |
| 259 | Ga0163163_10251669 | 3300014325 | Bacteria | 1817 |
| 260 | Ga0157377_10000920 | 3300014745 | Bacteria | 12288 |
| 261 | Ga0157377_10001177 | 3300014745 | Bacteria | 11110 |
| 262 | Ga0157377_10622027 | 3300014745 | Unclassified | 773 |
| 263 | Ga0157376_10000001 | 3300014969 | Bacteria | 842910 |
| 264 | Ga0157376_10000027 | 3300014969 | Bacteria | 204157 |
| 265 | Ga0157376_10945670 | 3300014969 | Bacteria | 882 |
| 266 | Ga0207697_10044198 | 3300025315 | Bacteria | 1832 |
| 267 | Ga0207710_10095235 | 3300025900 | Unclassified | 1398 |
| 268 | Ga0207680_10096370 | 3300025903 | Unclassified | 1892 |
| 269 | Ga0207680_10197512 | 3300025903 | Unclassified | 1369 |
| 270 | Ga0207647_10001245 | 3300025904 | Bacteria | 19575 |
| 271 | Ga0207699_10144502 | 3300025906 | Bacteria | 1567 |
| 272 | Ga0207645_10038847 | 3300025907 | Bacteria | 3051 |
| 273 | Ga0207645_10236498 | 3300025907 | Bacteria | 1206 |
| 274 | Ga0207645_10286483 | 3300025907 | Bacteria | 1095 |
| 275 | Ga0207705_10000011 | 3300025909 | Bacteria | 517768 |
| 276 | Ga0207705_10000047 | 3300025909 | Bacteria | 175887 |
| 277 | Ga0207705_10000115 | 3300025909 | Bacteria | 89955 |
| 278 | Ga0207705_10074336 | 3300025909 | Bacteria | 2467 |
| 279 | Ga0207705_10090408 | 3300025909 | Bacteria | 2241 |
| 280 | Ga0207705_10112718 | 3300025909 | Bacteria | 2011 |
| 281 | Ga0207705_10432439 | 3300025909 | Bacteria | 1020 |
| 282 | Ga0207654_10000002 | 3300025911 | Bacteria | 1460142 |
| 283 | Ga0207654_10002956 | 3300025911 | Bacteria | 8617 |
| 284 | Ga0207654_10047071 | 3300025911 | Bacteria | 2462 |
| 285 | Ga0207654_10157340 | 3300025911 | Bacteria | 1464 |
| 286 | Ga0207707_10025748 | 3300025912 | Bacteria | 5145 |
| 287 | Ga0207695_10000005 | 3300025913 | Bacteria | 1196715 |
| 288 | Ga0207695_10000009 | 3300025913 | Bacteria | 1034276 |
| 289 | Ga0207695_10000158 | 3300025913 | Bacteria | 201891 |
| 290 | Ga0207695_10072681 | 3300025913 | Bacteria | 3507 |
| 291 | Ga0207695_10076332 | 3300025913 | Bacteria | 3406 |
| 292 | Ga0207695_10247811 | 3300025913 | Bacteria | 1681 |
| 293 | Ga0207671_10000003 | 3300025914 | Bacteria | 1065461 |
| 294 | Ga0207671_10000008 | 3300025914 | Bacteria | 798229 |
| 295 | Ga0207671_10003661 | 3300025914 | Bacteria | 15170 |
| 296 | Ga0207671_10033531 | 3300025914 | Bacteria | 3818 |
| 297 | Ga0207660_10020375 | 3300025917 | Bacteria | 4448 |
| 298 | Ga0207660_10055049 | 3300025917 | Bacteria | 2841 |
| 299 | Ga0207660_10057958 | 3300025917 | Unclassified | 2776 |
| 300 | Ga0207657_10000712 | 3300025919 | Bacteria | 35358 |
| 301 | Ga0207657_10002562 | 3300025919 | Bacteria | 19664 |
| 302 | Ga0207657_10011048 | 3300025919 | Bacteria | 8976 |
| 303 | Ga0207657_10038978 | 3300025919 | Bacteria | 4225 |
| 304 | Ga0207657_10430137 | 3300025919 | Bacteria | 1037 |
| 305 | Ga0207652_10041373 | 3300025921 | Unclassified | 3917 |
| 306 | Ga0207652_10161876 | 3300025921 | Bacteria | 2006 |
| 307 | Ga0207694_10088559 | 3300025924 | Bacteria | 2440 |
| 308 | Ga0207694_10112347 | 3300025924 | Bacteria | 2168 |
| 309 | Ga0207659_10091373 | 3300025926 | Bacteria | 2274 |
| 310 | Ga0207687_10000001 | 3300025927 | Bacteria | 1130810 |
| 311 | Ga0207687_10000004 | 3300025927 | Bacteria | 841177 |
| 312 | Ga0207687_10001932 | 3300025927 | Bacteria | 14250 |
| 313 | Ga0207687_10075495 | 3300025927 | Unclassified | 2419 |
| 314 | Ga0207687_10209830 | 3300025927 | Bacteria | 1527 |
| 315 | Ga0207644_10000001 | 3300025931 | Bacteria | 1243214 |
| 316 | Ga0207644_10022204 | 3300025931 | Bacteria | 4334 |
| 317 | Ga0207690_10002652 | 3300025932 | Bacteria | 10785 |
| 318 | Ga0207690_10125620 | 3300025932 | Unclassified | 1870 |
| 319 | Ga0207706_10000073 | 3300025933 | Bacteria | 103803 |
| 320 | Ga0207686_10000001 | 3300025934 | Bacteria | 1169580 |
| 321 | Ga0207686_10061860 | 3300025934 | Unclassified | 2375 |
| 322 | Ga0207709_10000002 | 3300025935 | Bacteria | 1171536 |
| 323 | Ga0207709_10049943 | 3300025935 | Unclassified | 2555 |
| 324 | Ga0207670_11398663 | 3300025936 | Unclassified | 594 |
| 325 | Ga0207669_10006666 | 3300025937 | Bacteria | 5292 |
| 326 | Ga0207669_10024885 | 3300025937 | Bacteria | 3225 |
| 327 | Ga0207704_10001468 | 3300025938 | Bacteria | 10545 |
| 328 | Ga0207711_10135448 | 3300025941 | Bacteria | 2212 |
| 329 | Ga0207661_10000077 | 3300025944 | Bacteria | 67190 |
| 330 | Ga0207661_10000129 | 3300025944 | Bacteria | 47940 |
| 331 | Ga0207661_10002445 | 3300025944 | Bacteria | 12778 |
| 332 | Ga0207679_10000124 | 3300025945 | Bacteria | 63038 |
| 333 | Ga0207679_10316443 | 3300025945 | Bacteria | 1350 |
| 334 | Ga0207679_10507067 | 3300025945 | Unclassified | 1077 |
| 335 | Ga0207679_10844895 | 3300025945 | Unclassified | 836 |
| 336 | Ga0207667_10000003 | 3300025949 | Bacteria | 822935 |
| 337 | Ga0207667_10000756 | 3300025949 | Bacteria | 42002 |
| 338 | Ga0207667_10004357 | 3300025949 | Bacteria | 17337 |
| 339 | Ga0207667_10062876 | 3300025949 | Bacteria | 3880 |
| 340 | Ga0207667_10195280 | 3300025949 | Unclassified | 2076 |
| 341 | Ga0207667_10280915 | 3300025949 | Bacteria | 1701 |
| 342 | Ga0207651_10000141 | 3300025960 | Bacteria | 31367 |
| 343 | Ga0207712_10003874 | 3300025961 | Bacteria | 9451 |
| 344 | Ga0207712_10309436 | 3300025961 | Bacteria | 1299 |
| 345 | Ga0207668_10121136 | 3300025972 | Bacteria | 1981 |
| 346 | Ga0207668_11427994 | 3300025972 | Bacteria | 624 |
| 347 | Ga0207640_10019721 | 3300025981 | Bacteria | 3989 |
| 348 | Ga0207658_10000003 | 3300025986 | Bacteria | 1151934 |
| 349 | Ga0207703_10508632 | 3300026035 | Bacteria | 1131 |
| 350 | Ga0207639_10011466 | 3300026041 | Bacteria | 6157 |
| 351 | Ga0207702_10000015 | 3300026078 | Bacteria | 250830 |
| 352 | Ga0207702_10000034 | 3300026078 | Bacteria | 164965 |
| 353 | Ga0207702_10000057 | 3300026078 | Bacteria | 131118 |
| 354 | Ga0207702_10000739 | 3300026078 | Bacteria | 34921 |
| 355 | Ga0207702_10061822 | 3300026078 | Bacteria | 3196 |
| 356 | Ga0207702_10681970 | 3300026078 | Bacteria | 1012 |
| 357 | Ga0207674_10000439 | 3300026116 | Bacteria | 53818 |
| 358 | Ga0207674_10000878 | 3300026116 | Bacteria | 39325 |
| 359 | Ga0207674_10119816 | 3300026116 | Bacteria | 2600 |
| 360 | Ga0207674_10143475 | 3300026116 | Bacteria | 2347 |
| 361 | Ga0207674_10149562 | 3300026116 | Bacteria | 2292 |
| 362 | Ga0207674_10259094 | 3300026116 | Bacteria | 1686 |
| 363 | Ga0207674_11305110 | 3300026116 | Unclassified | 695 |
| 364 | Ga0207683_10030359 | 3300026121 | Bacteria | 4684 |
| 365 | Ga0207698_10000001 | 3300026142 | Bacteria | 625389 |
| 366 | Ga0207698_10000048 | 3300026142 | Bacteria | 90201 |
| 367 | Ga0207698_11249590 | 3300026142 | Bacteria | 757 |
| 368 | Ga0209998_10043572 | 3300027717 | Bacteria | 1024 |
| 369 | Ga0209813_10000335 | 3300027866 | Bacteria | 12250 |
| 370 | Ga0207428_10083905 | 3300027907 | Bacteria | 2483 |
| 371 | Ga0268266_10021620 | 3300028379 | Bacteria | 5480 |
| 372 | Ga0268265_11072907 | 3300028380 | Bacteria | 798 |
| 373 | Ga0268264_10007105 | 3300028381 | Bacteria | 9383 |
| 374 | Ga0265337_1014219 | 3300028556 | Unclassified | 2644 |
| 375 | Ga0265319_1056368 | 3300028563 | Bacteria | 1284 |
| 376 | Ga0265334_10000106 | 3300028573 | Bacteria | 55987 |
| 377 | Ga0265338_10000181 | 3300028800 | Bacteria | 117792 |
| 378 | Ga0265338_10000625 | 3300028800 | Bacteria | 61650 |
| 379 | Ga0265338_10052669 | 3300028800 | Bacteria | 3649 |
| 380 | Ga0314311_1122390 | 3300030733 | Bacteria | 4613 |
| 381 | Ga0316179_1064424 | 3300030734 | Bacteria | 12008 |
| 382 | Ga0316180_1071123 | 3300030736 | Bacteria | 1944 |
| 383 | Ga0316183_1041045 | 3300030742 | Bacteria | 1390 |
| 384 | Ga0316183_1192095 | 3300030742 | Bacteria | 16108 |
| 385 | Ga0316181_1019399 | 3300030744 | Bacteria | 3114 |
| 386 | Ga0316182_1017501 | 3300030745 | Bacteria | 11122 |
| 387 | Ga0316182_1175280 | 3300030745 | Bacteria | 2574 |
| 388 | Ga0316182_1326517 | 3300030745 | Bacteria | 4444 |
| 389 | Ga0316182_1396058 | 3300030745 | Bacteria | 6284 |
| 390 | Ga0265340_10000445 | 3300031247 | Bacteria | 22294 |
| 391 | Ga0265327_10000017 | 3300031251 | Bacteria | 445264 |
| 392 | Ga0265327_10035518 | 3300031251 | Bacteria | 2753 |
| 393 | Ga0265342_10121422 | 3300031712 | Bacteria | 1471 |
| 394 | Ga0307516_10008182 | 3300031730 | Bacteria | 11877 |
| 395 | Ga0307405_10051169 | 3300031731 | Unclassified | 2562 |
| 396 | Ga0307412_10122601 | 3300031911 | Bacteria | 1874 |
| 397 | Ga0395899_0013685 | 3300037312 | Bacteria | 6202 |
| 398 | Ga0395899_0039022 | 3300037312 | Bacteria | 3556 |
| 399 | Ga0395899_0144552 | 3300037312 | Bacteria | 1690 |
| 400 | Ga0395900_0000001 | 3300037418 | Bacteria | 931146 |
| 401 | Ga0395900_0002513 | 3300037418 | Bacteria | 20134 |
| 402 | Ga0395900_0010811 | 3300037418 | Bacteria | 9337 |
| 403 | Ga0395900_0035071 | 3300037418 | Bacteria | 5167 |
| 404 | Ga0395900_0138321 | 3300037418 | Bacteria | 2495 |
| 405 | Ga0395900_0155063 | 3300037418 | Bacteria | 2339 |
| 406 | Ga0395900_0475537 | 3300037418 | Bacteria | 1203 |
| 407 | Ga0395898_0000002 | 3300037466 | Bacteria | 931013 |
| 408 | Ga0395898_0025806 | 3300037466 | Bacteria | 5917 |
| 409 | Ga0395898_0038857 | 3300037466 | Unclassified | 4714 |
| 410 | Ga0395898_0165359 | 3300037466 | Unclassified | 2116 |
| 411 | Ga0395905_0002429 | 3300037471 | Bacteria | 20672 |
| 412 | Ga0395905_0019326 | 3300037471 | Bacteria | 6459 |
| 413 | Ga0395905_0055986 | 3300037471 | Unclassified | 3691 |
| 414 | Ga0395905_0309971 | 3300037471 | Bacteria | 1467 |
| 415 | Ga0395901_0000006 | 3300038443 | Bacteria | 514112 |
| 416 | Ga0395901_0006327 | 3300038443 | Bacteria | 11992 |
| 417 | Ga0395901_0010187 | 3300038443 | Bacteria | 9524 |
| 418 | Ga0395901_0032625 | 3300038443 | Bacteria | 5371 |
| 419 | Ga0395901_0132250 | 3300038443 | Bacteria | 2622 |
| 420 | Ga0439461_0002738 | 3300041410 | Bacteria | 2848 |
| 421 | Ga0451853_0102201 | 3300041512 | Bacteria | 559 |
| 422 | Ga0451853_0725875 | 3300041512 | Bacteria | 703 |
| 423 | Ga0439445_0005738 | 3300042004 | Bacteria | 2836 |
| 424 | Ga0439448_0214674 | 3300042005 | Bacteria | 676 |
| 425 | Ga0439432_007573 | 3300042006 | Bacteria | 3842 |
| 426 | Ga0450920_000808 | 3300042122 | Bacteria | 5051 |
| 427 | Ga0450906_005983 | 3300042145 | Bacteria | 2476 |
| 428 | Ga0439446_0000001 | 3300042156 | Bacteria | 275840 |
| 429 | Ga0450909_001971 | 3300042185 | Bacteria | 2897 |
| 430 | Ga0439464_0000130 | 3300042439 | Bacteria | 11960 |
| 431 | Ga0439464_0036928 | 3300042439 | Bacteria | 1384 |
| 432 | Ga0450918_000617 | 3300042531 | Bacteria | 7630 |
| 433 | Ga0466970_0123694 | 3300044765 | Bacteria | 1418 |
| 434 | Ga0495629_0298073 | 3300046459 | Bacteria | 1104 |
| 435 | Ga0495638_0000132 | 3300046460 | Bacteria | 120039 |
| 436 | Ga0495638_0000551 | 3300046460 | Bacteria | 42775 |
| 437 | Ga0495582_0056117 | 3300046473 | Bacteria | 2171 |
| 438 | Ga0495597_0030047 | 3300046542 | Bacteria | 2478 |
| 439 | Ga0495622_0000502 | 3300046557 | Bacteria | 24435 |
| 440 | Ga0495634_0096185 | 3300046642 | Bacteria | 1918 |
| 441 | Ga0495588_0000171 | 3300046674 | Bacteria | 83176 |
| 442 | Ga0495658_0000641 | 3300046683 | Bacteria | 18915 |
| 443 | Ga0495671_0065105 | 3300046692 | Bacteria | 1794 |
| 444 | Ga0495671_0269845 | 3300046692 | Unclassified | 820 |
| 445 | Ga0495600_0008925 | 3300046809 | Bacteria | 6175 |
| 446 | Ga0495660_0000005 | 3300046810 | Bacteria | 574567 |
| 447 | Ga0495672_0000694 | 3300047320 | Bacteria | 37308 |
| 448 | Ga0495676_0745076 | 3300047321 | Bacteria | 633 |
| 449 | Ga0495681_0201217 | 3300047470 | Bacteria | 808 |
| 450 | Ga0495686_0005549 | 3300047472 | Bacteria | 9924 |
| 451 | Ga0495686_0159155 | 3300047472 | Bacteria | 1321 |
| 452 | Ga0495593_0109795 | 3300047673 | Bacteria | 1409 |
| 453 | Ga0495615_0092397 | 3300048090 | Bacteria | 845 |
| 454 | Ga0496100_0017761 | 3300048903 | Bacteria | 4208 |
| 455 | Ga0496104_0574219 | 3300048907 | Bacteria | 1038 |
| 456 | Ga0496112_0072167 | 3300048915 | Bacteria | 3412 |
| 457 | Ga0496113_0025550 | 3300048916 | Bacteria | 4212 |
| 458 | Ga0501031_0002442 | 3300049568 | Bacteria | 11833 |
| 459 | Ga0501032_0000624 | 3300049569 | Bacteria | 28751 |
| 460 | Ga0501033_0421571 | 3300049570 | Bacteria | 929 |
| 461 | Ga0501034_0000028 | 3300049571 | Bacteria | 255803 |
| 462 | Ga0501034_0006453 | 3300049571 | Bacteria | 12628 |
| 463 | Ga0501034_0009503 | 3300049571 | Bacteria | 10178 |
| 464 | Ga0501034_0868664 | 3300049571 | Bacteria | 791 |
| 465 | Ga0501036_0001666 | 3300049572 | Bacteria | 17221 |
| 466 | Ga0501037_0000001 | 3300049573 | Bacteria | 753276 |
| 467 | Ga0501037_0000031 | 3300049573 | Bacteria | 133137 |
| 468 | Ga0501038_0070790 | 3300049574 | Bacteria | 2960 |
| 469 | Ga0501043_0000366 | 3300049579 | Bacteria | 40919 |
| 470 | Ga0501046_0000138 | 3300049580 | Bacteria | 77052 |
| 471 | Ga0501047_0000032 | 3300049581 | Bacteria | 208294 |
| 472 | Ga0501048_0000013 | 3300049582 | Bacteria | 76554 |
| 473 | Ga0501068_0341900 | 3300049584 | Bacteria | 961 |
| 474 | Ga0501070_0081893 | 3300049586 | Bacteria | 2671 |
| 475 | Ga0501073_0037892 | 3300049589 | Bacteria | 3422 |
| 476 | Ga0501073_0282905 | 3300049589 | Bacteria | 1144 |
| 477 | Ga0501234_003057 | 3300049707 | Bacteria | 2628 |
| 478 | Ga0501083_0011227 | 3300049744 | Bacteria | 6286 |
| 479 | Ga0501083_0025578 | 3300049744 | Bacteria | 4086 |
| 480 | Ga0501035_0000799 | 3300049822 | Bacteria | 33519 |
| 481 | Ga0501044_0037308 | 3300049823 | Bacteria | 5081 |
| 482 | nmdc:mga03683_32384_c1 | 3300050489 | Bacteria | 2103 |
| 483 | nmdc:mga03683_42674_c2 | 3300050489 | Unclassified | 562 |
| 484 | nmdc:mga03683_80_c1 | 3300050489 | Bacteria | 35991 |
| 485 | nmdc:mga00v17_120_c1 | 3300050491 | Bacteria | 46472 |
| 486 | nmdc:mga00v17_162499_c1 | 3300050491 | Bacteria | 1438 |
| 487 | nmdc:mga00v17_177221_c1 | 3300050491 | Bacteria | 1375 |
| 488 | nmdc:mga00v17_2630_c1 | 3300050491 | Bacteria | 8611 |
| 489 | nmdc:mga00v17_293530_c1 | 3300050491 | Bacteria | 1056 |
| 490 | nmdc:mga00v17_3801_c1 | 3300050491 | Bacteria | 5606 |
| 491 | nmdc:mga00v17_461019_c1 | 3300050491 | Unclassified | 825 |
| 492 | nmdc:mga00v17_5335_c1 | 3300050491 | Bacteria | 6314 |
| 493 | nmdc:mga00v17_56476_c1 | 3300050491 | Unclassified | 2400 |
| 494 | nmdc:mga0yw44_112386_c1 | 3300050492 | Bacteria | 1747 |
| 495 | nmdc:mga0yw44_128525_c1 | 3300050492 | Bacteria | 1638 |
| 496 | nmdc:mga0yw44_16_c1 | 3300050492 | Bacteria | 80085 |
| 497 | nmdc:mga0yw44_1_c1 | 3300050492 | Bacteria | 702221 |
| 498 | nmdc:mga0yw44_21337_c1 | 3300050492 | Bacteria | 3611 |
| 499 | nmdc:mga0yw44_2_c1 | 3300050492 | Bacteria | 586884 |
| 500 | nmdc:mga0yw44_3147_c1 | 3300050492 | Bacteria | 7247 |
| 501 | nmdc:mga0yw44_4_c1 | 3300050492 | Bacteria | 450247 |
| 502 | nmdc:mga0yw44_523976_c1 | 3300050492 | Bacteria | 804 |
| 503 | nmdc:mga0yw44_703768_c1 | 3300050492 | Unclassified | 686 |
| 504 | nmdc:mga0yw44_84798_c1 | 3300050492 | Unclassified | 1992 |
| 505 | nmdc:mga0k408_118_c1 | 3300050493 | Bacteria | 11075 |
| 506 | nmdc:mga0k408_159617_c1 | 3300050493 | Bacteria | 1343 |
| 507 | nmdc:mga0k408_1_c1 | 3300050493 | Bacteria | 1089059 |
| 508 | nmdc:mga0k408_214_c1 | 3300050493 | Bacteria | 31125 |
| 509 | nmdc:mga0k408_2889_c1 | 3300050493 | Bacteria | 9112 |
| 510 | nmdc:mga0k408_3696_c1 | 3300050493 | Bacteria | 7332 |
| 511 | nmdc:mga0k408_3708_c1 | 3300050493 | Bacteria | 8095 |
| 512 | nmdc:mga0k408_4209_c3 | 3300050493 | Bacteria | 2379 |
| 513 | nmdc:mga06z11_127_c1 | 3300050494 | Bacteria | 25603 |
| 514 | nmdc:mga06z11_198_c1 | 3300050494 | Bacteria | 24266 |
| 515 | nmdc:mga06z11_249319_c1 | 3300050494 | Unclassified | 1045 |
| 516 | nmdc:mga06z11_58210_c1 | 3300050494 | Bacteria | 2004 |
| 517 | nmdc:mga06z11_728833_c1 | 3300050494 | Unclassified | 604 |
| 518 | nmdc:mga04h51_202516_c1 | 3300050495 | Bacteria | 780 |
| 519 | nmdc:mga04h51_251_c1 | 3300050495 | Bacteria | 14040 |
| 520 | nmdc:mga07m45_10022_c1 | 3300050496 | Bacteria | 4932 |
| 521 | nmdc:mga07m45_148205_c1 | 3300050496 | Bacteria | 1360 |
| 522 | nmdc:mga07m45_248674_c1 | 3300050496 | Bacteria | 1035 |
| 523 | nmdc:mga08y16_5295_c1 | 3300050511 | Bacteria | 13491 |
| 524 | nmdc:mga0sz30_13016_c1 | 3300050516 | Bacteria | 3248 |
| 525 | nmdc:mga0sz30_1978_c2 | 3300050516 | Bacteria | 2048 |
| 526 | nmdc:mga0sz30_1_c1 | 3300050516 | Bacteria | 796501 |
| 527 | nmdc:mga0sz30_256333_c1 | 3300050516 | Unclassified | 779 |
| 528 | nmdc:mga0sz30_3_c9 | 3300050516 | Bacteria | 81468 |
| 529 | Ga0500610_0051662 | 3300053079 | Unclassified | 2141 |
| 530 | Ga0500643_000022 | 3300053087 | Bacteria | 277519 |
| 531 | Ga0500643_000148 | 3300053087 | Bacteria | 71560 |
| 532 | Ga0500643_003568 | 3300053087 | Bacteria | 7402 |
| 533 | Ga0500644_0001037 | 3300053088 | Bacteria | 8346 |
| 534 | Ga0500644_0007239 | 3300053088 | Bacteria | 2883 |
| 535 | Ga0500644_0012144 | 3300053088 | Bacteria | 2374 |
| 536 | Ga0500644_0472856 | 3300053088 | Unclassified | 550 |
| 537 | Ga0500646_0000007 | 3300053090 | Bacteria | 115744 |
| 538 | Ga0500646_0000805 | 3300053090 | Bacteria | 8705 |
| 539 | Ga0500646_0046835 | 3300053090 | Bacteria | 1235 |
| 540 | Ga0500583_0000082 | 3300053092 | Bacteria | 54810 |
| 541 | Ga0500583_0011114 | 3300053092 | Bacteria | 3378 |
| 542 | Ga0500583_0014634 | 3300053092 | Bacteria | 3079 |
| 543 | Ga0500583_0015409 | 3300053092 | Bacteria | 3023 |
| 544 | Ga0500583_0291472 | 3300053092 | Bacteria | 800 |
| 545 | Ga0500651_0000191 | 3300053093 | Bacteria | 39269 |
| 546 | Ga0500651_0009366 | 3300053093 | Bacteria | 5812 |
| 547 | Ga0500651_0287179 | 3300053093 | Unclassified | 947 |
| 548 | Ga0500566_0000001 | 3300053094 | Bacteria | 1101031 |
| 549 | Ga0500641_0000001 | 3300053096 | Bacteria | 1115973 |
| 550 | Ga0500650_0000001 | 3300053098 | Bacteria | 818797 |
| 551 | Ga0500555_000001 | 3300053103 | Bacteria | 1353713 |
| 552 | Ga0500555_000009 | 3300053103 | Bacteria | 263998 |
| 553 | Ga0500562_009692 | 3300053108 | Bacteria | 2435 |
| 554 | Ga0500569_000018 | 3300053109 | Bacteria | 42775 |
| 555 | Ga0500594_0000001 | 3300053118 | Bacteria | 1178472 |
| 556 | Ga0500614_000001 | 3300053123 | Bacteria | 1274484 |
| 557 | Ga0500614_002185 | 3300053123 | Unclassified | 4442 |
| 558 | Ga0500642_0016865 | 3300053130 | Bacteria | 2785 |
| 559 | Ga0500652_000001 | 3300053131 | Bacteria | 946868 |
| 560 | Ga0500652_136312 | 3300053131 | Bacteria | 1023 |
| 561 | Ga0500655_001617 | 3300053133 | Bacteria | 4244 |
| 562 | Ga0500559_0006860 | 3300053136 | Bacteria | 5104 |
| 563 | Ga0500568_0031933 | 3300053139 | Bacteria | 2168 |
| 564 | Ga0500577_0000528 | 3300053142 | Bacteria | 9883 |
| 565 | Ga0500577_0014179 | 3300053142 | Bacteria | 2456 |
| 566 | Ga0500577_0054346 | 3300053142 | Bacteria | 1517 |
| 567 | Ga0500579_000781 | 3300053143 | Bacteria | 18261 |
| 568 | Ga0500588_0000752 | 3300053146 | Bacteria | 5553 |
| 569 | Ga0500589_000013 | 3300053147 | Bacteria | 109118 |
| 570 | Ga0500589_025605 | 3300053147 | Bacteria | 2734 |
| 571 | Ga0500589_202833 | 3300053147 | Bacteria | 760 |
| 572 | Ga0500604_0014397 | 3300053151 | Bacteria | 2154 |
| 573 | Ga0500604_0049606 | 3300053151 | Bacteria | 1291 |
| 574 | Ga0500616_0000005 | 3300053153 | Bacteria | 961725 |
| 575 | Ga0500616_0000012 | 3300053153 | Bacteria | 681798 |
| 576 | Ga0500616_0015635 | 3300053153 | Bacteria | 4334 |
| 577 | Ga0500616_0025837 | 3300053153 | Bacteria | 3256 |
| 578 | Ga0500649_000004 | 3300053722 | Bacteria | 139374 |
| 579 | Ga0500570_008150 | 3300053724 | Bacteria | 5773 |
| 580 | Ga0500570_070171 | 3300053724 | Bacteria | 1639 |
| 581 | Ga0500611_004452 | 3300053727 | Bacteria | 1891 |
| 582 | Ga0500656_002995 | 3300053732 | Bacteria | 1558 |
| 583 | Ga0590077_054771 | 3300059426 | Bacteria | 899 |
| 584 | Ga0501082_0152578 | 3300060353 | Bacteria | 2007 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005336 | Ga0070680_100129715 | Ga0070680_1001297152 | 148 |
| 2 | 3300005458 | Ga0070681_10143721 | Ga0070681_101437213 | 148 |
| 3 | 3300005530 | Ga0070679_100045653 | Ga0070679_1000456533 | 148 |
| 4 | 3300025917 | Ga0207660_10055049 | Ga0207660_100550493 | 148 |
| 5 | 3300025921 | Ga0207652_10161876 | Ga0207652_101618763 | 148 |
| 6 | 3300025927 | Ga0207687_10000004 | Ga0207687_10000004768 | 148 |
| 7 | 3300037312 | Ga0395899_0013685 | Ga0395899_0013685_1683_2186 | 148 |
| 8 | 3300037418 | Ga0395900_0010811 | Ga0395900_0010811_2692_3195 | 148 |
| 9 | 3300037466 | Ga0395898_0038857 | Ga0395898_0038857_591_1094 | 148 |
| 10 | 3300037471 | Ga0395905_0055986 | Ga0395905_0055986_1989_2492 | 148 |
| 11 | 3300038443 | Ga0395901_0032625 | Ga0395901_0032625_215_718 | 148 |
| 12 | 3300003911 | JGI25405J52794_10007214 | JGI25405J52794_100072143 | 149 |
| 13 | 3300005327 | Ga0070658_10000015 | Ga0070658_10000015176 | 149 |
| 14 | 3300005327 | Ga0070658_10034417 | Ga0070658_100344174 | 149 |
| 15 | 3300005336 | Ga0070680_100053143 | Ga0070680_1000531435 | 149 |
| 16 | 3300005339 | Ga0070660_100000346 | Ga0070660_10000034616 | 149 |
| 17 | 3300005339 | Ga0070660_100027199 | Ga0070660_1000271992 | 149 |
| 18 | 3300005366 | Ga0070659_100359880 | Ga0070659_1003598802 | 149 |
| 19 | 3300005530 | Ga0070679_100113775 | Ga0070679_1001137752 | 149 |
| 20 | 3300005614 | Ga0068856_100106228 | Ga0068856_1001062285 | 149 |
| 21 | 3300005937 | Ga0081455_10000008 | Ga0081455_1000000810 | 149 |
| 22 | 3300013296 | Ga0157374_10000389 | Ga0157374_1000038940 | 149 |
| 23 | 3300013307 | Ga0157372_10140272 | Ga0157372_101402723 | 149 |
| 24 | 3300014745 | Ga0157377_10001177 | Ga0157377_1000117714 | 149 |
| 25 | 3300025909 | Ga0207705_10000011 | Ga0207705_10000011170 | 149 |
| 26 | 3300025909 | Ga0207705_10090408 | Ga0207705_100904082 | 149 |
| 27 | 3300025917 | Ga0207660_10057958 | Ga0207660_100579583 | 149 |
| 28 | 3300025919 | Ga0207657_10000712 | Ga0207657_100007124 | 149 |
| 29 | 3300025919 | Ga0207657_10038978 | Ga0207657_100389786 | 149 |
| 30 | 3300025921 | Ga0207652_10041373 | Ga0207652_100413733 | 149 |
| 31 | 3300031251 | Ga0265327_10000017 | Ga0265327_100000176 | 149 |
| 32 | 3300031251 | Ga0265327_10035518 | Ga0265327_100355185 | 149 |
| 33 | 3300037418 | Ga0395900_0002513 | Ga0395900_0002513_16654_17157 | 149 |
| 34 | 3300037418 | Ga0395900_0035071 | Ga0395900_0035071_1757_2263 | 149 |
| 35 | 3300037418 | Ga0395900_0155063 | Ga0395900_0155063_329_832 | 149 |
| 36 | 3300037466 | Ga0395898_0025806 | Ga0395898_0025806_3085_3591 | 149 |
| 37 | 3300037466 | Ga0395898_0165359 | Ga0395898_0165359_85_588 | 149 |
| 38 | 3300037471 | Ga0395905_0002429 | Ga0395905_0002429_14184_14690 | 149 |
| 39 | 3300037471 | Ga0395905_0309971 | Ga0395905_0309971_872_1375 | 149 |
| 40 | 3300038443 | Ga0395901_0010187 | Ga0395901_0010187_4587_5090 | 149 |
| 41 | 3300049568 | Ga0501031_0002442 | Ga0501031_0002442_9091_9591 | 149 |
| 42 | 3300049569 | Ga0501032_0000624 | Ga0501032_0000624_3980_4480 | 149 |
| 43 | 3300049570 | Ga0501033_0421571 | Ga0501033_0421571_184_684 | 149 |
| 44 | 3300049571 | Ga0501034_0006453 | Ga0501034_0006453_10376_10876 | 149 |
| 45 | 3300049572 | Ga0501036_0001666 | Ga0501036_0001666_3120_3620 | 149 |
| 46 | 3300049573 | Ga0501037_0000031 | Ga0501037_0000031_114888_115388 | 149 |
| 47 | 3300049579 | Ga0501043_0000366 | Ga0501043_0000366_10561_11061 | 149 |
| 48 | 3300049580 | Ga0501046_0000138 | Ga0501046_0000138_3356_3856 | 149 |
| 49 | 3300049581 | Ga0501047_0000032 | Ga0501047_0000032_35035_35535 | 149 |
| 50 | 3300049582 | Ga0501048_0000013 | Ga0501048_0000013_42622_43122 | 149 |
| 51 | 3300049584 | Ga0501068_0341900 | Ga0501068_0341900_67_567 | 149 |
| 52 | 3300049586 | Ga0501070_0081893 | Ga0501070_0081893_1962_2462 | 149 |
| 53 | 3300049589 | Ga0501073_0037892 | Ga0501073_0037892_2687_3187 | 149 |
| 54 | 3300049744 | Ga0501083_0025578 | Ga0501083_0025578_2204_2704 | 149 |
| 55 | 3300049822 | Ga0501035_0000799 | Ga0501035_0000799_24096_24596 | 149 |
| 56 | 3300049823 | Ga0501044_0037308 | Ga0501044_0037308_1353_1853 | 149 |
| 57 | 3300060353 | Ga0501082_0152578 | Ga0501082_0152578_504_1004 | 149 |
| 58 | 3300001979 | JGI24740J21852_10005605 | JGI24740J21852_100056053 | 150 |
| 59 | 3300001979 | JGI24740J21852_10047586 | JGI24740J21852_100475861 | 150 |
| 60 | 3300002067 | JGI24735J21928_10000075 | JGI24735J21928_1000007537 | 150 |
| 61 | 3300003320 | rootH2_10000244 | rootH2_10000244538 | 150 |
| 62 | 3300005328 | Ga0070676_10239783 | Ga0070676_102397832 | 150 |
| 63 | 3300005329 | Ga0070683_100000505 | Ga0070683_1000005057 | 150 |
| 64 | 3300005329 | Ga0070683_100428918 | Ga0070683_1004289181 | 150 |
| 65 | 3300005331 | Ga0070670_100738903 | Ga0070670_1007389031 | 150 |
| 66 | 3300005335 | Ga0070666_10004519 | Ga0070666_1000451910 | 150 |
| 67 | 3300005335 | Ga0070666_10128410 | Ga0070666_101284104 | 150 |
| 68 | 3300005336 | Ga0070680_100038020 | Ga0070680_1000380204 | 150 |
| 69 | 3300005336 | Ga0070680_100092015 | Ga0070680_1000920152 | 150 |
| 70 | 3300005354 | Ga0070675_101120741 | Ga0070675_1011207411 | 150 |
| 71 | 3300005355 | Ga0070671_100000001 | Ga0070671_100000001650 | 150 |
| 72 | 3300005356 | Ga0070674_101533982 | Ga0070674_1015339821 | 150 |
| 73 | 3300005366 | Ga0070659_101706293 | Ga0070659_1017062931 | 150 |
| 74 | 3300005367 | Ga0070667_100000001 | Ga0070667_100000001612 | 150 |
| 75 | 3300005458 | Ga0070681_10111539 | Ga0070681_101115394 | 150 |
| 76 | 3300005530 | Ga0070679_100438440 | Ga0070679_1004384402 | 150 |
| 77 | 3300005535 | Ga0070684_100013686 | Ga0070684_1000136866 | 150 |
| 78 | 3300005563 | Ga0068855_100042951 | Ga0068855_1000429517 | 150 |
| 79 | 3300005563 | Ga0068855_100770916 | Ga0068855_1007709162 | 150 |
| 80 | 3300005577 | Ga0068857_100102988 | Ga0068857_1001029882 | 150 |
| 81 | 3300005614 | Ga0068856_100000445 | Ga0068856_10000044551 | 150 |
| 82 | 3300005617 | Ga0068859_100345560 | Ga0068859_1003455604 | 150 |
| 83 | 3300005719 | Ga0068861_100103735 | Ga0068861_1001037354 | 150 |
| 84 | 3300005719 | Ga0068861_100918014 | Ga0068861_1009180142 | 150 |
| 85 | 3300005843 | Ga0068860_100004772 | Ga0068860_10000477215 | 150 |
| 86 | 3300006038 | Ga0075365_10000009 | Ga0075365_1000000967 | 150 |
| 87 | 3300006038 | Ga0075365_10390927 | Ga0075365_103909272 | 150 |
| 88 | 3300006048 | Ga0075363_100112350 | Ga0075363_1001123502 | 150 |
| 89 | 3300006051 | Ga0075364_10003371 | Ga0075364_100033715 | 150 |
| 90 | 3300006051 | Ga0075364_10064884 | Ga0075364_100648844 | 150 |
| 91 | 3300006051 | Ga0075364_10214920 | Ga0075364_102149202 | 150 |
| 92 | 3300006177 | Ga0075362_10000063 | Ga0075362_1000006320 | 150 |
| 93 | 3300006178 | Ga0075367_10000093 | Ga0075367_1000009321 | 150 |
| 94 | 3300006178 | Ga0075367_10261139 | Ga0075367_102611392 | 150 |
| 95 | 3300006178 | Ga0075367_10287429 | Ga0075367_102874292 | 150 |
| 96 | 3300006186 | Ga0075369_10000001 | Ga0075369_1000000110 | 150 |
| 97 | 3300006186 | Ga0075369_10000010 | Ga0075369_100000106 | 150 |
| 98 | 3300006195 | Ga0075366_10000001 | Ga0075366_10000001561 | 150 |
| 99 | 3300006195 | Ga0075366_10001109 | Ga0075366_100011097 | 150 |
| 100 | 3300006195 | Ga0075366_10001938 | Ga0075366_1000193813 | 150 |
| 101 | 3300006195 | Ga0075366_10019344 | Ga0075366_100193445 | 150 |
| 102 | 3300006237 | Ga0097621_100000009 | Ga0097621_100000009107 | 150 |
| 103 | 3300006353 | Ga0075370_10081614 | Ga0075370_100816142 | 150 |
| 104 | 3300006358 | Ga0068871_100000232 | Ga0068871_10000023212 | 150 |
| 105 | 3300006358 | Ga0068871_100506948 | Ga0068871_1005069482 | 150 |
| 106 | 3300006931 | Ga0097620_100345553 | Ga0097620_1003455534 | 150 |
| 107 | 3300009093 | Ga0105240_10002332 | Ga0105240_1000233228 | 150 |
| 108 | 3300009098 | Ga0105245_10000002 | Ga0105245_1000000213 | 150 |
| 109 | 3300009148 | Ga0105243_10032209 | Ga0105243_100322094 | 150 |
| 110 | 3300009174 | Ga0105241_10000003 | Ga0105241_10000003345 | 150 |
| 111 | 3300009174 | Ga0105241_10000842 | Ga0105241_1000084220 | 150 |
| 112 | 3300009545 | Ga0105237_10044114 | Ga0105237_100441144 | 150 |
| 113 | 3300009551 | Ga0105238_10100206 | Ga0105238_101002062 | 150 |
| 114 | 3300009553 | Ga0105249_10131763 | Ga0105249_101317632 | 150 |
| 115 | 3300009553 | Ga0105249_10351772 | Ga0105249_103517722 | 150 |
| 116 | 3300009993 | Ga0105028_100263 | Ga0105028_1002632 | 150 |
| 117 | 3300010375 | Ga0105239_10039896 | Ga0105239_100398965 | 150 |
| 118 | 3300010375 | Ga0105239_10610835 | Ga0105239_106108352 | 150 |
| 119 | 3300013100 | Ga0157373_10000061 | Ga0157373_1000006150 | 150 |
| 120 | 3300013100 | Ga0157373_10104613 | Ga0157373_101046132 | 150 |
| 121 | 3300013104 | Ga0157370_10379496 | Ga0157370_103794962 | 150 |
| 122 | 3300013104 | Ga0157370_10479916 | Ga0157370_104799162 | 150 |
| 123 | 3300013105 | Ga0157369_10262848 | Ga0157369_102628482 | 150 |
| 124 | 3300013296 | Ga0157374_10000073 | Ga0157374_1000007390 | 150 |
| 125 | 3300013296 | Ga0157374_10001423 | Ga0157374_1000142322 | 150 |
| 126 | 3300013297 | Ga0157378_10402379 | Ga0157378_104023792 | 150 |
| 127 | 3300013307 | Ga0157372_10002447 | Ga0157372_1000244710 | 150 |
| 128 | 3300013308 | Ga0157375_11044856 | Ga0157375_110448562 | 150 |
| 129 | 3300013308 | Ga0157375_11161074 | Ga0157375_111610742 | 150 |
| 130 | 3300014745 | Ga0157377_10622027 | Ga0157377_106220272 | 150 |
| 131 | 3300025903 | Ga0207680_10096370 | Ga0207680_100963704 | 150 |
| 132 | 3300025903 | Ga0207680_10197512 | Ga0207680_101975121 | 150 |
| 133 | 3300025907 | Ga0207645_10236498 | Ga0207645_102364982 | 150 |
| 134 | 3300025911 | Ga0207654_10000002 | Ga0207654_10000002862 | 150 |
| 135 | 3300025911 | Ga0207654_10002956 | Ga0207654_100029562 | 150 |
| 136 | 3300025913 | Ga0207695_10072681 | Ga0207695_100726815 | 150 |
| 137 | 3300025917 | Ga0207660_10020375 | Ga0207660_100203753 | 150 |
| 138 | 3300025927 | Ga0207687_10000001 | Ga0207687_100000011197 | 150 |
| 139 | 3300025931 | Ga0207644_10000001 | Ga0207644_10000001786 | 150 |
| 140 | 3300025935 | Ga0207709_10049943 | Ga0207709_100499434 | 150 |
| 141 | 3300025936 | Ga0207670_11398663 | Ga0207670_113986631 | 150 |
| 142 | 3300025944 | Ga0207661_10000129 | Ga0207661_100001297 | 150 |
| 143 | 3300025945 | Ga0207679_10844895 | Ga0207679_108448952 | 150 |
| 144 | 3300025949 | Ga0207667_10000003 | Ga0207667_1000000348 | 150 |
| 145 | 3300025949 | Ga0207667_10062876 | Ga0207667_100628764 | 150 |
| 146 | 3300025961 | Ga0207712_10003874 | Ga0207712_1000387412 | 150 |
| 147 | 3300025961 | Ga0207712_10309436 | Ga0207712_103094362 | 150 |
| 148 | 3300025972 | Ga0207668_11427994 | Ga0207668_114279942 | 150 |
| 149 | 3300025986 | Ga0207658_10000003 | Ga0207658_10000003769 | 150 |
| 150 | 3300026078 | Ga0207702_10000739 | Ga0207702_1000073922 | 150 |
| 151 | 3300026116 | Ga0207674_10259094 | Ga0207674_102590943 | 150 |
| 152 | 3300027717 | Ga0209998_10043572 | Ga0209998_100435722 | 150 |
| 153 | 3300027907 | Ga0207428_10083905 | Ga0207428_100839052 | 150 |
| 154 | 3300028381 | Ga0268264_10007105 | Ga0268264_100071058 | 150 |
| 155 | 3300028563 | Ga0265319_1056368 | Ga0265319_10563682 | 150 |
| 156 | 3300046459 | Ga0495629_0298073 | Ga0495629_0298073_416_916 | 150 |
| 157 | 3300046473 | Ga0495582_0056117 | Ga0495582_0056117_1049_1549 | 150 |
| 158 | 3300046557 | Ga0495622_0000502 | Ga0495622_0000502_23230_23730 | 150 |
| 159 | 3300046674 | Ga0495588_0000171 | Ga0495588_0000171_3547_4047 | 150 |
| 160 | 3300046683 | Ga0495658_0000641 | Ga0495658_0000641_11236_11736 | 150 |
| 161 | 3300046692 | Ga0495671_0269845 | Ga0495671_0269845_103_606 | 150 |
| 162 | 3300046809 | Ga0495600_0008925 | Ga0495600_0008925_2044_2544 | 150 |
| 163 | 3300047320 | Ga0495672_0000694 | Ga0495672_0000694_29886_30386 | 150 |
| 164 | 3300047321 | Ga0495676_0745076 | Ga0495676_0745076_39_539 | 150 |
| 165 | 3300047472 | Ga0495686_0159155 | Ga0495686_0159155_754_1254 | 150 |
| 166 | 3300047673 | Ga0495593_0109795 | Ga0495593_0109795_570_1070 | 150 |
| 167 | 3300049571 | Ga0501034_0868664 | Ga0501034_0868664_132_641 | 150 |
| 168 | 3300049589 | Ga0501073_0282905 | Ga0501073_0282905_539_1039 | 150 |
| 169 | 3300049744 | Ga0501083_0011227 | Ga0501083_0011227_5287_5787 | 150 |
| 170 | 3300050489 | nmdc:mga03683_42674_c2 | nmdc:mga03683_42674_c2_38_538 | 150 |
| 171 | 3300050489 | nmdc:mga03683_80_c1 | nmdc:mga03683_80_c1_18313_18813 | 150 |
| 172 | 3300050491 | nmdc:mga00v17_177221_c1 | nmdc:mga00v17_177221_c1_103_603 | 150 |
| 173 | 3300050491 | nmdc:mga00v17_2630_c1 | nmdc:mga00v17_2630_c1_7801_8301 | 150 |
| 174 | 3300050491 | nmdc:mga00v17_293530_c1 | nmdc:mga00v17_293530_c1_195_698 | 150 |
| 175 | 3300050491 | nmdc:mga00v17_3801_c1 | nmdc:mga00v17_3801_c1_320_838 | 150 |
| 176 | 3300050491 | nmdc:mga00v17_461019_c1 | nmdc:mga00v17_461019_c1_168_668 | 150 |
| 177 | 3300050491 | nmdc:mga00v17_5335_c1 | nmdc:mga00v17_5335_c1_161_664 | 150 |
| 178 | 3300050491 | nmdc:mga00v17_56476_c1 | nmdc:mga00v17_56476_c1_99_602 | 150 |
| 179 | 3300050492 | nmdc:mga0yw44_112386_c1 | nmdc:mga0yw44_112386_c1_141_644 | 150 |
| 180 | 3300050492 | nmdc:mga0yw44_21337_c1 | nmdc:mga0yw44_21337_c1_1088_1591 | 150 |
| 181 | 3300050492 | nmdc:mga0yw44_2_c1 | nmdc:mga0yw44_2_c1_81486_81986 | 150 |
| 182 | 3300050492 | nmdc:mga0yw44_703768_c1 | nmdc:mga0yw44_703768_c1_150_653 | 150 |
| 183 | 3300050492 | nmdc:mga0yw44_84798_c1 | nmdc:mga0yw44_84798_c1_1331_1849 | 150 |
| 184 | 3300050493 | nmdc:mga0k408_118_c1 | nmdc:mga0k408_118_c1_1661_2164 | 150 |
| 185 | 3300050493 | nmdc:mga0k408_1_c1 | nmdc:mga0k408_1_c1_565557_566057 | 150 |
| 186 | 3300050493 | nmdc:mga0k408_214_c1 | nmdc:mga0k408_214_c1_3174_3677 | 150 |
| 187 | 3300050493 | nmdc:mga0k408_2889_c1 | nmdc:mga0k408_2889_c1_2584_3078 | 150 |
| 188 | 3300050493 | nmdc:mga0k408_3708_c1 | nmdc:mga0k408_3708_c1_7142_7645 | 150 |
| 189 | 3300050494 | nmdc:mga06z11_127_c1 | nmdc:mga06z11_127_c1_6098_6601 | 150 |
| 190 | 3300050494 | nmdc:mga06z11_249319_c1 | nmdc:mga06z11_249319_c1_424_924 | 150 |
| 191 | 3300050494 | nmdc:mga06z11_728833_c1 | nmdc:mga06z11_728833_c1_84_578 | 150 |
| 192 | 3300050511 | nmdc:mga08y16_5295_c1 | nmdc:mga08y16_5295_c1_7171_7668 | 150 |
| 193 | 3300050516 | nmdc:mga0sz30_1_c1 | nmdc:mga0sz30_1_c1_68433_68933 | 150 |
| 194 | 3300050516 | nmdc:mga0sz30_256333_c1 | nmdc:mga0sz30_256333_c1_33_536 | 150 |
| 195 | 3300050516 | nmdc:mga0sz30_3_c9 | nmdc:mga0sz30_3_c9_74016_74516 | 150 |
| 196 | 3300053079 | Ga0500610_0051662 | Ga0500610_0051662_1239_1739 | 150 |
| 197 | 3300053087 | Ga0500643_000148 | Ga0500643_000148_13233_13736 | 150 |
| 198 | 3300053088 | Ga0500644_0001037 | Ga0500644_0001037_4810_5310 | 150 |
| 199 | 3300053092 | Ga0500583_0000082 | Ga0500583_0000082_29641_30141 | 150 |
| 200 | 3300053092 | Ga0500583_0015409 | Ga0500583_0015409_701_1204 | 150 |
| 201 | 3300053094 | Ga0500566_0000001 | Ga0500566_0000001_526739_527239 | 150 |
| 202 | 3300053103 | Ga0500555_000001 | Ga0500555_000001_573239_573739 | 150 |
| 203 | 3300053123 | Ga0500614_000001 | Ga0500614_000001_438142_438642 | 150 |
| 204 | 3300053130 | Ga0500642_0016865 | Ga0500642_0016865_608_1108 | 150 |
| 205 | 3300053136 | Ga0500559_0006860 | Ga0500559_0006860_3046_3546 | 150 |
| 206 | 3300053142 | Ga0500577_0000528 | Ga0500577_0000528_7498_7998 | 150 |
| 207 | 3300053147 | Ga0500589_000013 | Ga0500589_000013_73994_74494 | 150 |
| 208 | 3300053147 | Ga0500589_025605 | Ga0500589_025605_1256_1759 | 150 |
| 209 | 3300053147 | Ga0500589_202833 | Ga0500589_202833_48_557 | 150 |
| 210 | 3300053151 | Ga0500604_0014397 | Ga0500604_0014397_980_1480 | 150 |
| 211 | 3300053722 | Ga0500649_000004 | Ga0500649_000004_106544_107044 | 150 |
| 212 | 3300053727 | Ga0500611_004452 | Ga0500611_004452_60_560 | 150 |
| 213 | 3300003320 | rootH2_10206709 | rootH2_102067091 | 151 |
| 214 | 3300003322 | rootL2_10247150 | rootL2_102471503 | 151 |
| 215 | 3300003323 | rootH1_10311088 | rootH1_103110888 | 151 |
| 216 | 3300005327 | Ga0070658_10000020 | Ga0070658_1000002053 | 151 |
| 217 | 3300005327 | Ga0070658_10006516 | Ga0070658_100065163 | 151 |
| 218 | 3300005327 | Ga0070658_10059696 | Ga0070658_100596962 | 151 |
| 219 | 3300005328 | Ga0070676_10006637 | Ga0070676_100066374 | 151 |
| 220 | 3300005329 | Ga0070683_100853205 | Ga0070683_1008532051 | 151 |
| 221 | 3300005329 | Ga0070683_101218198 | Ga0070683_1012181981 | 151 |
| 222 | 3300005339 | Ga0070660_100158272 | Ga0070660_1001582725 | 151 |
| 223 | 3300005355 | Ga0070671_100022194 | Ga0070671_1000221945 | 151 |
| 224 | 3300005355 | Ga0070671_100228642 | Ga0070671_1002286422 | 151 |
| 225 | 3300005356 | Ga0070674_100002912 | Ga0070674_1000029126 | 151 |
| 226 | 3300005356 | Ga0070674_100005409 | Ga0070674_1000054094 | 151 |
| 227 | 3300005364 | Ga0070673_100000033 | Ga0070673_10000003341 | 151 |
| 228 | 3300005365 | Ga0070688_100622557 | Ga0070688_1006225571 | 151 |
| 229 | 3300005456 | Ga0070678_100000201 | Ga0070678_1000002018 | 151 |
| 230 | 3300005458 | Ga0070681_10000608 | Ga0070681_1000060833 | 151 |
| 231 | 3300005459 | Ga0068867_100203796 | Ga0068867_1002037961 | 151 |
| 232 | 3300005466 | Ga0070685_10000690 | Ga0070685_1000069013 | 151 |
| 233 | 3300005466 | Ga0070685_10003963 | Ga0070685_100039635 | 151 |
| 234 | 3300005535 | Ga0070684_100000049 | Ga0070684_1000000494 | 151 |
| 235 | 3300005548 | Ga0070665_100085636 | Ga0070665_1000856364 | 151 |
| 236 | 3300005548 | Ga0070665_100124630 | Ga0070665_1001246304 | 151 |
| 237 | 3300005548 | Ga0070665_101378630 | Ga0070665_1013786302 | 151 |
| 238 | 3300005563 | Ga0068855_100004286 | Ga0068855_10000428616 | 151 |
| 239 | 3300005564 | Ga0070664_100728018 | Ga0070664_1007280182 | 151 |
| 240 | 3300005577 | Ga0068857_100039775 | Ga0068857_1000397753 | 151 |
| 241 | 3300005614 | Ga0068856_100082335 | Ga0068856_1000823355 | 151 |
| 242 | 3300006358 | Ga0068871_100234417 | Ga0068871_1002344172 | 151 |
| 243 | 3300009093 | Ga0105240_10000003 | Ga0105240_10000003603 | 151 |
| 244 | 3300009093 | Ga0105240_10118938 | Ga0105240_101189382 | 151 |
| 245 | 3300009098 | Ga0105245_10000200 | Ga0105245_1000020039 | 151 |
| 246 | 3300009098 | Ga0105245_10061919 | Ga0105245_100619194 | 151 |
| 247 | 3300009098 | Ga0105245_10373504 | Ga0105245_103735042 | 151 |
| 248 | 3300009148 | Ga0105243_10000001 | Ga0105243_10000001690 | 151 |
| 249 | 3300009174 | Ga0105241_10448771 | Ga0105241_104487711 | 151 |
| 250 | 3300009176 | Ga0105242_10000001 | Ga0105242_10000001573 | 151 |
| 251 | 3300009176 | Ga0105242_10002087 | Ga0105242_1000208725 | 151 |
| 252 | 3300009176 | Ga0105242_10013893 | Ga0105242_100138939 | 151 |
| 253 | 3300009177 | Ga0105248_11612672 | Ga0105248_116126721 | 151 |
| 254 | 3300009545 | Ga0105237_10009293 | Ga0105237_100092932 | 151 |
| 255 | 3300010375 | Ga0105239_10031923 | Ga0105239_100319234 | 151 |
| 256 | 3300010375 | Ga0105239_10038093 | Ga0105239_100380934 | 151 |
| 257 | 3300010375 | Ga0105239_10853134 | Ga0105239_108531341 | 151 |
| 258 | 3300013296 | Ga0157374_10000096 | Ga0157374_1000009659 | 151 |
| 259 | 3300013297 | Ga0157378_10037888 | Ga0157378_100378885 | 151 |
| 260 | 3300013297 | Ga0157378_10327382 | Ga0157378_103273822 | 151 |
| 261 | 3300013307 | Ga0157372_10025726 | Ga0157372_100257265 | 151 |
| 262 | 3300013308 | Ga0157375_10640535 | Ga0157375_106405351 | 151 |
| 263 | 3300014969 | Ga0157376_10000001 | Ga0157376_10000001362 | 151 |
| 264 | 3300025907 | Ga0207645_10038847 | Ga0207645_100388475 | 151 |
| 265 | 3300025909 | Ga0207705_10000115 | Ga0207705_1000011547 | 151 |
| 266 | 3300025909 | Ga0207705_10074336 | Ga0207705_100743363 | 151 |
| 267 | 3300025909 | Ga0207705_10432439 | Ga0207705_104324392 | 151 |
| 268 | 3300025912 | Ga0207707_10025748 | Ga0207707_100257485 | 151 |
| 269 | 3300025913 | Ga0207695_10000005 | Ga0207695_10000005611 | 151 |
| 270 | 3300025913 | Ga0207695_10076332 | Ga0207695_100763324 | 151 |
| 271 | 3300025914 | Ga0207671_10003661 | Ga0207671_1000366120 | 151 |
| 272 | 3300025919 | Ga0207657_10430137 | Ga0207657_104301372 | 151 |
| 273 | 3300025927 | Ga0207687_10001932 | Ga0207687_1000193219 | 151 |
| 274 | 3300025927 | Ga0207687_10075495 | Ga0207687_100754954 | 151 |
| 275 | 3300025927 | Ga0207687_10209830 | Ga0207687_102098302 | 151 |
| 276 | 3300025931 | Ga0207644_10022204 | Ga0207644_100222044 | 151 |
| 277 | 3300025934 | Ga0207686_10000001 | Ga0207686_10000001454 | 151 |
| 278 | 3300025934 | Ga0207686_10061860 | Ga0207686_100618604 | 151 |
| 279 | 3300025935 | Ga0207709_10000002 | Ga0207709_10000002570 | 151 |
| 280 | 3300025937 | Ga0207669_10006666 | Ga0207669_100066668 | 151 |
| 281 | 3300025937 | Ga0207669_10024885 | Ga0207669_100248853 | 151 |
| 282 | 3300025944 | Ga0207661_10000077 | Ga0207661_1000007754 | 151 |
| 283 | 3300025949 | Ga0207667_10004357 | Ga0207667_100043577 | 151 |
| 284 | 3300025949 | Ga0207667_10195280 | Ga0207667_101952802 | 151 |
| 285 | 3300025960 | Ga0207651_10000141 | Ga0207651_1000014120 | 151 |
| 286 | 3300026041 | Ga0207639_10011466 | Ga0207639_100114665 | 151 |
| 287 | 3300026078 | Ga0207702_10061822 | Ga0207702_100618225 | 151 |
| 288 | 3300026116 | Ga0207674_10119816 | Ga0207674_101198164 | 151 |
| 289 | 3300026121 | Ga0207683_10030359 | Ga0207683_100303594 | 151 |
| 290 | 3300028379 | Ga0268266_10021620 | Ga0268266_100216205 | 151 |
| 291 | 3300028556 | Ga0265337_1014219 | Ga0265337_10142191 | 151 |
| 292 | 3300028573 | Ga0265334_10000106 | Ga0265334_1000010619 | 151 |
| 293 | 3300028800 | Ga0265338_10000181 | Ga0265338_1000018156 | 151 |
| 294 | 3300028800 | Ga0265338_10000625 | Ga0265338_1000062534 | 151 |
| 295 | 3300028800 | Ga0265338_10052669 | Ga0265338_100526693 | 151 |
| 296 | 3300031247 | Ga0265340_10000445 | Ga0265340_100004453 | 151 |
| 297 | 3300031712 | Ga0265342_10121422 | Ga0265342_101214222 | 151 |
| 298 | 3300037418 | Ga0395900_0138321 | Ga0395900_0138321_1541_2134 | 151 |
| 299 | 3300037418 | Ga0395900_0475537 | Ga0395900_0475537_47_547 | 151 |
| 300 | 3300037471 | Ga0395905_0019326 | Ga0395905_0019326_2639_3205 | 151 |
| 301 | 3300038443 | Ga0395901_0006327 | Ga0395901_0006327_2548_3111 | 151 |
| 302 | 3300038443 | Ga0395901_0132250 | Ga0395901_0132250_477_1040 | 151 |
| 303 | 3300048903 | Ga0496100_0017761 | Ga0496100_0017761_224_793 | 151 |
| 304 | 3300048907 | Ga0496104_0574219 | Ga0496104_0574219_421_984 | 151 |
| 305 | 3300048915 | Ga0496112_0072167 | Ga0496112_0072167_1434_1934 | 151 |
| 306 | 3300049571 | Ga0501034_0009503 | Ga0501034_0009503_2673_3167 | 151 |
| 307 | 3300049707 | Ga0501234_003057 | Ga0501234_003057_1456_2031 | 151 |
| 308 | 3300053088 | Ga0500644_0012144 | Ga0500644_0012144_1072_1644 | 151 |
| 309 | 3300053090 | Ga0500646_0000805 | Ga0500646_0000805_7885_8457 | 151 |
| 310 | 3300053093 | Ga0500651_0000191 | Ga0500651_0000191_1035_1598 | 151 |
| 311 | 3300053093 | Ga0500651_0009366 | Ga0500651_0009366_4218_4778 | 151 |
| 312 | 3300053093 | Ga0500651_0287179 | Ga0500651_0287179_303_875 | 151 |
| 313 | 3300053098 | Ga0500650_0000001 | Ga0500650_0000001_295436_296008 | 151 |
| 314 | 3300053108 | Ga0500562_009692 | Ga0500562_009692_1519_2091 | 151 |
| 315 | 3300053118 | Ga0500594_0000001 | Ga0500594_0000001_959869_960441 | 151 |
| 316 | 3300053123 | Ga0500614_002185 | Ga0500614_002185_1055_1618 | 151 |
| 317 | 3300053133 | Ga0500655_001617 | Ga0500655_001617_3048_3620 | 151 |
| 318 | 3300053142 | Ga0500577_0014179 | Ga0500577_0014179_1635_2207 | 151 |
| 319 | 3300053143 | Ga0500579_000781 | Ga0500579_000781_9397_9969 | 151 |
| 320 | 2162886011 | MRS1b_contig_4084217 | MRS1b_0407.00002990 | 152 |
| 321 | 2162886012 | MBSR1b_contig_1799290 | MBSR1b_0934.00002860 | 152 |
| 322 | 3300001979 | JGI24740J21852_10004913 | JGI24740J21852_100049135 | 152 |
| 323 | 3300001979 | JGI24740J21852_10015481 | JGI24740J21852_100154812 | 152 |
| 324 | 3300001979 | JGI24740J21852_10019351 | JGI24740J21852_100193513 | 152 |
| 325 | 3300001989 | JGI24739J22299_10005141 | JGI24739J22299_100051415 | 152 |
| 326 | 3300001989 | JGI24739J22299_10065986 | JGI24739J22299_100659862 | 152 |
| 327 | 3300001990 | JGI24737J22298_10002203 | JGI24737J22298_100022039 | 152 |
| 328 | 3300001991 | JGI24743J22301_10000630 | JGI24743J22301_100006306 | 152 |
| 329 | 3300002067 | JGI24735J21928_10000149 | JGI24735J21928_100001496 | 152 |
| 330 | 3300002075 | JGI24738J21930_10001791 | JGI24738J21930_100017919 | 152 |
| 331 | 3300003320 | rootH2_10006847 | rootH2_1000684719 | 152 |
| 332 | 3300003320 | rootH2_10224747 | rootH2_102247472 | 152 |
| 333 | 3300003911 | JGI25405J52794_10004809 | JGI25405J52794_100048092 | 152 |
| 334 | 3300005290 | Ga0065712_10265754 | Ga0065712_102657541 | 152 |
| 335 | 3300005293 | Ga0065715_10099813 | Ga0065715_100998134 | 152 |
| 336 | 3300005327 | Ga0070658_10000024 | Ga0070658_10000024144 | 152 |
| 337 | 3300005327 | Ga0070658_10143421 | Ga0070658_101434212 | 152 |
| 338 | 3300005328 | Ga0070676_10295997 | Ga0070676_102959971 | 152 |
| 339 | 3300005329 | Ga0070683_100010750 | Ga0070683_1000107503 | 152 |
| 340 | 3300005329 | Ga0070683_100810260 | Ga0070683_1008102601 | 152 |
| 341 | 3300005339 | Ga0070660_100000316 | Ga0070660_10000031616 | 152 |
| 342 | 3300005339 | Ga0070660_100045343 | Ga0070660_1000453435 | 152 |
| 343 | 3300005344 | Ga0070661_100056640 | Ga0070661_1000566403 | 152 |
| 344 | 3300005345 | Ga0070692_10048571 | Ga0070692_100485715 | 152 |
| 345 | 3300005347 | Ga0070668_100135648 | Ga0070668_1001356482 | 152 |
| 346 | 3300005366 | Ga0070659_100099914 | Ga0070659_1000999143 | 152 |
| 347 | 3300005366 | Ga0070659_100115307 | Ga0070659_1001153073 | 152 |
| 348 | 3300005367 | Ga0070667_100281074 | Ga0070667_1002810743 | 152 |
| 349 | 3300005457 | Ga0070662_100009029 | Ga0070662_1000090295 | 152 |
| 350 | 3300005518 | Ga0070699_100829465 | Ga0070699_1008294652 | 152 |
| 351 | 3300005535 | Ga0070684_100094775 | Ga0070684_1000947752 | 152 |
| 352 | 3300005544 | Ga0070686_100228546 | Ga0070686_1002285462 | 152 |
| 353 | 3300005563 | Ga0068855_100000663 | Ga0068855_10000066342 | 152 |
| 354 | 3300005563 | Ga0068855_101775138 | Ga0068855_1017751382 | 152 |
| 355 | 3300005564 | Ga0070664_100003334 | Ga0070664_1000033344 | 152 |
| 356 | 3300005564 | Ga0070664_100277615 | Ga0070664_1002776152 | 152 |
| 357 | 3300005577 | Ga0068857_100000441 | Ga0068857_10000044114 | 152 |
| 358 | 3300005577 | Ga0068857_100000829 | Ga0068857_10000082930 | 152 |
| 359 | 3300005577 | Ga0068857_100128291 | Ga0068857_1001282912 | 152 |
| 360 | 3300005577 | Ga0068857_100777493 | Ga0068857_1007774932 | 152 |
| 361 | 3300005578 | Ga0068854_100026707 | Ga0068854_1000267074 | 152 |
| 362 | 3300005614 | Ga0068856_100000027 | Ga0068856_10000002715 | 152 |
| 363 | 3300005614 | Ga0068856_100000200 | Ga0068856_1000002003 | 152 |
| 364 | 3300005614 | Ga0068856_100073196 | Ga0068856_1000731964 | 152 |
| 365 | 3300005616 | Ga0068852_100000001 | Ga0068852_100000001459 | 152 |
| 366 | 3300005616 | Ga0068852_100000155 | Ga0068852_10000015553 | 152 |
| 367 | 3300005842 | Ga0068858_100918270 | Ga0068858_1009182702 | 152 |
| 368 | 3300005843 | Ga0068860_100013616 | Ga0068860_1000136164 | 152 |
| 369 | 3300005844 | Ga0068862_100134154 | Ga0068862_1001341542 | 152 |
| 370 | 3300005937 | Ga0081455_10000001 | Ga0081455_10000001320 | 152 |
| 371 | 3300006028 | Ga0070717_10058886 | Ga0070717_100588865 | 152 |
| 372 | 3300006038 | Ga0075365_10000001 | Ga0075365_1000000183 | 152 |
| 373 | 3300006038 | Ga0075365_10000014 | Ga0075365_1000001415 | 152 |
| 374 | 3300006038 | Ga0075365_10004786 | Ga0075365_100047863 | 152 |
| 375 | 3300006038 | Ga0075365_10007875 | Ga0075365_100078754 | 152 |
| 376 | 3300006038 | Ga0075365_10092905 | Ga0075365_100929053 | 152 |
| 377 | 3300006038 | Ga0075365_10391815 | Ga0075365_103918152 | 152 |
| 378 | 3300006042 | Ga0075368_10002082 | Ga0075368_100020822 | 152 |
| 379 | 3300006048 | Ga0075363_100019278 | Ga0075363_1000192782 | 152 |
| 380 | 3300006051 | Ga0075364_10002700 | Ga0075364_1000270016 | 152 |
| 381 | 3300006051 | Ga0075364_10137566 | Ga0075364_101375662 | 152 |
| 382 | 3300006051 | Ga0075364_10271444 | Ga0075364_102714442 | 152 |
| 383 | 3300006178 | Ga0075367_10008164 | Ga0075367_100081646 | 152 |
| 384 | 3300006178 | Ga0075367_10078335 | Ga0075367_100783352 | 152 |
| 385 | 3300006186 | Ga0075369_10039210 | Ga0075369_100392102 | 152 |
| 386 | 3300006186 | Ga0075369_10042664 | Ga0075369_100426643 | 152 |
| 387 | 3300006195 | Ga0075366_10010874 | Ga0075366_100108745 | 152 |
| 388 | 3300006195 | Ga0075366_10056325 | Ga0075366_100563253 | 152 |
| 389 | 3300006195 | Ga0075366_10169845 | Ga0075366_101698451 | 152 |
| 390 | 3300006237 | Ga0097621_100558325 | Ga0097621_1005583252 | 152 |
| 391 | 3300006353 | Ga0075370_10031490 | Ga0075370_100314905 | 152 |
| 392 | 3300006353 | Ga0075370_10103382 | Ga0075370_101033822 | 152 |
| 393 | 3300006358 | Ga0068871_101099834 | Ga0068871_1010998342 | 152 |
| 394 | 3300006844 | Ga0075428_100001999 | Ga0075428_10000199920 | 152 |
| 395 | 3300006881 | Ga0068865_100000307 | Ga0068865_10000030723 | 152 |
| 396 | 3300009093 | Ga0105240_10000004 | Ga0105240_10000004166 | 152 |
| 397 | 3300009093 | Ga0105240_10000050 | Ga0105240_10000050126 | 152 |
| 398 | 3300009093 | Ga0105240_10001357 | Ga0105240_1000135741 | 152 |
| 399 | 3300009093 | Ga0105240_11323262 | Ga0105240_113232621 | 152 |
| 400 | 3300009098 | Ga0105245_10173800 | Ga0105245_101738005 | 152 |
| 401 | 3300009101 | Ga0105247_10185438 | Ga0105247_101854383 | 152 |
| 402 | 3300009174 | Ga0105241_10082024 | Ga0105241_100820243 | 152 |
| 403 | 3300009174 | Ga0105241_10263637 | Ga0105241_102636372 | 152 |
| 404 | 3300009177 | Ga0105248_10201081 | Ga0105248_102010813 | 152 |
| 405 | 3300009177 | Ga0105248_10434691 | Ga0105248_104346912 | 152 |
| 406 | 3300009177 | Ga0105248_10789385 | Ga0105248_107893851 | 152 |
| 407 | 3300009545 | Ga0105237_10000001 | Ga0105237_10000001599 | 152 |
| 408 | 3300009545 | Ga0105237_10000002 | Ga0105237_10000002353 | 152 |
| 409 | 3300009545 | Ga0105237_10061315 | Ga0105237_100613155 | 152 |
| 410 | 3300009545 | Ga0105237_11130283 | Ga0105237_111302832 | 152 |
| 411 | 3300009545 | Ga0105237_11683392 | Ga0105237_116833922 | 152 |
| 412 | 3300009551 | Ga0105238_10020346 | Ga0105238_100203463 | 152 |
| 413 | 3300009551 | Ga0105238_10140584 | Ga0105238_101405842 | 152 |
| 414 | 3300009979 | Ga0105032_100001 | Ga0105032_100001317 | 152 |
| 415 | 3300009979 | Ga0105032_100020 | Ga0105032_1000207 | 152 |
| 416 | 3300009984 | Ga0105029_100086 | Ga0105029_1000864 | 152 |
| 417 | 3300010375 | Ga0105239_10001223 | Ga0105239_1000122333 | 152 |
| 418 | 3300011119 | Ga0105246_10010028 | Ga0105246_100100282 | 152 |
| 419 | 3300011119 | Ga0105246_10014924 | Ga0105246_100149242 | 152 |
| 420 | 3300011119 | Ga0105246_10052123 | Ga0105246_100521234 | 152 |
| 421 | 3300013100 | Ga0157373_10043985 | Ga0157373_100439853 | 152 |
| 422 | 3300013100 | Ga0157373_10094199 | Ga0157373_100941992 | 152 |
| 423 | 3300013100 | Ga0157373_10936581 | Ga0157373_109365812 | 152 |
| 424 | 3300013102 | Ga0157371_10007527 | Ga0157371_100075279 | 152 |
| 425 | 3300013102 | Ga0157371_10077928 | Ga0157371_100779282 | 152 |
| 426 | 3300013102 | Ga0157371_10109435 | Ga0157371_101094352 | 152 |
| 427 | 3300013104 | Ga0157370_10002357 | Ga0157370_1000235716 | 152 |
| 428 | 3300013104 | Ga0157370_10012318 | Ga0157370_100123182 | 152 |
| 429 | 3300013104 | Ga0157370_10137441 | Ga0157370_101374412 | 152 |
| 430 | 3300013105 | Ga0157369_10000029 | Ga0157369_10000029224 | 152 |
| 431 | 3300013105 | Ga0157369_10000151 | Ga0157369_1000015179 | 152 |
| 432 | 3300013105 | Ga0157369_10000190 | Ga0157369_100001903 | 152 |
| 433 | 3300013105 | Ga0157369_10000567 | Ga0157369_1000056753 | 152 |
| 434 | 3300013105 | Ga0157369_10119188 | Ga0157369_101191885 | 152 |
| 435 | 3300013105 | Ga0157369_10451879 | Ga0157369_104518793 | 152 |
| 436 | 3300013296 | Ga0157374_10004073 | Ga0157374_100040736 | 152 |
| 437 | 3300013307 | Ga0157372_10000002 | Ga0157372_10000002144 | 152 |
| 438 | 3300013307 | Ga0157372_10000086 | Ga0157372_1000008619 | 152 |
| 439 | 3300013307 | Ga0157372_10257262 | Ga0157372_102572624 | 152 |
| 440 | 3300013308 | Ga0157375_10074210 | Ga0157375_100742104 | 152 |
| 441 | 3300014325 | Ga0163163_10251669 | Ga0163163_102516694 | 152 |
| 442 | 3300014745 | Ga0157377_10000920 | Ga0157377_1000092013 | 152 |
| 443 | 3300014969 | Ga0157376_10000027 | Ga0157376_100000273 | 152 |
| 444 | 3300014969 | Ga0157376_10945670 | Ga0157376_109456701 | 152 |
| 445 | 3300025315 | Ga0207697_10044198 | Ga0207697_100441983 | 152 |
| 446 | 3300025900 | Ga0207710_10095235 | Ga0207710_100952351 | 152 |
| 447 | 3300025904 | Ga0207647_10001245 | Ga0207647_1000124521 | 152 |
| 448 | 3300025906 | Ga0207699_10144502 | Ga0207699_101445022 | 152 |
| 449 | 3300025907 | Ga0207645_10286483 | Ga0207645_102864833 | 152 |
| 450 | 3300025909 | Ga0207705_10000047 | Ga0207705_1000004763 | 152 |
| 451 | 3300025909 | Ga0207705_10112718 | Ga0207705_101127182 | 152 |
| 452 | 3300025911 | Ga0207654_10047071 | Ga0207654_100470714 | 152 |
| 453 | 3300025911 | Ga0207654_10157340 | Ga0207654_101573402 | 152 |
| 454 | 3300025913 | Ga0207695_10000009 | Ga0207695_10000009546 | 152 |
| 455 | 3300025913 | Ga0207695_10000158 | Ga0207695_10000158105 | 152 |
| 456 | 3300025913 | Ga0207695_10247811 | Ga0207695_102478113 | 152 |
| 457 | 3300025914 | Ga0207671_10000003 | Ga0207671_10000003602 | 152 |
| 458 | 3300025914 | Ga0207671_10000008 | Ga0207671_10000008457 | 152 |
| 459 | 3300025914 | Ga0207671_10033531 | Ga0207671_100335315 | 152 |
| 460 | 3300025919 | Ga0207657_10002562 | Ga0207657_1000256216 | 152 |
| 461 | 3300025919 | Ga0207657_10011048 | Ga0207657_100110488 | 152 |
| 462 | 3300025924 | Ga0207694_10088559 | Ga0207694_100885592 | 152 |
| 463 | 3300025924 | Ga0207694_10112347 | Ga0207694_101123475 | 152 |
| 464 | 3300025926 | Ga0207659_10091373 | Ga0207659_100913733 | 152 |
| 465 | 3300025932 | Ga0207690_10002652 | Ga0207690_100026525 | 152 |
| 466 | 3300025932 | Ga0207690_10125620 | Ga0207690_101256202 | 152 |
| 467 | 3300025933 | Ga0207706_10000073 | Ga0207706_1000007351 | 152 |
| 468 | 3300025938 | Ga0207704_10001468 | Ga0207704_100014686 | 152 |
| 469 | 3300025941 | Ga0207711_10135448 | Ga0207711_101354483 | 152 |
| 470 | 3300025944 | Ga0207661_10002445 | Ga0207661_1000244518 | 152 |
| 471 | 3300025945 | Ga0207679_10000124 | Ga0207679_1000012464 | 152 |
| 472 | 3300025945 | Ga0207679_10316443 | Ga0207679_103164432 | 152 |
| 473 | 3300025945 | Ga0207679_10507067 | Ga0207679_105070672 | 152 |
| 474 | 3300025949 | Ga0207667_10000756 | Ga0207667_1000075641 | 152 |
| 475 | 3300025949 | Ga0207667_10280915 | Ga0207667_102809153 | 152 |
| 476 | 3300025972 | Ga0207668_10121136 | Ga0207668_101211362 | 152 |
| 477 | 3300025981 | Ga0207640_10019721 | Ga0207640_100197214 | 152 |
| 478 | 3300026035 | Ga0207703_10508632 | Ga0207703_105086322 | 152 |
| 479 | 3300026078 | Ga0207702_10000015 | Ga0207702_10000015104 | 152 |
| 480 | 3300026078 | Ga0207702_10000034 | Ga0207702_10000034104 | 152 |
| 481 | 3300026078 | Ga0207702_10000057 | Ga0207702_1000005796 | 152 |
| 482 | 3300026078 | Ga0207702_10681970 | Ga0207702_106819702 | 152 |
| 483 | 3300026116 | Ga0207674_10000439 | Ga0207674_100004392 | 152 |
| 484 | 3300026116 | Ga0207674_10000878 | Ga0207674_1000087814 | 152 |
| 485 | 3300026116 | Ga0207674_10143475 | Ga0207674_101434754 | 152 |
| 486 | 3300026116 | Ga0207674_10149562 | Ga0207674_101495622 | 152 |
| 487 | 3300026116 | Ga0207674_11305110 | Ga0207674_113051102 | 152 |
| 488 | 3300026142 | Ga0207698_10000001 | Ga0207698_10000001410 | 152 |
| 489 | 3300026142 | Ga0207698_10000048 | Ga0207698_1000004815 | 152 |
| 490 | 3300026142 | Ga0207698_11249590 | Ga0207698_112495902 | 152 |
| 491 | 3300027866 | Ga0209813_10000335 | Ga0209813_1000033519 | 152 |
| 492 | 3300028380 | Ga0268265_11072907 | Ga0268265_110729072 | 152 |
| 493 | 3300030733 | Ga0314311_1122390 | Ga0314311_11223904 | 152 |
| 494 | 3300030734 | Ga0316179_1064424 | Ga0316179_10644247 | 152 |
| 495 | 3300030736 | Ga0316180_1071123 | Ga0316180_10711234 | 152 |
| 496 | 3300030742 | Ga0316183_1041045 | Ga0316183_10410453 | 152 |
| 497 | 3300030742 | Ga0316183_1192095 | Ga0316183_11920957 | 152 |
| 498 | 3300030744 | Ga0316181_1019399 | Ga0316181_10193995 | 152 |
| 499 | 3300030745 | Ga0316182_1017501 | Ga0316182_10175018 | 152 |
| 500 | 3300030745 | Ga0316182_1175280 | Ga0316182_11752802 | 152 |
| 501 | 3300030745 | Ga0316182_1326517 | Ga0316182_13265172 | 152 |
| 502 | 3300030745 | Ga0316182_1396058 | Ga0316182_13960587 | 152 |
| 503 | 3300031730 | Ga0307516_10008182 | Ga0307516_100081824 | 152 |
| 504 | 3300031731 | Ga0307405_10051169 | Ga0307405_100511693 | 152 |
| 505 | 3300031911 | Ga0307412_10122601 | Ga0307412_101226012 | 152 |
| 506 | 3300037312 | Ga0395899_0039022 | Ga0395899_0039022_1673_2131 | 152 |
| 507 | 3300037312 | Ga0395899_0144552 | Ga0395899_0144552_489_983 | 152 |
| 508 | 3300037418 | Ga0395900_0000001 | Ga0395900_0000001_261338_261796 | 152 |
| 509 | 3300037466 | Ga0395898_0000002 | Ga0395898_0000002_844150_844668 | 152 |
| 510 | 3300038443 | Ga0395901_0000006 | Ga0395901_0000006_489826_490344 | 152 |
| 511 | 3300041410 | Ga0439461_0002738 | Ga0439461_0002738_339_833 | 152 |
| 512 | 3300041512 | Ga0451853_0102201 | Ga0451853_0102201_35_529 | 152 |
| 513 | 3300041512 | Ga0451853_0725875 | Ga0451853_0725875_82_576 | 152 |
| 514 | 3300042004 | Ga0439445_0005738 | Ga0439445_0005738_90_584 | 152 |
| 515 | 3300042005 | Ga0439448_0214674 | Ga0439448_0214674_46_564 | 152 |
| 516 | 3300042006 | Ga0439432_007573 | Ga0439432_007573_331_825 | 152 |
| 517 | 3300042122 | Ga0450920_000808 | Ga0450920_000808_4036_4530 | 152 |
| 518 | 3300042145 | Ga0450906_005983 | Ga0450906_005983_1152_1646 | 152 |
| 519 | 3300042156 | Ga0439446_0000001 | Ga0439446_0000001_15676_16170 | 152 |
| 520 | 3300042185 | Ga0450909_001971 | Ga0450909_001971_1243_1737 | 152 |
| 521 | 3300042439 | Ga0439464_0000130 | Ga0439464_0000130_9304_9762 | 152 |
| 522 | 3300042439 | Ga0439464_0036928 | Ga0439464_0036928_106_600 | 152 |
| 523 | 3300042531 | Ga0450918_000617 | Ga0450918_000617_2538_3035 | 152 |
| 524 | 3300044765 | Ga0466970_0123694 | Ga0466970_0123694_627_1121 | 152 |
| 525 | 3300046460 | Ga0495638_0000132 | Ga0495638_0000132_95904_96398 | 152 |
| 526 | 3300046460 | Ga0495638_0000551 | Ga0495638_0000551_35887_36381 | 152 |
| 527 | 3300046542 | Ga0495597_0030047 | Ga0495597_0030047_1126_1620 | 152 |
| 528 | 3300046642 | Ga0495634_0096185 | Ga0495634_0096185_826_1320 | 152 |
| 529 | 3300046692 | Ga0495671_0065105 | Ga0495671_0065105_923_1417 | 152 |
| 530 | 3300046810 | Ga0495660_0000005 | Ga0495660_0000005_126691_127185 | 152 |
| 531 | 3300047470 | Ga0495681_0201217 | Ga0495681_0201217_244_738 | 152 |
| 532 | 3300047472 | Ga0495686_0005549 | Ga0495686_0005549_2260_2754 | 152 |
| 533 | 3300048090 | Ga0495615_0092397 | Ga0495615_0092397_119_613 | 152 |
| 534 | 3300048916 | Ga0496113_0025550 | Ga0496113_0025550_1678_2136 | 152 |
| 535 | 3300049571 | Ga0501034_0000028 | Ga0501034_0000028_977_1471 | 152 |
| 536 | 3300049573 | Ga0501037_0000001 | Ga0501037_0000001_189104_189598 | 152 |
| 537 | 3300049574 | Ga0501038_0070790 | Ga0501038_0070790_2282_2776 | 152 |
| 538 | 3300050489 | nmdc:mga03683_32384_c1 | nmdc:mga03683_32384_c1_33_527 | 152 |
| 539 | 3300050491 | nmdc:mga00v17_120_c1 | nmdc:mga00v17_120_c1_26858_27352 | 152 |
| 540 | 3300050491 | nmdc:mga00v17_162499_c1 | nmdc:mga00v17_162499_c1_769_1227 | 152 |
| 541 | 3300050492 | nmdc:mga0yw44_128525_c1 | nmdc:mga0yw44_128525_c1_662_1156 | 152 |
| 542 | 3300050492 | nmdc:mga0yw44_16_c1 | nmdc:mga0yw44_16_c1_67126_67620 | 152 |
| 543 | 3300050492 | nmdc:mga0yw44_1_c1 | nmdc:mga0yw44_1_c1_179764_180258 | 152 |
| 544 | 3300050492 | nmdc:mga0yw44_3147_c1 | nmdc:mga0yw44_3147_c1_5823_6332 | 152 |
| 545 | 3300050492 | nmdc:mga0yw44_4_c1 | nmdc:mga0yw44_4_c1_320149_320643 | 152 |
| 546 | 3300050492 | nmdc:mga0yw44_523976_c1 | nmdc:mga0yw44_523976_c1_164_658 | 152 |
| 547 | 3300050493 | nmdc:mga0k408_159617_c1 | nmdc:mga0k408_159617_c1_29_523 | 152 |
| 548 | 3300050493 | nmdc:mga0k408_3696_c1 | nmdc:mga0k408_3696_c1_6821_7279 | 152 |
| 549 | 3300050493 | nmdc:mga0k408_4209_c3 | nmdc:mga0k408_4209_c3_1012_1506 | 152 |
| 550 | 3300050494 | nmdc:mga06z11_198_c1 | nmdc:mga06z11_198_c1_12892_13386 | 152 |
| 551 | 3300050494 | nmdc:mga06z11_58210_c1 | nmdc:mga06z11_58210_c1_1282_1740 | 152 |
| 552 | 3300050495 | nmdc:mga04h51_202516_c1 | nmdc:mga04h51_202516_c1_205_663 | 152 |
| 553 | 3300050495 | nmdc:mga04h51_251_c1 | nmdc:mga04h51_251_c1_13371_13865 | 152 |
| 554 | 3300050496 | nmdc:mga07m45_10022_c1 | nmdc:mga07m45_10022_c1_1387_1845 | 152 |
| 555 | 3300050496 | nmdc:mga07m45_148205_c1 | nmdc:mga07m45_148205_c1_810_1304 | 152 |
| 556 | 3300050496 | nmdc:mga07m45_248674_c1 | nmdc:mga07m45_248674_c1_403_897 | 152 |
| 557 | 3300050516 | nmdc:mga0sz30_13016_c1 | nmdc:mga0sz30_13016_c1_1259_1717 | 152 |
| 558 | 3300050516 | nmdc:mga0sz30_1978_c2 | nmdc:mga0sz30_1978_c2_238_732 | 152 |
| 559 | 3300053087 | Ga0500643_000022 | Ga0500643_000022_89901_90398 | 152 |
| 560 | 3300053087 | Ga0500643_003568 | Ga0500643_003568_5853_6347 | 152 |
| 561 | 3300053088 | Ga0500644_0007239 | Ga0500644_0007239_1847_2341 | 152 |
| 562 | 3300053088 | Ga0500644_0472856 | Ga0500644_0472856_18_512 | 152 |
| 563 | 3300053090 | Ga0500646_0000007 | Ga0500646_0000007_27122_27616 | 152 |
| 564 | 3300053090 | Ga0500646_0046835 | Ga0500646_0046835_172_666 | 152 |
| 565 | 3300053092 | Ga0500583_0011114 | Ga0500583_0011114_2394_2888 | 152 |
| 566 | 3300053092 | Ga0500583_0014634 | Ga0500583_0014634_2192_2686 | 152 |
| 567 | 3300053092 | Ga0500583_0291472 | Ga0500583_0291472_32_526 | 152 |
| 568 | 3300053096 | Ga0500641_0000001 | Ga0500641_0000001_71483_71977 | 152 |
| 569 | 3300053103 | Ga0500555_000009 | Ga0500555_000009_256319_256813 | 152 |
| 570 | 3300053109 | Ga0500569_000018 | Ga0500569_000018_35887_36381 | 152 |
| 571 | 3300053131 | Ga0500652_000001 | Ga0500652_000001_290496_290990 | 152 |
| 572 | 3300053131 | Ga0500652_136312 | Ga0500652_136312_400_894 | 152 |
| 573 | 3300053139 | Ga0500568_0031933 | Ga0500568_0031933_909_1406 | 152 |
| 574 | 3300053142 | Ga0500577_0054346 | Ga0500577_0054346_239_733 | 152 |
| 575 | 3300053146 | Ga0500588_0000752 | Ga0500588_0000752_343_837 | 152 |
| 576 | 3300053151 | Ga0500604_0049606 | Ga0500604_0049606_466_963 | 152 |
| 577 | 3300053153 | Ga0500616_0000005 | Ga0500616_0000005_268469_268969 | 152 |
| 578 | 3300053153 | Ga0500616_0000012 | Ga0500616_0000012_395863_396357 | 152 |
| 579 | 3300053153 | Ga0500616_0015635 | Ga0500616_0015635_2784_3278 | 152 |
| 580 | 3300053153 | Ga0500616_0025837 | Ga0500616_0025837_477_971 | 152 |
| 581 | 3300053724 | Ga0500570_008150 | Ga0500570_008150_2274_2768 | 152 |
| 582 | 3300053724 | Ga0500570_070171 | Ga0500570_070171_1106_1600 | 152 |
| 583 | 3300053732 | Ga0500656_002995 | Ga0500656_002995_294_788 | 152 |
| 584 | 3300059426 | Ga0590077_054771 | Ga0590077_054771_107_601 | 152 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3i7u-assembly1.cif.gz_B | crystal structure of ap4a hydrolase (aq_158) from aquifex aeolicus vf5 | 0.9486 | 12 | 149 |
| 1vc9-assembly2.cif.gz_B | crystal structure of a t.thermophilus hb8 ap6a hydrolase e50q mutant-mg2+-atp complex | 0.9284 | 14 | 146 |
| 1vcd-assembly1.cif.gz_A | crystal structure of a t.thermophilus hb8 ap6a hydrolase ndx1 | 0.9271 | 14 | 147 |
| 3i7u-assembly1.cif.gz_B | crystal structure of ap4a hydrolase (aq_158) from aquifex aeolicus vf5 | 0.9214 | 12 | 149 |
| 6m6y-assembly1.cif.gz_A | crystal structure of mycobacterium smegmatis mutt1 in complex with 8-oxo-dgtp | 0.9138 | 13 | 140 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 2pbtB01 | Alpha Beta;Alpha-Beta Complex;Nucleoside Triphosphate Pyrophosphohydrolase;Nucleoside Triphosphate Pyrophosphohydrolase | 0.9499 | 16 | 145 | 3.90.79.10 |
| 1vcdB01 | Alpha Beta;Alpha-Beta Complex;Nucleoside Triphosphate Pyrophosphohydrolase;Nucleoside Triphosphate Pyrophosphohydrolase | 0.9197 | 16 | 146 | 3.90.79.10 |
| 2pbtB01 | Alpha Beta;Alpha-Beta Complex;Nucleoside Triphosphate Pyrophosphohydrolase;Nucleoside Triphosphate Pyrophosphohydrolase | 0.9139 | 16 | 145 | 3.90.79.10 |
| 1vcdB01 | Alpha Beta;Alpha-Beta Complex;Nucleoside Triphosphate Pyrophosphohydrolase;Nucleoside Triphosphate Pyrophosphohydrolase | 0.8982 | 16 | 146 | 3.90.79.10 |
| af_P9WIY3_15_154_3.90.79.10 | Alpha Beta;Alpha-Beta Complex;Nucleoside Triphosphate Pyrophosphohydrolase;Nucleoside Triphosphate Pyrophosphohydrolase | 0.8912 | 13 | 141 | 3.90.79.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7W4HU80-F1-model_v4 | NUDIX domain-containing protein | 0.9954 | 23 | 152 |
GO:0004081
GO:0006167 GO:0006754 |
| AF-A0A660M028-F1-model_v4 | NUDIX domain-containing protein | 0.9895 | 2 | 152 |
GO:0004081
GO:0006167 GO:0006754 |
| AF-A0A7W4HU80-F1-model_v4 | NUDIX domain-containing protein | 0.9878 | 23 | 152 |
GO:0004081
GO:0006167 GO:0006754 |
| AF-A0A7C7HV55-F1-model_v4 | NUDIX domain-containing protein | 0.9822 | 2 | 152 |
GO:0004081
GO:0006167 GO:0006754 |
| AF-A0A7W1KHD8-F1-model_v4 | NUDIX domain-containing protein | 0.9815 | 1 | 152 |
GO:0004081
GO:0006167 GO:0006754 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar