F466335

General Info

Members Datasets Scaffolds Average Seq Length
584 220 1168 137

Family's Representative Sequence

Representative Sequence 3300005435|Ga0070714_100006277|Ga0070714_1000062772
Length 140
Sequence MRLKLAFAVAGAGLILAAVPAWAHHAFAAEFDAKHPVHFEGEVTKVELINPHSWIHVDVKGSDGTVTNWMFEAGSPNVLLRRGFTKNTIPVGTKVIVDGYQSKDGSNRANGRDITLPNGQKLFIGATGTGAPDEGGDKKQ

Samples

Sample ID Description Type Environment
1 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
2 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
3 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
4 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
14 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
15 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
16 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
17 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
18 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
19 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
20 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
21 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
22 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
23 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
24 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
25 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
26 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
27 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
28 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
29 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
30 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
31 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
32 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
33 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
34 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
35 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
36 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
37 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
38 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
39 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
40 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
41 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
42 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
43 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
44 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
45 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
46 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
47 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
48 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
49 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
50 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
51 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
52 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
53 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
54 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
55 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
56 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
57 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
58 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
59 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
60 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
61 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
62 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
63 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
64 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
65 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
66 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
67 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
68 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
69 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
70 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
71 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
72 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
73 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
74 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
75 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
76 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
77 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
78 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
79 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
80 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
81 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
82 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
83 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
84 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
85 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
86 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
87 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
88 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
89 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
90 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
91 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
92 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
93 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
94 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
95 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
96 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
97 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
98 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
99 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300028016 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 Metagenome Rhizosphere
138 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
141 3300030888 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU6 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
142 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
143 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
144 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
145 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
146 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
147 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
148 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
149 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
150 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
151 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
152 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
153 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
154 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
155 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
156 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
157 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
158 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
159 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
160 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
161 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
162 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
163 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
164 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
165 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
166 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
167 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
168 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
169 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
170 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
171 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
172 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
173 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
174 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
175 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
176 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
177 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
178 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
179 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
180 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
181 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
182 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
183 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
184 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
185 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
186 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
187 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
188 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
189 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
190 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
191 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
192 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
193 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
194 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
195 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
196 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
197 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
198 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
199 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
200 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
201 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
202 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
203 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
204 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
205 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
206 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
207 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
208 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
209 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
210 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
211 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
212 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
213 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
214 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
215 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
216 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
217 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
218 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
219 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
220 3300059477 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.26
Metatranscriptomes 2.74
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.68
Rhizosphere 96.92
Stem 0
Stem Tuber 0
Unclassified 30.65

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070714_100006277 3300005435 Bacteria 9160
2 Ga0058863_11855876 3300004799 Bacteria 1475
3 Ga0058861_11865700 3300004800 Unclassified 799
4 Ga0058862_12129794 3300004803 Bacteria 1482
5 Ga0058862_12224086 3300004803 Bacteria 982
6 Ga0058862_12240131 3300004803 Unclassified 981
7 Ga0058862_12575189 3300004803 Unclassified 1764
8 Ga0070658_10454590 3300005327 Bacteria 1104
9 Ga0070683_100003717 3300005329 Bacteria 12442
10 Ga0070683_100050193 3300005329 Bacteria 3861
11 Ga0070683_100062239 3300005329 Bacteria 3470
12 Ga0070683_100092996 3300005329 Bacteria 2832
13 Ga0070683_100151294 3300005329 Unclassified 2200
14 Ga0070690_100282848 3300005330 Unclassified 1184
15 Ga0070690_100391537 3300005330 Unclassified 1018
16 Ga0070690_100904050 3300005330 Bacteria 691
17 Ga0070690_101475273 3300005330 Bacteria 549
18 Ga0068869_100025151 3300005334 Unclassified 4131
19 Ga0068869_100708959 3300005334 Bacteria 859
20 Ga0068869_100863718 3300005334 Unclassified 781
21 Ga0068869_100950615 3300005334 Bacteria 746
22 Ga0070666_10187833 3300005335 Bacteria 1451
23 Ga0070680_100009677 3300005336 Bacteria 7416
24 Ga0068868_100362915 3300005338 Bacteria 1243
25 Ga0070689_100911234 3300005340 Bacteria 778
26 Ga0070691_10005647 3300005341 Bacteria 5702
27 Ga0070661_100126450 3300005344 Bacteria 1918
28 Ga0070661_101028279 3300005344 Unclassified 684
29 Ga0070675_101631151 3300005354 Bacteria 595
30 Ga0070671_100284049 3300005355 Bacteria 1408
31 Ga0070671_101387129 3300005355 Unclassified 621
32 Ga0070674_101902060 3300005356 Unclassified 541
33 Ga0070673_101129334 3300005364 Unclassified 733
34 Ga0070659_100008560 3300005366 Bacteria 7480
35 Ga0070709_10020775 3300005434 Unclassified 3817
36 Ga0070709_10056118 3300005434 Bacteria 2490
37 Ga0070709_10264932 3300005434 Bacteria 1243
38 Ga0070714_100252790 3300005435 Unclassified 1630
39 Ga0070714_100555785 3300005435 Unclassified 1099
40 Ga0070714_101202925 3300005435 Unclassified 739
41 Ga0070714_102212487 3300005435 Bacteria 535
42 Ga0070713_100001089 3300005436 Bacteria 17388
43 Ga0070713_100121074 3300005436 Bacteria 2295
44 Ga0070713_100366778 3300005436 Unclassified 1339
45 Ga0070713_100473165 3300005436 Unclassified 1179
46 Ga0070713_102235670 3300005436 Bacteria 530
47 Ga0070710_10283386 3300005437 Viruses 1076
48 Ga0070710_10289228 3300005437 Bacteria 1066
49 Ga0070710_11086370 3300005437 Unclassified 587
50 Ga0070711_100004716 3300005439 Bacteria 8071
51 Ga0070711_100206237 3300005439 Bacteria 1520
52 Ga0070711_100275568 3300005439 Bacteria 1329
53 Ga0070711_100542335 3300005439 Bacteria 964
54 Ga0070711_100658065 3300005439 Bacteria 879
55 Ga0070705_101533854 3300005440 Unclassified 559
56 Ga0070694_100941472 3300005444 Unclassified 715
57 Ga0070662_100080136 3300005457 Bacteria 2430
58 Ga0070681_10193640 3300005458 Bacteria 1952
59 Ga0070698_100189065 3300005471 Bacteria 1997
60 Ga0070698_100634877 3300005471 Unclassified 1009
61 Ga0070698_100874929 3300005471 Bacteria 844
62 Ga0070679_100002209 3300005530 Bacteria 17567
63 Ga0070684_100012682 3300005535 Bacteria 6762
64 Ga0070684_100067528 3300005535 Bacteria 3141
65 Ga0070684_100454774 3300005535 Bacteria 1184
66 Ga0070697_100505455 3300005536 Unclassified 1057
67 Ga0068853_100092275 3300005539 Bacteria 2664
68 Ga0068853_100552632 3300005539 Unclassified 1091
69 Ga0070672_100483912 3300005543 Unclassified 1069
70 Ga0070686_100345634 3300005544 Unclassified 1116
71 Ga0070693_100047240 3300005547 Unclassified 2449
72 Ga0070693_100129304 3300005547 Bacteria 1576
73 Ga0068855_100010995 3300005563 Bacteria 10921
74 Ga0068855_100024373 3300005563 Bacteria 7239
75 Ga0068855_101521309 3300005563 Bacteria 687
76 Ga0070664_100647940 3300005564 Unclassified 982
77 Ga0068857_100002058 3300005577 Bacteria 16336
78 Ga0068857_100016161 3300005577 Bacteria 6535
79 Ga0068854_100140994 3300005578 Bacteria 1850
80 Ga0068856_100006565 3300005614 Bacteria 11406
81 Ga0068856_100075815 3300005614 Bacteria 3331
82 Ga0068856_100198151 3300005614 Bacteria 2023
83 Ga0068856_100345429 3300005614 Bacteria 1506
84 Ga0068856_101612904 3300005614 Bacteria 662
85 Ga0070702_100180100 3300005615 Bacteria 1382
86 Ga0068852_100094938 3300005616 Bacteria 2677
87 Ga0068852_100437156 3300005616 Bacteria 1293
88 Ga0068852_101793180 3300005616 Unclassified 636
89 Ga0068859_100318307 3300005617 Bacteria 1650
90 Ga0068859_100553287 3300005617 Bacteria 1245
91 Ga0068859_100724632 3300005617 Unclassified 1084
92 Ga0068859_101190102 3300005617 Bacteria 839
93 Ga0068859_102062069 3300005617 Bacteria 630
94 Ga0068864_101092273 3300005618 Unclassified 794
95 Ga0068866_10307718 3300005718 Bacteria 992
96 Ga0068866_10499611 3300005718 Unclassified 804
97 Ga0068861_102005864 3300005719 Unclassified 577
98 Ga0068863_101258509 3300005841 Bacteria 746
99 Ga0068858_100057712 3300005842 Bacteria 3588
100 Ga0068858_100106022 3300005842 Bacteria 2623
101 Ga0068858_100369450 3300005842 Bacteria 1375
102 Ga0068858_100843962 3300005842 Bacteria 895
103 Ga0068860_100636665 3300005843 Unclassified 1074
104 Ga0068860_100834563 3300005843 Bacteria 936
105 Ga0068860_101175710 3300005843 Unclassified 787
106 Ga0068860_101954098 3300005843 Unclassified 608
107 Ga0081455_10046810 3300005937 Bacteria 3749
108 Ga0070717_10014020 3300006028 Bacteria 6158
109 Ga0070717_10304083 3300006028 Bacteria 1418
110 Ga0070717_11457920 3300006028 Unclassified 621
111 Ga0075432_10341911 3300006058 Unclassified 632
112 Ga0070712_100142038 3300006175 Unclassified 1833
113 Ga0097621_100032901 3300006237 Unclassified 4125
114 Ga0097621_100150181 3300006237 Bacteria 1998
115 Ga0097621_100458232 3300006237 Bacteria 1150
116 Ga0068871_100127782 3300006358 Unclassified 2153
117 Ga0068871_100456834 3300006358 Unclassified 1146
118 Ga0068871_100459952 3300006358 Unclassified 1142
119 Ga0068871_101604016 3300006358 Bacteria 616
120 Ga0075428_100120059 3300006844 Bacteria 2862
121 Ga0075428_100293161 3300006844 Bacteria 1750
122 Ga0075428_100610795 3300006844 Unclassified 1164
123 Ga0075428_100750156 3300006844 Unclassified 1039
124 Ga0075430_100421102 3300006846 Bacteria 1102
125 Ga0075431_100087154 3300006847 Unclassified 3222
126 Ga0075431_100735160 3300006847 Unclassified 963
127 Ga0075431_100812942 3300006847 Unclassified 907
128 Ga0075431_101097269 3300006847 Unclassified 760
129 Ga0075433_10086491 3300006852 Bacteria 2768
130 Ga0075433_10402057 3300006852 Bacteria 1208
131 Ga0075434_100005027 3300006871 Bacteria 12004
132 Ga0075434_100031812 3300006871 Bacteria 5203
133 Ga0075434_100055792 3300006871 Bacteria 3926
134 Ga0075434_100084911 3300006871 Unclassified 3165
135 Ga0075434_100087072 3300006871 Bacteria 3124
136 Ga0075434_100108333 3300006871 Bacteria 2788
137 Ga0075434_100655328 3300006871 Bacteria 1068
138 Ga0075434_100670661 3300006871 Bacteria 1055
139 Ga0075434_101543140 3300006871 Bacteria 673
140 Ga0075434_101822104 3300006871 Unclassified 615
141 Ga0075429_100033046 3300006880 Bacteria 4495
142 Ga0068865_100035739 3300006881 Unclassified 3345
143 Ga0068865_100104454 3300006881 Bacteria 2079
144 Ga0075436_100273989 3300006914 Bacteria 1205
145 Ga0075436_100662620 3300006914 Unclassified 771
146 Ga0097620_100318318 3300006931 Bacteria 1650
147 Ga0097620_100553255 3300006931 Bacteria 1245
148 Ga0097620_100724670 3300006931 Unclassified 1084
149 Ga0097620_101190435 3300006931 Bacteria 839
150 Ga0097620_102062066 3300006931 Bacteria 630
151 Ga0075435_100170473 3300007076 Bacteria 1836
152 Ga0075435_100284896 3300007076 Unclassified 1411
153 Ga0075435_100557109 3300007076 Bacteria 993
154 Ga0105240_10001470 3300009093 Bacteria 40285
155 Ga0105240_10002067 3300009093 Bacteria 32884
156 Ga0105240_10034115 3300009093 Bacteria 6567
157 Ga0105240_10333894 3300009093 Bacteria 1724
158 Ga0105240_10510498 3300009093 Bacteria 1335
159 Ga0105240_10526109 3300009093 Unclassified 1312
160 Ga0111539_10140582 3300009094 Unclassified 2826
161 Ga0111539_10275802 3300009094 Bacteria 1957
162 Ga0111539_10495511 3300009094 Bacteria 1423
163 Ga0105245_10000602 3300009098 Bacteria 32584
164 Ga0105245_10006654 3300009098 Bacteria 10143
165 Ga0105245_10008681 3300009098 Bacteria 8863
166 Ga0105245_10272666 3300009098 Bacteria 1651
167 Ga0105245_10276855 3300009098 Bacteria 1639
168 Ga0105245_12017995 3300009098 Bacteria 630
169 Ga0105245_12492545 3300009098 Unclassified 571
170 Ga0105247_10726322 3300009101 Bacteria 750
171 Ga0114129_10001331 3300009147 Bacteria 33128
172 Ga0114129_10014082 3300009147 Bacteria 11392
173 Ga0114129_10014439 3300009147 Bacteria 11255
174 Ga0114129_10032183 3300009147 Bacteria 7414
175 Ga0114129_10236545 3300009147 Unclassified 2457
176 Ga0114129_10249021 3300009147 Unclassified 2386
177 Ga0114129_10431401 3300009147 Bacteria 1731
178 Ga0114129_10571024 3300009147 Bacteria 1469
179 Ga0114129_10591720 3300009147 Bacteria 1438
180 Ga0114129_11069175 3300009147 Unclassified 1012
181 Ga0114129_11178454 3300009147 Bacteria 955
182 Ga0105243_10413699 3300009148 Bacteria 1256
183 Ga0105243_10571460 3300009148 Unclassified 1084
184 Ga0105243_11096747 3300009148 Unclassified 804
185 Ga0105241_10078175 3300009174 Bacteria 2585
186 Ga0105241_10115803 3300009174 Bacteria 2152
187 Ga0105241_10287815 3300009174 Unclassified 1406
188 Ga0105241_10393467 3300009174 Bacteria 1214
189 Ga0105241_10760168 3300009174 Unclassified 889
190 Ga0105241_11075742 3300009174 Unclassified 756
191 Ga0105242_10017458 3300009176 Bacteria 5594
192 Ga0105242_10041658 3300009176 Bacteria 3705
193 Ga0105242_10059545 3300009176 Bacteria 3134
194 Ga0105242_10108494 3300009176 Unclassified 2362
195 Ga0105242_10136934 3300009176 Bacteria 2120
196 Ga0105242_10205900 3300009176 Bacteria 1750
197 Ga0105242_10272303 3300009176 Bacteria 1534
198 Ga0105242_10775832 3300009176 Bacteria 946
199 Ga0105242_11090646 3300009176 Unclassified 812
200 Ga0105248_10003271 3300009177 Bacteria 17979
201 Ga0105248_10025106 3300009177 Bacteria 6625
202 Ga0105248_10167923 3300009177 Bacteria 2473
203 Ga0105248_11208480 3300009177 Bacteria 855
204 Ga0105237_10025936 3300009545 Bacteria 5992
205 Ga0105237_10149183 3300009545 Bacteria 2334
206 Ga0105237_11173600 3300009545 Bacteria 774
207 Ga0105238_10004133 3300009551 Bacteria 14403
208 Ga0105238_10013994 3300009551 Bacteria 8113
209 Ga0105238_10042599 3300009551 Bacteria 4596
210 Ga0105238_10054351 3300009551 Bacteria 4021
211 Ga0105238_10056150 3300009551 Bacteria 3951
212 Ga0105238_10773384 3300009551 Bacteria 975
213 Ga0105238_11292035 3300009551 Unclassified 755
214 Ga0105238_11658465 3300009551 Bacteria 670
215 Ga0105249_10016531 3300009553 Bacteria 6546
216 Ga0105249_10070925 3300009553 Bacteria 3218
217 Ga0105249_12577193 3300009553 Unclassified 581
218 Ga0105239_10002582 3300010375 Bacteria 22934
219 Ga0105239_10010549 3300010375 Bacteria 10331
220 Ga0105239_10029824 3300010375 Bacteria 5998
221 Ga0105239_10521813 3300010375 Bacteria 1351
222 Ga0105239_10704821 3300010375 Bacteria 1154
223 Ga0105239_10890406 3300010375 Unclassified 1021
224 Ga0105246_10005632 3300011119 Bacteria 7639
225 Ga0105246_10121081 3300011119 Bacteria 1939
226 Ga0105246_10339258 3300011119 Unclassified 1227
227 Ga0105246_10488486 3300011119 Unclassified 1043
228 Ga0105246_11406647 3300011119 Unclassified 651
229 Ga0157370_10003226 3300013104 Bacteria 19258
230 Ga0157370_10024893 3300013104 Bacteria 5926
231 Ga0157370_11160099 3300013104 Bacteria 697
232 Ga0157369_10001646 3300013105 Bacteria 27266
233 Ga0157369_10091175 3300013105 Unclassified 3254
234 Ga0157369_10506620 3300013105 Unclassified 1249
235 Ga0157369_11494943 3300013105 Bacteria 687
236 Ga0157374_10061994 3300013296 Bacteria 3504
237 Ga0157374_10074954 3300013296 Bacteria 3197
238 Ga0157374_10095370 3300013296 Bacteria 2845
239 Ga0157374_10337441 3300013296 Unclassified 1496
240 Ga0157374_10485679 3300013296 Unclassified 1239
241 Ga0157374_10539764 3300013296 Bacteria 1173
242 Ga0157378_10018216 3300013297 Bacteria 6164
243 Ga0157378_10022328 3300013297 Bacteria 5570
244 Ga0157378_10228634 3300013297 Unclassified 1771
245 Ga0157378_10335124 3300013297 Bacteria 1473
246 Ga0157378_11797480 3300013297 Bacteria 661
247 Ga0157378_11800494 3300013297 Unclassified 660
248 Ga0157378_12654581 3300013297 Unclassified 553
249 Ga0157378_13019409 3300013297 Bacteria 522
250 Ga0163162_10323030 3300013306 Bacteria 1676
251 Ga0163162_10424717 3300013306 Bacteria 1461
252 Ga0163162_10721152 3300013306 Bacteria 1118
253 Ga0163162_10988181 3300013306 Bacteria 951
254 Ga0163162_11621553 3300013306 Bacteria 738
255 Ga0163162_11688258 3300013306 Bacteria 723
256 Ga0157372_10003872 3300013307 Bacteria 16081
257 Ga0157372_10012703 3300013307 Bacteria 8970
258 Ga0157372_10172996 3300013307 Bacteria 2499
259 Ga0157372_10771379 3300013307 Bacteria 1118
260 Ga0157372_11057999 3300013307 Bacteria 939
261 Ga0157372_12433032 3300013307 Unclassified 601
262 Ga0157375_10001100 3300013308 Bacteria 23449
263 Ga0157375_10151007 3300013308 Bacteria 2458
264 Ga0157375_10407021 3300013308 Bacteria 1527
265 Ga0157375_11803316 3300013308 Bacteria 725
266 Ga0163163_10019966 3300014325 Bacteria 6304
267 Ga0163163_10499639 3300014325 Unclassified 1278
268 Ga0163163_10780439 3300014325 Bacteria 1019
269 Ga0163163_12834463 3300014325 Bacteria 541
270 Ga0163163_12958212 3300014325 Unclassified 530
271 Ga0157379_10263721 3300014968 Bacteria 1566
272 Ga0157379_10894797 3300014968 Unclassified 842
273 Ga0157379_10941349 3300014968 Unclassified 821
274 Ga0157379_11299523 3300014968 Bacteria 702
275 Ga0157376_10028179 3300014969 Bacteria 4461
276 Ga0157376_11019243 3300014969 Bacteria 851
277 Ga0163161_11395525 3300017792 Unclassified 612
278 Ga0163161_11435760 3300017792 Bacteria 604
279 Ga0197907_10157203 3300020069 Bacteria 596
280 Ga0206355_1706608 3300020076 Bacteria 672
281 Ga0206352_10822083 3300020078 Bacteria 2728
282 Ga0206354_11480115 3300020081 Unclassified 748
283 Ga0213873_10018134 3300021358 Bacteria 1615
284 Ga0213873_10184829 3300021358 Unclassified 641
285 Ga0213876_10167146 3300021384 Bacteria 1170
286 Ga0213876_10453955 3300021384 Unclassified 682
287 Ga0213875_10005857 3300021388 Bacteria 6535
288 Ga0213875_10017252 3300021388 Unclassified 3492
289 Ga0213875_10242558 3300021388 Unclassified 849
290 Ga0224712_10105373 3300022467 Unclassified 1202
291 Ga0207692_10105282 3300025898 Bacteria 1556
292 Ga0207692_10484606 3300025898 Bacteria 783
293 Ga0207699_10025338 3300025906 Unclassified 3255
294 Ga0207699_10041236 3300025906 Bacteria 2665
295 Ga0207699_10274807 3300025906 Bacteria 1169
296 Ga0207645_10455869 3300025907 Unclassified 863
297 Ga0207705_10153814 3300025909 Bacteria 1725
298 Ga0207654_10031909 3300025911 Bacteria 2905
299 Ga0207654_10058309 3300025911 Bacteria 2247
300 Ga0207707_10002548 3300025912 Bacteria 16326
301 Ga0207695_10002558 3300025913 Bacteria 26729
302 Ga0207695_10006265 3300025913 Bacteria 15488
303 Ga0207695_10031205 3300025913 Bacteria 5850
304 Ga0207695_10047903 3300025913 Bacteria 4518
305 Ga0207695_10246829 3300025913 Bacteria 1685
306 Ga0207695_10517275 3300025913 Unclassified 1075
307 Ga0207671_10007148 3300025914 Bacteria 9742
308 Ga0207671_10108253 3300025914 Bacteria 2112
309 Ga0207693_10054479 3300025915 Bacteria 3137
310 Ga0207663_10396787 3300025916 Unclassified 1054
311 Ga0207663_10573511 3300025916 Bacteria 884
312 Ga0207663_10687958 3300025916 Unclassified 809
313 Ga0207660_10009726 3300025917 Bacteria 6223
314 Ga0207657_10122678 3300025919 Bacteria 2137
315 Ga0207652_10003515 3300025921 Bacteria 12921
316 Ga0207694_10012429 3300025924 Bacteria 6417
317 Ga0207694_10048947 3300025924 Bacteria 3271
318 Ga0207694_10078420 3300025924 Bacteria 2589
319 Ga0207694_10150094 3300025924 Bacteria 1877
320 Ga0207694_10220425 3300025924 Bacteria 1547
321 Ga0207687_10003477 3300025927 Bacteria 10599
322 Ga0207687_10003733 3300025927 Bacteria 10240
323 Ga0207687_10003975 3300025927 Bacteria 9907
324 Ga0207687_10023378 3300025927 Bacteria 4119
325 Ga0207687_10487267 3300025927 Bacteria 1027
326 Ga0207687_10500507 3300025927 Bacteria 1014
327 Ga0207687_10531503 3300025927 Unclassified 985
328 Ga0207687_10651419 3300025927 Bacteria 891
329 Ga0207687_10732758 3300025927 Bacteria 840
330 Ga0207700_10001132 3300025928 Bacteria 15310
331 Ga0207700_10172466 3300025928 Bacteria 1805
332 Ga0207700_10471112 3300025928 Bacteria 1109
333 Ga0207700_10988334 3300025928 Bacteria 753
334 Ga0207664_10037330 3300025929 Bacteria 3759
335 Ga0207690_10067679 3300025932 Bacteria 2450
336 Ga0207686_10008528 3300025934 Bacteria 5536
337 Ga0207686_10033269 3300025934 Bacteria 3076
338 Ga0207686_10046321 3300025934 Bacteria 2681
339 Ga0207686_10172467 3300025934 Bacteria 1527
340 Ga0207686_10189383 3300025934 Unclassified 1465
341 Ga0207686_10243770 3300025934 Bacteria 1309
342 Ga0207686_10326961 3300025934 Bacteria 1148
343 Ga0207686_10353338 3300025934 Bacteria 1107
344 Ga0207709_10366975 3300025935 Bacteria 1092
345 Ga0207704_11240212 3300025938 Unclassified 636
346 Ga0207691_10567213 3300025940 Unclassified 962
347 Ga0207711_10000883 3300025941 Bacteria 28937
348 Ga0207711_10103478 3300025941 Bacteria 2521
349 Ga0207711_10192467 3300025941 Bacteria 1859
350 Ga0207689_10016668 3300025942 Bacteria 6218
351 Ga0207661_10007186 3300025944 Bacteria 7912
352 Ga0207661_10017976 3300025944 Bacteria 5247
353 Ga0207661_10118519 3300025944 Bacteria 2250
354 Ga0207661_10155622 3300025944 Unclassified 1979
355 Ga0207661_10183213 3300025944 Bacteria 1831
356 Ga0207667_10000636 3300025949 Bacteria 45432
357 Ga0207667_10004705 3300025949 Bacteria 16702
358 Ga0207667_10027397 3300025949 Bacteria 6203
359 Ga0207667_10163722 3300025949 Bacteria 2287
360 Ga0207667_10217449 3300025949 Bacteria 1958
361 Ga0207651_10357660 3300025960 Bacteria 1231
362 Ga0207712_10017934 3300025961 Bacteria 4607
363 Ga0207640_10125767 3300025981 Bacteria 1845
364 Ga0207658_10864903 3300025986 Bacteria 822
365 Ga0207703_10014205 3300026035 Bacteria 6210
366 Ga0207703_10261576 3300026035 Bacteria 1564
367 Ga0207703_10287794 3300026035 Bacteria 1495
368 Ga0207703_10304199 3300026035 Bacteria 1455
369 Ga0207639_10036925 3300026041 Bacteria 3625
370 Ga0207639_10608800 3300026041 Unclassified 1008
371 Ga0207639_11721791 3300026041 Unclassified 587
372 Ga0207702_10035049 3300026078 Bacteria 4196
373 Ga0207702_10169480 3300026078 Bacteria 2001
374 Ga0207702_10230521 3300026078 Bacteria 1731
375 Ga0207702_10697706 3300026078 Unclassified 1000
376 Ga0207641_10161604 3300026088 Bacteria 2037
377 Ga0207676_10372940 3300026095 Unclassified 1326
378 Ga0207674_10003310 3300026116 Bacteria 19811
379 Ga0207674_10004029 3300026116 Bacteria 17829
380 Ga0207674_10237375 3300026116 Bacteria 1770
381 Ga0207675_100963886 3300026118 Unclassified 871
382 Ga0207698_10005780 3300026142 Bacteria 7675
383 Ga0265354_1009399 3300028016 Bacteria 939
384 Ga0268265_11982850 3300028380 Unclassified 589
385 Ga0268264_11066230 3300028381 Unclassified 816
386 Ga0268264_11760291 3300028381 Bacteria 630
387 Ga0265338_10056036 3300028800 Bacteria 3501
388 Ga0265338_10142080 3300028800 Bacteria 1879
389 Ga0265769_111307 3300030888 Unclassified 619
390 Ga0265760_10068774 3300031090 Unclassified 1084
391 Ga0265760_10097374 3300031090 Bacteria 927
392 Ga0265760_10130726 3300031090 Unclassified 812
393 Ga0265332_10053986 3300031238 Bacteria 1724
394 Ga0265325_10072908 3300031241 Unclassified 1720
395 Ga0265313_10005853 3300031595 Bacteria 8920
396 Ga0265314_10229135 3300031711 Bacteria 1079
397 Ga0265342_10164855 3300031712 Bacteria 1223
398 Ga0373926_0402882 3300035083 Unclassified 540
399 Ga0373934_0001200 3300035086 Bacteria 9393
400 Ga0373934_0102288 3300035086 Bacteria 1158
401 Ga0373949_0075992 3300035090 Bacteria 887
402 Ga0373952_0155880 3300035092 Unclassified 644
403 Ga0373923_0021683 3300035111 Bacteria 2511
404 Ga0373923_0052300 3300035111 Unclassified 1716
405 Ga0373923_0079917 3300035111 Unclassified 1417
406 Ga0373953_0019816 3300035117 Bacteria 2507
407 Ga0373953_0036385 3300035117 Bacteria 1939
408 Ga0373953_0137904 3300035117 Unclassified 1042
409 Ga0373953_0255313 3300035117 Unclassified 762
410 Ga0373954_0001587 3300035118 Bacteria 9274
411 Ga0373954_0004540 3300035118 Bacteria 5977
412 Ga0373954_0035795 3300035118 Bacteria 2303
413 Ga0373956_0142425 3300035119 Bacteria 1126
414 Ga0373956_0145721 3300035119 Unclassified 1113
415 Ga0373956_0204265 3300035119 Unclassified 937
416 Ga0373957_0025239 3300035120 Bacteria 2140
417 Ga0373957_0083659 3300035120 Bacteria 1262
418 Ga0373957_0125392 3300035120 Bacteria 1042
419 Ga0373943_0250897 3300035170 Bacteria 994
420 Ga0373943_0280563 3300035170 Bacteria 942
421 Ga0373943_0382910 3300035170 Bacteria 810
422 Ga0373946_0681311 3300035171 Unclassified 537
423 Ga0373946_0747040 3300035171 Bacteria 513
424 Ga0373955_0063363 3300035172 Bacteria 2047
425 Ga0373955_0090056 3300035172 Bacteria 1747
426 Ga0373955_0533924 3300035172 Bacteria 717
427 Ga0373955_0768652 3300035172 Bacteria 592
428 Ga0373961_0166116 3300035241 Bacteria 761
429 Ga0373924_0038488 3300035410 Unclassified 1951
430 Ga0373924_0296801 3300035410 Bacteria 717
431 Ga0373931_0879046 3300035691 Bacteria 601
432 Ga0373931_1208544 3300035691 Unclassified 518
433 Ga0373935_0743930 3300035692 Bacteria 722
434 Ga0373935_0901718 3300035692 Unclassified 655
435 Ga0373935_1383663 3300035692 Unclassified 526
436 Ga0373927_0424599 3300035695 Unclassified 877
437 Ga0373927_0485775 3300035695 Bacteria 816
438 Ga0373927_0654137 3300035695 Unclassified 694
439 Ga0373933_0033477 3300035724 Bacteria 2990
440 Ga0373933_0066073 3300035724 Bacteria 2191
441 Ga0373933_0074280 3300035724 Bacteria 2073
442 Ga0373933_0119115 3300035724 Bacteria 1652
443 Ga0373933_0235457 3300035724 Unclassified 1177
444 Ga0373933_0867400 3300035724 Unclassified 594
445 Ga0373947_0061992 3300035725 Unclassified 2274
446 Ga0373947_0142360 3300035725 Bacteria 1539
447 Ga0373947_0288207 3300035725 Unclassified 1093
448 Ga0373947_0882086 3300035725 Unclassified 611
449 Ga0373947_0900627 3300035725 Unclassified 604
450 Ga0373937_0006320 3300036401 Bacteria 10213
451 Ga0373937_0009455 3300036401 Bacteria 8473
452 Ga0373937_0019061 3300036401 Bacteria 6139
453 Ga0373937_0024393 3300036401 Bacteria 5455
454 Ga0373937_0102920 3300036401 Bacteria 2652
455 Ga0373937_0106232 3300036401 Unclassified 2610
456 Ga0373937_0240024 3300036401 Bacteria 1707
457 Ga0373937_0426841 3300036401 Unclassified 1258
458 Ga0373937_0748308 3300036401 Unclassified 925
459 Ga0373937_0938140 3300036401 Unclassified 814
460 Ga0373937_1147185 3300036401 Unclassified 726
461 Ga0373937_1790531 3300036401 Bacteria 561
462 Ga0373937_2135326 3300036401 Unclassified 506
463 Ga0373925_0034401 3300037068 Bacteria 3734
464 Ga0373925_0137406 3300037068 Bacteria 1911
465 Ga0373925_0182392 3300037068 Bacteria 1662
466 Ga0373925_0306775 3300037068 Bacteria 1282
467 Ga0436364_0319349 3300037853 Bacteria 867
468 Ga0436364_0635190 3300037853 Bacteria 906
469 Ga0436364_0770372 3300037853 Bacteria 5616
470 Ga0436364_0833812 3300037853 Bacteria 2481
471 Ga0436364_0852686 3300037853 Bacteria 1587
472 Ga0436365_0280398 3300039437 Bacteria 2160
473 Ga0436365_0926245 3300039437 Bacteria 4085
474 Ga0436365_1922631 3300039437 Bacteria 7275
475 Ga0436360_0097118 3300039438 Unclassified 794
476 Ga0436360_0842698 3300039438 Bacteria 532
477 Ga0436360_1257646 3300039438 Unclassified 694
478 Ga0436361_0235800 3300039447 Bacteria 549
479 Ga0436363_1029109 3300039450 Bacteria 1389
480 Ga0436362_0030673 3300039453 Unclassified 646
481 Ga0436362_0727245 3300039453 Unclassified 1507
482 Ga0436362_1073911 3300039453 Unclassified 674
483 Ga0495592_0163553 3300046454 Bacteria 1529
484 Ga0495651_0073380 3300046462 Bacteria 2598
485 Ga0495653_0589077 3300046463 Unclassified 685
486 Ga0495580_0015199 3300046472 Bacteria 5819
487 Ga0495580_0036785 3300046472 Bacteria 3514
488 Ga0495580_0046586 3300046472 Bacteria 3075
489 Ga0495580_0056940 3300046472 Bacteria 2752
490 Ga0495580_0092225 3300046472 Bacteria 2108
491 Ga0495580_0440568 3300046472 Unclassified 875
492 Ga0495580_0679053 3300046472 Bacteria 675
493 Ga0495582_0001720 3300046473 Bacteria 12344
494 Ga0495582_0134878 3300046473 Unclassified 1396
495 Ga0495594_0035651 3300046499 Bacteria 2711
496 Ga0495594_0389319 3300046499 Bacteria 793
497 Ga0495628_0163463 3300046516 Bacteria 1691
498 Ga0495628_0329105 3300046516 Bacteria 1126
499 Ga0495630_0588205 3300046517 Unclassified 853
500 Ga0495630_0723523 3300046517 Bacteria 761
501 Ga0495666_0548092 3300046526 Bacteria 516
502 Ga0495652_0022348 3300046529 Bacteria 5612
503 Ga0495652_0147450 3300046529 Bacteria 1842
504 Ga0495652_0167234 3300046529 Bacteria 1701
505 Ga0495652_0181824 3300046529 Bacteria 1613
506 Ga0495652_0574307 3300046529 Unclassified 772
507 Ga0495652_0928002 3300046529 Bacteria 573
508 Ga0495652_1025659 3300046529 Unclassified 539
509 Ga0495665_0087230 3300046531 Bacteria 1640
510 Ga0495640_0283522 3300046533 Unclassified 1031
511 Ga0495586_0018661 3300046535 Unclassified 3693
512 Ga0495586_0837110 3300046535 Unclassified 530
513 Ga0495587_0333725 3300046536 Bacteria 846
514 Ga0495587_0437881 3300046536 Unclassified 725
515 Ga0495645_0122334 3300046543 Bacteria 1831
516 Ga0495667_0020428 3300046559 Unclassified 4469
517 Ga0495667_0079210 3300046559 Bacteria 2136
518 Ga0495667_1019158 3300046559 Unclassified 504
519 Ga0495634_0167143 3300046642 Unclassified 1384
520 Ga0495635_0451056 3300046663 Unclassified 850
521 Ga0495588_0392083 3300046674 Bacteria 729
522 Ga0495657_0493544 3300046675 Unclassified 714
523 Ga0495599_0005463 3300046678 Bacteria 7600
524 Ga0495599_0020953 3300046678 Bacteria 4076
525 Ga0495623_0156011 3300046679 Bacteria 1345
526 Ga0495658_0015511 3300046683 Bacteria 3910
527 Ga0495613_0068798 3300046689 Bacteria 2582
528 Ga0495613_0127982 3300046689 Bacteria 1820
529 Ga0495624_0285743 3300046690 Unclassified 996
530 Ga0495581_0122747 3300047315 Bacteria 1512
531 Ga0495636_0237278 3300047318 Unclassified 840
532 Ga0495674_0404176 3300047319 Unclassified 1102
533 Ga0495674_0454092 3300047319 Bacteria 1029
534 Ga0495674_1350017 3300047319 Bacteria 533
535 Ga0495680_0822898 3300047322 Unclassified 605
536 Ga0495675_0148756 3300047444 Bacteria 1448
537 Ga0495675_0253480 3300047444 Bacteria 1056
538 Ga0495675_0260306 3300047444 Unclassified 1039
539 Ga0495684_0011773 3300047471 Bacteria 6749
540 Ga0495684_0025138 3300047471 Bacteria 4580
541 Ga0495684_0089951 3300047471 Bacteria 2326
542 Ga0495684_0108830 3300047471 Bacteria 2093
543 Ga0495684_0226188 3300047471 Bacteria 1370
544 Ga0495684_0288333 3300047471 Unclassified 1182
545 Ga0495602_0000669 3300048088 Bacteria 32135
546 Ga0495602_0117336 3300048088 Bacteria 2149
547 Ga0495602_0336103 3300048088 Unclassified 1094
548 Ga0496104_0750441 3300048907 Bacteria 883
549 Ga0496106_0419204 3300048909 Unclassified 1076
550 Ga0496112_0316220 3300048915 Bacteria 1506
551 Ga0496115_0164950 3300048918 Bacteria 1832
552 nmdc:mga05p37_1161232_c1 3300050507 Bacteria 802
553 nmdc:mga05p37_137217_c1 3300050507 Bacteria 2998
554 nmdc:mga05p37_1900479_c1 3300050507 Unclassified 569
555 nmdc:mga05p37_237947_c1 3300050507 Bacteria 2191
556 nmdc:mga05p37_36305_c1 3300050507 Bacteria 6046
557 nmdc:mga05p37_415374_c1 3300050507 Bacteria 1567
558 nmdc:mga05p37_46870_c1 3300050507 Bacteria 5315
559 nmdc:mga05p37_51146_c1 3300050507 Bacteria 5082
560 nmdc:mga05p37_52494_c1 3300050507 Bacteria 5013
561 nmdc:mga05p37_589_c1 3300050507 Bacteria 40002
562 nmdc:mga05p37_689635_c1 3300050507 Bacteria 1137
563 nmdc:mga09592_126504_c1 3300050508 Bacteria 2197
564 nmdc:mga09592_1427738_c1 3300050508 Unclassified 565
565 nmdc:mga09592_198303_c1 3300050508 Bacteria 1738
566 nmdc:mga0qj67_386425_c1 3300050509 Bacteria 1130
567 nmdc:mga0qj67_750243_c1 3300050509 Bacteria 774
568 nmdc:mga06r32_1060033_c1 3300050510 Bacteria 761
569 nmdc:mga06r32_1369473_c1 3300050510 Bacteria 650
570 nmdc:mga06r32_384654_c1 3300050510 Unclassified 1386
571 nmdc:mga06r32_948228_c1 3300050510 Unclassified 815
572 nmdc:mga06r32_979589_c1 3300050510 Unclassified 799
573 nmdc:mga08y16_1355965_c1 3300050511 Unclassified 676
574 nmdc:mga0n895_114697_c1 3300050512 Bacteria 2712
575 nmdc:mga0n895_1379308_c1 3300050512 Unclassified 674
576 nmdc:mga0n895_219982_c1 3300050512 Unclassified 1928
577 nmdc:mga0n895_44939_c1 3300050512 Bacteria 4308
578 nmdc:mga0n895_591747_c1 3300050512 Bacteria 1112
579 nmdc:mga0n895_637797_c1 3300050512 Bacteria 1065
580 nmdc:mga0rr50_80570_c1 3300050513 Bacteria 2510
581 nmdc:mga0a205_3457_c2 3300050515 Bacteria 10959
582 nmdc:mga0a205_514808_c1 3300050515 Unclassified 1053
583 Ga0495601_0166837 3300053077 Bacteria 1439
584 Ga0587084_094774 3300059477 Unclassified 597
585 Ga0070714_100006277
586 Ga0058863_11855876
587 Ga0058861_11865700
588 Ga0058862_12129794
589 Ga0058862_12224086
590 Ga0058862_12240131
591 Ga0058862_12575189
592 Ga0070658_10454590
593 Ga0070683_100003717
594 Ga0070683_100050193
595 Ga0070683_100062239
596 Ga0070683_100092996
597 Ga0070683_100151294
598 Ga0070690_100282848
599 Ga0070690_100391537
600 Ga0070690_100904050
601 Ga0070690_101475273
602 Ga0068869_100025151
603 Ga0068869_100708959
604 Ga0068869_100863718
605 Ga0068869_100950615
606 Ga0070666_10187833
607 Ga0070680_100009677
608 Ga0068868_100362915
609 Ga0070689_100911234
610 Ga0070691_10005647
611 Ga0070661_100126450
612 Ga0070661_101028279
613 Ga0070675_101631151
614 Ga0070671_100284049
615 Ga0070671_101387129
616 Ga0070674_101902060
617 Ga0070673_101129334
618 Ga0070659_100008560
619 Ga0070709_10020775
620 Ga0070709_10056118
621 Ga0070709_10264932
622 Ga0070714_100252790
623 Ga0070714_100555785
624 Ga0070714_101202925
625 Ga0070714_102212487
626 Ga0070713_100001089
627 Ga0070713_100121074
628 Ga0070713_100366778
629 Ga0070713_100473165
630 Ga0070713_102235670
631 Ga0070710_10283386
632 Ga0070710_10289228
633 Ga0070710_11086370
634 Ga0070711_100004716
635 Ga0070711_100206237
636 Ga0070711_100275568
637 Ga0070711_100542335
638 Ga0070711_100658065
639 Ga0070705_101533854
640 Ga0070694_100941472
641 Ga0070662_100080136
642 Ga0070681_10193640
643 Ga0070698_100189065
644 Ga0070698_100634877
645 Ga0070698_100874929
646 Ga0070679_100002209
647 Ga0070684_100012682
648 Ga0070684_100067528
649 Ga0070684_100454774
650 Ga0070697_100505455
651 Ga0068853_100092275
652 Ga0068853_100552632
653 Ga0070672_100483912
654 Ga0070686_100345634
655 Ga0070693_100047240
656 Ga0070693_100129304
657 Ga0068855_100010995
658 Ga0068855_100024373
659 Ga0068855_101521309
660 Ga0070664_100647940
661 Ga0068857_100002058
662 Ga0068857_100016161
663 Ga0068854_100140994
664 Ga0068856_100006565
665 Ga0068856_100075815
666 Ga0068856_100198151
667 Ga0068856_100345429
668 Ga0068856_101612904
669 Ga0070702_100180100
670 Ga0068852_100094938
671 Ga0068852_100437156
672 Ga0068852_101793180
673 Ga0068859_100318307
674 Ga0068859_100553287
675 Ga0068859_100724632
676 Ga0068859_101190102
677 Ga0068859_102062069
678 Ga0068864_101092273
679 Ga0068866_10307718
680 Ga0068866_10499611
681 Ga0068861_102005864
682 Ga0068863_101258509
683 Ga0068858_100057712
684 Ga0068858_100106022
685 Ga0068858_100369450
686 Ga0068858_100843962
687 Ga0068860_100636665
688 Ga0068860_100834563
689 Ga0068860_101175710
690 Ga0068860_101954098
691 Ga0081455_10046810
692 Ga0070717_10014020
693 Ga0070717_10304083
694 Ga0070717_11457920
695 Ga0075432_10341911
696 Ga0070712_100142038
697 Ga0097621_100032901
698 Ga0097621_100150181
699 Ga0097621_100458232
700 Ga0068871_100127782
701 Ga0068871_100456834
702 Ga0068871_100459952
703 Ga0068871_101604016
704 Ga0075428_100120059
705 Ga0075428_100293161
706 Ga0075428_100610795
707 Ga0075428_100750156
708 Ga0075430_100421102
709 Ga0075431_100087154
710 Ga0075431_100735160
711 Ga0075431_100812942
712 Ga0075431_101097269
713 Ga0075433_10086491
714 Ga0075433_10402057
715 Ga0075434_100005027
716 Ga0075434_100031812
717 Ga0075434_100055792
718 Ga0075434_100084911
719 Ga0075434_100087072
720 Ga0075434_100108333
721 Ga0075434_100655328
722 Ga0075434_100670661
723 Ga0075434_101543140
724 Ga0075434_101822104
725 Ga0075429_100033046
726 Ga0068865_100035739
727 Ga0068865_100104454
728 Ga0075436_100273989
729 Ga0075436_100662620
730 Ga0097620_100318318
731 Ga0097620_100553255
732 Ga0097620_100724670
733 Ga0097620_101190435
734 Ga0097620_102062066
735 Ga0075435_100170473
736 Ga0075435_100284896
737 Ga0075435_100557109
738 Ga0105240_10001470
739 Ga0105240_10002067
740 Ga0105240_10034115
741 Ga0105240_10333894
742 Ga0105240_10510498
743 Ga0105240_10526109
744 Ga0111539_10140582
745 Ga0111539_10275802
746 Ga0111539_10495511
747 Ga0105245_10000602
748 Ga0105245_10006654
749 Ga0105245_10008681
750 Ga0105245_10272666
751 Ga0105245_10276855
752 Ga0105245_12017995
753 Ga0105245_12492545
754 Ga0105247_10726322
755 Ga0114129_10001331
756 Ga0114129_10014082
757 Ga0114129_10014439
758 Ga0114129_10032183
759 Ga0114129_10236545
760 Ga0114129_10249021
761 Ga0114129_10431401
762 Ga0114129_10571024
763 Ga0114129_10591720
764 Ga0114129_11069175
765 Ga0114129_11178454
766 Ga0105243_10413699
767 Ga0105243_10571460
768 Ga0105243_11096747
769 Ga0105241_10078175
770 Ga0105241_10115803
771 Ga0105241_10287815
772 Ga0105241_10393467
773 Ga0105241_10760168
774 Ga0105241_11075742
775 Ga0105242_10017458
776 Ga0105242_10041658
777 Ga0105242_10059545
778 Ga0105242_10108494
779 Ga0105242_10136934
780 Ga0105242_10205900
781 Ga0105242_10272303
782 Ga0105242_10775832
783 Ga0105242_11090646
784 Ga0105248_10003271
785 Ga0105248_10025106
786 Ga0105248_10167923
787 Ga0105248_11208480
788 Ga0105237_10025936
789 Ga0105237_10149183
790 Ga0105237_11173600
791 Ga0105238_10004133
792 Ga0105238_10013994
793 Ga0105238_10042599
794 Ga0105238_10054351
795 Ga0105238_10056150
796 Ga0105238_10773384
797 Ga0105238_11292035
798 Ga0105238_11658465
799 Ga0105249_10016531
800 Ga0105249_10070925
801 Ga0105249_12577193
802 Ga0105239_10002582
803 Ga0105239_10010549
804 Ga0105239_10029824
805 Ga0105239_10521813
806 Ga0105239_10704821
807 Ga0105239_10890406
808 Ga0105246_10005632
809 Ga0105246_10121081
810 Ga0105246_10339258
811 Ga0105246_10488486
812 Ga0105246_11406647
813 Ga0157370_10003226
814 Ga0157370_10024893
815 Ga0157370_11160099
816 Ga0157369_10001646
817 Ga0157369_10091175
818 Ga0157369_10506620
819 Ga0157369_11494943
820 Ga0157374_10061994
821 Ga0157374_10074954
822 Ga0157374_10095370
823 Ga0157374_10337441
824 Ga0157374_10485679
825 Ga0157374_10539764
826 Ga0157378_10018216
827 Ga0157378_10022328
828 Ga0157378_10228634
829 Ga0157378_10335124
830 Ga0157378_11797480
831 Ga0157378_11800494
832 Ga0157378_12654581
833 Ga0157378_13019409
834 Ga0163162_10323030
835 Ga0163162_10424717
836 Ga0163162_10721152
837 Ga0163162_10988181
838 Ga0163162_11621553
839 Ga0163162_11688258
840 Ga0157372_10003872
841 Ga0157372_10012703
842 Ga0157372_10172996
843 Ga0157372_10771379
844 Ga0157372_11057999
845 Ga0157372_12433032
846 Ga0157375_10001100
847 Ga0157375_10151007
848 Ga0157375_10407021
849 Ga0157375_11803316
850 Ga0163163_10019966
851 Ga0163163_10499639
852 Ga0163163_10780439
853 Ga0163163_12834463
854 Ga0163163_12958212
855 Ga0157379_10263721
856 Ga0157379_10894797
857 Ga0157379_10941349
858 Ga0157379_11299523
859 Ga0157376_10028179
860 Ga0157376_11019243
861 Ga0163161_11395525
862 Ga0163161_11435760
863 Ga0197907_10157203
864 Ga0206355_1706608
865 Ga0206352_10822083
866 Ga0206354_11480115
867 Ga0213873_10018134
868 Ga0213873_10184829
869 Ga0213876_10167146
870 Ga0213876_10453955
871 Ga0213875_10005857
872 Ga0213875_10017252
873 Ga0213875_10242558
874 Ga0224712_10105373
875 Ga0207692_10105282
876 Ga0207692_10484606
877 Ga0207699_10025338
878 Ga0207699_10041236
879 Ga0207699_10274807
880 Ga0207645_10455869
881 Ga0207705_10153814
882 Ga0207654_10031909
883 Ga0207654_10058309
884 Ga0207707_10002548
885 Ga0207695_10002558
886 Ga0207695_10006265
887 Ga0207695_10031205
888 Ga0207695_10047903
889 Ga0207695_10246829
890 Ga0207695_10517275
891 Ga0207671_10007148
892 Ga0207671_10108253
893 Ga0207693_10054479
894 Ga0207663_10396787
895 Ga0207663_10573511
896 Ga0207663_10687958
897 Ga0207660_10009726
898 Ga0207657_10122678
899 Ga0207652_10003515
900 Ga0207694_10012429
901 Ga0207694_10048947
902 Ga0207694_10078420
903 Ga0207694_10150094
904 Ga0207694_10220425
905 Ga0207687_10003477
906 Ga0207687_10003733
907 Ga0207687_10003975
908 Ga0207687_10023378
909 Ga0207687_10487267
910 Ga0207687_10500507
911 Ga0207687_10531503
912 Ga0207687_10651419
913 Ga0207687_10732758
914 Ga0207700_10001132
915 Ga0207700_10172466
916 Ga0207700_10471112
917 Ga0207700_10988334
918 Ga0207664_10037330
919 Ga0207690_10067679
920 Ga0207686_10008528
921 Ga0207686_10033269
922 Ga0207686_10046321
923 Ga0207686_10172467
924 Ga0207686_10189383
925 Ga0207686_10243770
926 Ga0207686_10326961
927 Ga0207686_10353338
928 Ga0207709_10366975
929 Ga0207704_11240212
930 Ga0207691_10567213
931 Ga0207711_10000883
932 Ga0207711_10103478
933 Ga0207711_10192467
934 Ga0207689_10016668
935 Ga0207661_10007186
936 Ga0207661_10017976
937 Ga0207661_10118519
938 Ga0207661_10155622
939 Ga0207661_10183213
940 Ga0207667_10000636
941 Ga0207667_10004705
942 Ga0207667_10027397
943 Ga0207667_10163722
944 Ga0207667_10217449
945 Ga0207651_10357660
946 Ga0207712_10017934
947 Ga0207640_10125767
948 Ga0207658_10864903
949 Ga0207703_10014205
950 Ga0207703_10261576
951 Ga0207703_10287794
952 Ga0207703_10304199
953 Ga0207639_10036925
954 Ga0207639_10608800
955 Ga0207639_11721791
956 Ga0207702_10035049
957 Ga0207702_10169480
958 Ga0207702_10230521
959 Ga0207702_10697706
960 Ga0207641_10161604
961 Ga0207676_10372940
962 Ga0207674_10003310
963 Ga0207674_10004029
964 Ga0207674_10237375
965 Ga0207675_100963886
966 Ga0207698_10005780
967 Ga0265354_1009399
968 Ga0268265_11982850
969 Ga0268264_11066230
970 Ga0268264_11760291
971 Ga0265338_10056036
972 Ga0265338_10142080
973 Ga0265769_111307
974 Ga0265760_10068774
975 Ga0265760_10097374
976 Ga0265760_10130726
977 Ga0265332_10053986
978 Ga0265325_10072908
979 Ga0265313_10005853
980 Ga0265314_10229135
981 Ga0265342_10164855
982 Ga0373926_0402882
983 Ga0373934_0001200
984 Ga0373934_0102288
985 Ga0373949_0075992
986 Ga0373952_0155880
987 Ga0373923_0021683
988 Ga0373923_0052300
989 Ga0373923_0079917
990 Ga0373953_0019816
991 Ga0373953_0036385
992 Ga0373953_0137904
993 Ga0373953_0255313
994 Ga0373954_0001587
995 Ga0373954_0004540
996 Ga0373954_0035795
997 Ga0373956_0142425
998 Ga0373956_0145721
999 Ga0373956_0204265
1000 Ga0373957_0025239
1001 Ga0373957_0083659
1002 Ga0373957_0125392
1003 Ga0373943_0250897
1004 Ga0373943_0280563
1005 Ga0373943_0382910
1006 Ga0373946_0681311
1007 Ga0373946_0747040
1008 Ga0373955_0063363
1009 Ga0373955_0090056
1010 Ga0373955_0533924
1011 Ga0373955_0768652
1012 Ga0373961_0166116
1013 Ga0373924_0038488
1014 Ga0373924_0296801
1015 Ga0373931_0879046
1016 Ga0373931_1208544
1017 Ga0373935_0743930
1018 Ga0373935_0901718
1019 Ga0373935_1383663
1020 Ga0373927_0424599
1021 Ga0373927_0485775
1022 Ga0373927_0654137
1023 Ga0373933_0033477
1024 Ga0373933_0066073
1025 Ga0373933_0074280
1026 Ga0373933_0119115
1027 Ga0373933_0235457
1028 Ga0373933_0867400
1029 Ga0373947_0061992
1030 Ga0373947_0142360
1031 Ga0373947_0288207
1032 Ga0373947_0882086
1033 Ga0373947_0900627
1034 Ga0373937_0006320
1035 Ga0373937_0009455
1036 Ga0373937_0019061
1037 Ga0373937_0024393
1038 Ga0373937_0102920
1039 Ga0373937_0106232
1040 Ga0373937_0240024
1041 Ga0373937_0426841
1042 Ga0373937_0748308
1043 Ga0373937_0938140
1044 Ga0373937_1147185
1045 Ga0373937_1790531
1046 Ga0373937_2135326
1047 Ga0373925_0034401
1048 Ga0373925_0137406
1049 Ga0373925_0182392
1050 Ga0373925_0306775
1051 Ga0436364_0319349
1052 Ga0436364_0635190
1053 Ga0436364_0770372
1054 Ga0436364_0833812
1055 Ga0436364_0852686
1056 Ga0436365_0280398
1057 Ga0436365_0926245
1058 Ga0436365_1922631
1059 Ga0436360_0097118
1060 Ga0436360_0842698
1061 Ga0436360_1257646
1062 Ga0436361_0235800
1063 Ga0436363_1029109
1064 Ga0436362_0030673
1065 Ga0436362_0727245
1066 Ga0436362_1073911
1067 Ga0495592_0163553
1068 Ga0495651_0073380
1069 Ga0495653_0589077
1070 Ga0495580_0015199
1071 Ga0495580_0036785
1072 Ga0495580_0046586
1073 Ga0495580_0056940
1074 Ga0495580_0092225
1075 Ga0495580_0440568
1076 Ga0495580_0679053
1077 Ga0495582_0001720
1078 Ga0495582_0134878
1079 Ga0495594_0035651
1080 Ga0495594_0389319
1081 Ga0495628_0163463
1082 Ga0495628_0329105
1083 Ga0495630_0588205
1084 Ga0495630_0723523
1085 Ga0495666_0548092
1086 Ga0495652_0022348
1087 Ga0495652_0147450
1088 Ga0495652_0167234
1089 Ga0495652_0181824
1090 Ga0495652_0574307
1091 Ga0495652_0928002
1092 Ga0495652_1025659
1093 Ga0495665_0087230
1094 Ga0495640_0283522
1095 Ga0495586_0018661
1096 Ga0495586_0837110
1097 Ga0495587_0333725
1098 Ga0495587_0437881
1099 Ga0495645_0122334
1100 Ga0495667_0020428
1101 Ga0495667_0079210
1102 Ga0495667_1019158
1103 Ga0495634_0167143
1104 Ga0495635_0451056
1105 Ga0495588_0392083
1106 Ga0495657_0493544
1107 Ga0495599_0005463
1108 Ga0495599_0020953
1109 Ga0495623_0156011
1110 Ga0495658_0015511
1111 Ga0495613_0068798
1112 Ga0495613_0127982
1113 Ga0495624_0285743
1114 Ga0495581_0122747
1115 Ga0495636_0237278
1116 Ga0495674_0404176
1117 Ga0495674_0454092
1118 Ga0495674_1350017
1119 Ga0495680_0822898
1120 Ga0495675_0148756
1121 Ga0495675_0253480
1122 Ga0495675_0260306
1123 Ga0495684_0011773
1124 Ga0495684_0025138
1125 Ga0495684_0089951
1126 Ga0495684_0108830
1127 Ga0495684_0226188
1128 Ga0495684_0288333
1129 Ga0495602_0000669
1130 Ga0495602_0117336
1131 Ga0495602_0336103
1132 Ga0496104_0750441
1133 Ga0496106_0419204
1134 Ga0496112_0316220
1135 Ga0496115_0164950
1136 nmdc:mga05p37_1161232_c1
1137 nmdc:mga05p37_137217_c1
1138 nmdc:mga05p37_1900479_c1
1139 nmdc:mga05p37_237947_c1
1140 nmdc:mga05p37_36305_c1
1141 nmdc:mga05p37_415374_c1
1142 nmdc:mga05p37_46870_c1
1143 nmdc:mga05p37_51146_c1
1144 nmdc:mga05p37_52494_c1
1145 nmdc:mga05p37_589_c1
1146 nmdc:mga05p37_689635_c1
1147 nmdc:mga09592_126504_c1
1148 nmdc:mga09592_1427738_c1
1149 nmdc:mga09592_198303_c1
1150 nmdc:mga0qj67_386425_c1
1151 nmdc:mga0qj67_750243_c1
1152 nmdc:mga06r32_1060033_c1
1153 nmdc:mga06r32_1369473_c1
1154 nmdc:mga06r32_384654_c1
1155 nmdc:mga06r32_948228_c1
1156 nmdc:mga06r32_979589_c1
1157 nmdc:mga08y16_1355965_c1
1158 nmdc:mga0n895_114697_c1
1159 nmdc:mga0n895_1379308_c1
1160 nmdc:mga0n895_219982_c1
1161 nmdc:mga0n895_44939_c1
1162 nmdc:mga0n895_591747_c1
1163 nmdc:mga0n895_637797_c1
1164 nmdc:mga0rr50_80570_c1
1165 nmdc:mga0a205_3457_c2
1166 nmdc:mga0a205_514808_c1
1167 Ga0495601_0166837
1168 Ga0587084_094774

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF19649

DUF6152

Family of unknown function (DUF6152)

11

111

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
4fxd-assembly1.cif.gz_A crystal structure of yeast dna polymerase alpha bound to dna/rna 0.8402 39 73
4fxd-assembly2.cif.gz_B crystal structure of yeast dna polymerase alpha bound to dna/rna 0.8392 39 73
4b08-assembly1.cif.gz_A yeast dna polymerase alpha, selenomethionine protein 0.8242 39 73
8foc-assembly1.cif.gz_1 cryo-em structure of s. cerevisiae dna polymerase alpha-primase in apo state conformation i 0.8115 38 73
8foe-assembly1.cif.gz_1 cryo-em structure of s. cerevisiae dna polymerase alpha-primase complex bound to a template dna 0.8103 38 73
ID Description Score Start End Superfamily
af_Q9VKY7_200_296_2.30.29.30 Mainly Beta;Roll;PH-domain like;Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 0.8403 43 76 2.30.29.30
4fxdB01 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P); 0.8392 39 73 2.40.50.730
2awoD03 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.8244 37 75 2.40.50.140
af_Q54R65_1_135_3.40.20.10 Alpha Beta;3-Layer(aba) Sandwich;Severin;Severin 0.8043 52 74 3.40.20.10
2jjdF02 Alpha Beta;Alpha-Beta Complex;Protein-Tyrosine Phosphatase; Chain A;Protein tyrosine phosphatase superfamily 0.8024 43 72 3.90.190.10
ID Description Score Start End GO Terms
AF-A0A382AM76-F1-model_v4 OB-fold nucleic acid binding domain-containing protein 0.9323 17 119
AF-A0A2E5NKG2-F1-model_v4 OB-fold nucleic acid binding domain-containing protein 0.9277 17 125
AF-A0A2V8I9N4-F1-model_v4 DUF5666 domain-containing protein 0.9213 39 124
AF-A0A383BXH4-F1-model_v4 OB-fold nucleic acid binding domain-containing protein 0.9135 18 120
AF-A0A7T0NZ13-F1-model_v4 Uncharacterized protein 0.91 17 132

Map