F466270

General Info

Members Datasets Scaffolds Average Seq Length
583 267 1166 138

Family's Representative Sequence

Representative Sequence 3300014745|Ga0157377_10373855|Ga0157377_103738552
Length 168
Sequence MQISIGQKATRSITLTAEHVRTFAALSGDYNPLHFDESFVSKTKFKRLVVQGGLTTVLLHALVAMDMPGPGTVFLSQNWKFTAPVFIDDTITAEAEVISKHETKPVTQLKIKVARQNGETVLEGEAWCYTFTADNYIFSIRIRGKRSHILHDLFFKIPQFSIGHGFAW

Samples

Sample ID Description Type Environment
1 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
2 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
3 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
5 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
6 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
8 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
9 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
10 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
11 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
12 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
13 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
14 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
15 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
16 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
17 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
18 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
19 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
20 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
21 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
22 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
23 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
24 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
25 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
26 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
27 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
28 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
29 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
30 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
31 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
32 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
33 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
34 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
35 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
36 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
37 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
38 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
39 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
40 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
41 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
42 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
43 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
44 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
45 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
46 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
47 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
48 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
49 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
50 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
51 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
52 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
53 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
54 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
55 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
56 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
57 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
58 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
59 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
60 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
61 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
62 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
63 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
64 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
65 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
66 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
67 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
68 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
69 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
70 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
71 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
72 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
73 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
74 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
75 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
76 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
77 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
78 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
79 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
80 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
81 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
82 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
83 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
84 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
85 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
86 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
87 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
88 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
89 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
90 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
91 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
92 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
93 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
94 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
95 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
96 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
97 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
98 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
99 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
100 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
101 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
102 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
103 3300012512 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.old.270510 Metagenome Rhizosphere
104 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
105 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
106 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
107 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
108 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
109 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
110 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
111 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
112 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
113 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
114 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
115 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
116 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
117 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
172 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
176 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
177 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
178 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
179 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
180 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
181 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
182 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
183 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
184 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
185 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
186 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
187 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
188 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
189 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
190 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
191 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
192 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
193 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
194 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
195 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
196 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
197 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
198 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
199 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
200 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
201 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
202 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
203 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
204 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
205 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
206 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
207 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
208 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
209 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
210 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
211 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
212 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
213 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
214 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
215 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
216 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
217 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
218 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
219 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
220 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
221 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
222 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
223 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
224 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
225 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
226 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
227 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
228 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
229 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
230 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
231 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
232 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
233 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
234 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
235 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
236 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
237 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
238 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
239 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
240 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
241 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
242 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
243 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
244 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
245 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
246 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
247 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
248 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
249 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
250 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
251 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
252 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
253 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
254 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
255 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
256 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
257 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
258 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
259 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
260 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
261 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
262 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
263 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
264 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
265 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
266 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
267 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 2.4
Rhizosphere 97.6
Stem 0
Stem Tuber 0
Unclassified 35.68

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0157377_10373855 3300014745 Bacteria 963
2 JGI24750J21931_1008639 3300002070 Unclassified 1299
3 Ga0065714_10070213 3300005288 Bacteria 3931
4 Ga0065704_10093650 3300005289 Unclassified 2584
5 Ga0065704_10124220 3300005289 Bacteria 1721
6 Ga0065704_10228986 3300005289 Unclassified 1049
7 Ga0065704_10325791 3300005289 Bacteria 845
8 Ga0065712_10000249 3300005290 Bacteria 50462
9 Ga0065712_10001435 3300005290 Bacteria 6680
10 Ga0065712_10236051 3300005290 Bacteria 984
11 Ga0065715_10000224 3300005293 Bacteria 33957
12 Ga0065715_10036063 3300005293 Bacteria 1293
13 Ga0065715_10138251 3300005293 Unclassified 1894
14 Ga0065715_10573191 3300005293 Bacteria 725
15 Ga0065715_11060808 3300005293 Unclassified 529
16 Ga0065707_10358690 3300005295 Unclassified 907
17 Ga0065707_10501834 3300005295 Bacteria 756
18 Ga0070658_10357428 3300005327 Bacteria 1251
19 Ga0070676_10010188 3300005328 Bacteria 5097
20 Ga0070676_10081859 3300005328 Unclassified 1960
21 Ga0070676_10471279 3300005328 Bacteria 887
22 Ga0070676_10709592 3300005328 Bacteria 735
23 Ga0070683_100005831 3300005329 Bacteria 10302
24 Ga0070683_100030095 3300005329 Unclassified 4923
25 Ga0070683_100088519 3300005329 Bacteria 2905
26 Ga0070683_100106232 3300005329 Bacteria 2647
27 Ga0070683_100140796 3300005329 Bacteria 2285
28 Ga0070683_100214994 3300005329 Bacteria 1827
29 Ga0070683_102005506 3300005329 Bacteria 556
30 Ga0070690_100008521 3300005330 Bacteria 5910
31 Ga0070690_100101459 3300005330 Bacteria 1909
32 Ga0070670_100004578 3300005331 Bacteria 11603
33 Ga0070670_100019707 3300005331 Bacteria 5791
34 Ga0070670_100072944 3300005331 Unclassified 2948
35 Ga0070670_100092550 3300005331 Bacteria 2600
36 Ga0070670_100546573 3300005331 Unclassified 1033
37 Ga0070670_100801100 3300005331 Bacteria 851
38 Ga0070677_10046852 3300005333 Bacteria 1731
39 Ga0068869_100031593 3300005334 Unclassified 3724
40 Ga0068869_100057929 3300005334 Bacteria 2830
41 Ga0068869_100089321 3300005334 Unclassified 2314
42 Ga0070666_10473790 3300005335 Unclassified 906
43 Ga0070682_100803734 3300005337 Bacteria 764
44 Ga0068868_100023328 3300005338 Unclassified 4681
45 Ga0068868_100344855 3300005338 Bacteria 1274
46 Ga0068868_100386741 3300005338 Unclassified 1205
47 Ga0070689_100041576 3300005340 Unclassified 3529
48 Ga0070689_100041727 3300005340 Bacteria 3522
49 Ga0070689_100275357 3300005340 Bacteria 1394
50 Ga0070691_10004081 3300005341 Bacteria 6621
51 Ga0070687_100022735 3300005343 Unclassified 2968
52 Ga0070687_100324087 3300005343 Bacteria 985
53 Ga0070661_100006304 3300005344 Bacteria 8182
54 Ga0070661_100116870 3300005344 Bacteria 1995
55 Ga0070661_100344962 3300005344 Bacteria 1167
56 Ga0070661_100606971 3300005344 Bacteria 885
57 Ga0070692_10445612 3300005345 Unclassified 827
58 Ga0070668_100006874 3300005347 Bacteria 8433
59 Ga0070668_100223103 3300005347 Bacteria 1555
60 Ga0070668_100760839 3300005347 Unclassified 858
61 Ga0070669_100075086 3300005353 Unclassified 2506
62 Ga0070669_101418304 3300005353 Unclassified 603
63 Ga0070675_100002696 3300005354 Bacteria 13348
64 Ga0070675_100015164 3300005354 Bacteria 6086
65 Ga0070675_100159725 3300005354 Bacteria 1937
66 Ga0070675_100318497 3300005354 Bacteria 1373
67 Ga0070671_100037794 3300005355 Bacteria 4005
68 Ga0070671_100074386 3300005355 Bacteria 2839
69 Ga0070671_100478941 3300005355 Unclassified 1069
70 Ga0070671_100768147 3300005355 Unclassified 838
71 Ga0070671_101355877 3300005355 Unclassified 628
72 Ga0070674_100205372 3300005356 Unclassified 1524
73 Ga0070673_100020256 3300005364 Bacteria 4794
74 Ga0070673_100112259 3300005364 Unclassified 2262
75 Ga0070673_100359954 3300005364 Bacteria 1293
76 Ga0070688_100020006 3300005365 Unclassified 3885
77 Ga0070688_100410217 3300005365 Bacteria 1005
78 Ga0070659_100045024 3300005366 Unclassified 3456
79 Ga0070659_100912118 3300005366 Unclassified 768
80 Ga0070667_100021189 3300005367 Bacteria 5400
81 Ga0070667_100604433 3300005367 Unclassified 1011
82 Ga0070667_101414281 3300005367 Unclassified 653
83 Ga0070709_10005264 3300005434 Bacteria 7002
84 Ga0070713_100021727 3300005436 Bacteria 4944
85 Ga0070710_10782069 3300005437 Unclassified 680
86 Ga0070701_10035689 3300005438 Unclassified 2500
87 Ga0070701_10063194 3300005438 Unclassified 1958
88 Ga0070711_100000553 3300005439 Bacteria 19549
89 Ga0070711_100005421 3300005439 Bacteria 7624
90 Ga0070711_100100296 3300005439 Bacteria 2105
91 Ga0070711_100339360 3300005439 Bacteria 1205
92 Ga0070700_100034292 3300005441 Bacteria 3065
93 Ga0070694_100076830 3300005444 Unclassified 2312
94 Ga0070694_100156944 3300005444 Bacteria 1666
95 Ga0070694_100592785 3300005444 Unclassified 892
96 Ga0070694_100763761 3300005444 Bacteria 790
97 Ga0070708_100006387 3300005445 Bacteria 9387
98 Ga0070708_100157182 3300005445 Bacteria 2117
99 Ga0070708_100178546 3300005445 Unclassified 1984
100 Ga0070708_100771885 3300005445 Bacteria 904
101 Ga0070678_100059095 3300005456 Bacteria 2817
102 Ga0070678_101131012 3300005456 Unclassified 724
103 Ga0070678_101219891 3300005456 Unclassified 698
104 Ga0070678_101255685 3300005456 Bacteria 688
105 Ga0070678_101924161 3300005456 Bacteria 559
106 Ga0070662_100041686 3300005457 Bacteria 3276
107 Ga0070681_10500243 3300005458 Bacteria 1128
108 Ga0068867_100052191 3300005459 Bacteria 3017
109 Ga0068867_100589485 3300005459 Bacteria 968
110 Ga0068867_101249722 3300005459 Bacteria 684
111 Ga0070685_10002545 3300005466 Bacteria 9337
112 Ga0070685_10006105 3300005466 Bacteria 6139
113 Ga0070685_10009608 3300005466 Bacteria 5004
114 Ga0070685_10064139 3300005466 Bacteria 2159
115 Ga0070685_10104581 3300005466 Unclassified 1734
116 Ga0070706_100429223 3300005467 Unclassified 1230
117 Ga0070707_100014254 3300005468 Bacteria 7451
118 Ga0070707_100158620 3300005468 Bacteria 2204
119 Ga0070707_100666354 3300005468 Unclassified 1003
120 Ga0070707_100824358 3300005468 Bacteria 892
121 Ga0070707_101120768 3300005468 Unclassified 753
122 Ga0070698_100005201 3300005471 Bacteria 14234
123 Ga0070698_100031381 3300005471 Bacteria 5509
124 Ga0070698_100321836 3300005471 Unclassified 1477
125 Ga0070698_100380730 3300005471 Unclassified 1344
126 Ga0070698_100502218 3300005471 Bacteria 1151
127 Ga0070699_100002807 3300005518 Bacteria 15541
128 Ga0070699_100019273 3300005518 Bacteria 5872
129 Ga0070699_100022802 3300005518 Bacteria 5395
130 Ga0070679_100221638 3300005530 Bacteria 1852
131 Ga0070684_100016274 3300005535 Bacteria 6076
132 Ga0070684_100261693 3300005535 Bacteria 1583
133 Ga0070684_100294203 3300005535 Bacteria 1489
134 Ga0070684_100460625 3300005535 Bacteria 1176
135 Ga0070697_100044788 3300005536 Bacteria 3584
136 Ga0070697_100153427 3300005536 Bacteria 1943
137 Ga0070697_100186397 3300005536 Bacteria 1760
138 Ga0068853_100151506 3300005539 Bacteria 2088
139 Ga0068853_100181451 3300005539 Unclassified 1909
140 Ga0068853_100205411 3300005539 Bacteria 1794
141 Ga0068853_100992782 3300005539 Unclassified 808
142 Ga0068853_101029582 3300005539 Unclassified 793
143 Ga0070672_100007109 3300005543 Bacteria 7572
144 Ga0070672_100009008 3300005543 Bacteria 6861
145 Ga0070672_100180383 3300005543 Unclassified 1759
146 Ga0070672_100582431 3300005543 Unclassified 973
147 Ga0070686_100096310 3300005544 Bacteria 1990
148 Ga0070686_100277885 3300005544 Bacteria 1234
149 Ga0070695_100004369 3300005545 Bacteria 8290
150 Ga0070695_100009292 3300005545 Bacteria 5845
151 Ga0070696_100841788 3300005546 Unclassified 757
152 Ga0070665_100022608 3300005548 Bacteria 6331
153 Ga0070704_100020263 3300005549 Bacteria 4286
154 Ga0070704_100096782 3300005549 Bacteria 2213
155 Ga0070704_100845635 3300005549 Bacteria 820
156 Ga0068855_100302296 3300005563 Unclassified 1772
157 Ga0068855_100413100 3300005563 Bacteria 1477
158 Ga0070664_100024448 3300005564 Bacteria 4996
159 Ga0070664_100070815 3300005564 Unclassified 2987
160 Ga0070664_100072274 3300005564 Bacteria 2958
161 Ga0070664_100224241 3300005564 Unclassified 1682
162 Ga0068857_100031673 3300005577 Bacteria 4674
163 Ga0068857_100104553 3300005577 Bacteria 2542
164 Ga0068857_100563389 3300005577 Unclassified 1074
165 Ga0068854_100338664 3300005578 Unclassified 1228
166 Ga0068856_100019445 3300005614 Bacteria 6591
167 Ga0070702_100328134 3300005615 Bacteria 1069
168 Ga0068852_100012731 3300005616 Bacteria 6403
169 Ga0068852_100039811 3300005616 Bacteria 3960
170 Ga0068852_100044520 3300005616 Bacteria 3770
171 Ga0068852_100313179 3300005616 Unclassified 1522
172 Ga0068859_100050039 3300005617 Bacteria 4197
173 Ga0068859_100194682 3300005617 Unclassified 2111
174 Ga0068859_100262991 3300005617 Bacteria 1817
175 Ga0068859_100448880 3300005617 Bacteria 1386
176 Ga0068859_100497326 3300005617 Unclassified 1314
177 Ga0068864_100000641 3300005618 Bacteria 29412
178 Ga0068864_100351015 3300005618 Bacteria 1392
179 Ga0068864_100351038 3300005618 Unclassified 1392
180 Ga0068864_100430860 3300005618 Unclassified 1258
181 Ga0068861_100007187 3300005719 Bacteria 7626
182 Ga0068861_100121165 3300005719 Bacteria 2110
183 Ga0068861_101644672 3300005719 Unclassified 634
184 Ga0068851_10126537 3300005834 Unclassified 1378
185 Ga0068851_10929173 3300005834 Unclassified 546
186 Ga0068870_10172324 3300005840 Bacteria 1292
187 Ga0068870_10476388 3300005840 Bacteria 828
188 Ga0068863_100098465 3300005841 Bacteria 2777
189 Ga0068863_100100858 3300005841 Bacteria 2744
190 Ga0068863_100305953 3300005841 Unclassified 1542
191 Ga0068863_100405814 3300005841 Bacteria 1333
192 Ga0068863_100648431 3300005841 Bacteria 1047
193 Ga0068863_100807318 3300005841 Unclassified 936
194 Ga0068863_101093305 3300005841 Unclassified 802
195 Ga0068858_100116738 3300005842 Bacteria 2494
196 Ga0068858_100256462 3300005842 Unclassified 1662
197 Ga0068858_100587583 3300005842 Unclassified 1080
198 Ga0068858_100985798 3300005842 Unclassified 825
199 Ga0068860_100433261 3300005843 Bacteria 1305
200 Ga0068860_100995258 3300005843 Unclassified 856
201 Ga0068862_100038283 3300005844 Bacteria 4067
202 Ga0068862_100056852 3300005844 Bacteria 3353
203 Ga0068862_100582663 3300005844 Unclassified 1072
204 Ga0068862_100609483 3300005844 Bacteria 1049
205 Ga0068862_101536379 3300005844 Bacteria 672
206 Ga0070717_10430108 3300006028 Unclassified 1188
207 Ga0075432_10238168 3300006058 Bacteria 734
208 Ga0070715_10116158 3300006163 Unclassified 1269
209 Ga0070716_100405125 3300006173 Unclassified 982
210 Ga0070712_100336707 3300006175 Bacteria 1231
211 Ga0070712_100850815 3300006175 Bacteria 784
212 Ga0070712_101175171 3300006175 Bacteria 667
213 Ga0097621_100083101 3300006237 Bacteria 2668
214 Ga0097621_100167242 3300006237 Unclassified 1894
215 Ga0097621_100293987 3300006237 Bacteria 1433
216 Ga0097621_100390321 3300006237 Unclassified 1245
217 Ga0097621_100662646 3300006237 Bacteria 958
218 Ga0068871_100129934 3300006358 Bacteria 2135
219 Ga0068871_100316667 3300006358 Unclassified 1373
220 Ga0068871_100645774 3300006358 Bacteria 966
221 Ga0068871_101085676 3300006358 Bacteria 748
222 Ga0075428_100018610 3300006844 Bacteria 7676
223 Ga0075428_101631331 3300006844 Bacteria 674
224 Ga0075431_100081100 3300006847 Unclassified 3350
225 Ga0075431_100273279 3300006847 Bacteria 1712
226 Ga0075431_100895561 3300006847 Unclassified 857
227 Ga0075433_10001882 3300006852 Bacteria 15777
228 Ga0075433_10025266 3300006852 Bacteria 5019
229 Ga0075433_10096025 3300006852 Unclassified 2623
230 Ga0075433_11132032 3300006852 Bacteria 680
231 Ga0075434_100149265 3300006871 Bacteria 2357
232 Ga0075434_100171984 3300006871 Unclassified 2186
233 Ga0075434_100469135 3300006871 Bacteria 1280
234 Ga0075434_102130309 3300006871 Bacteria 565
235 Ga0075429_100003589 3300006880 Bacteria 13221
236 Ga0068865_100029573 3300006881 Unclassified 3637
237 Ga0068865_100124535 3300006881 Unclassified 1922
238 Ga0068865_100296291 3300006881 Unclassified 1293
239 Ga0068865_100543238 3300006881 Bacteria 975
240 Ga0068865_101067804 3300006881 Bacteria 710
241 Ga0075436_100204303 3300006914 Unclassified 1400
242 Ga0075436_100289707 3300006914 Bacteria 1172
243 Ga0097620_100050041 3300006931 Bacteria 4197
244 Ga0097620_100194676 3300006931 Unclassified 2111
245 Ga0097620_100262987 3300006931 Bacteria 1817
246 Ga0097620_100448915 3300006931 Bacteria 1386
247 Ga0097620_100497327 3300006931 Unclassified 1314
248 Ga0075435_100020052 3300007076 Bacteria 5113
249 Ga0075435_100092550 3300007076 Unclassified 2497
250 Ga0075435_100216388 3300007076 Bacteria 1626
251 Ga0105240_10093803 3300009093 Bacteria 3663
252 Ga0105240_10183991 3300009093 Unclassified 2463
253 Ga0111539_10047674 3300009094 Bacteria 5120
254 Ga0111539_10322809 3300009094 Unclassified 1797
255 Ga0111539_10473947 3300009094 Bacteria 1458
256 Ga0111539_11665046 3300009094 Unclassified 740
257 Ga0105245_10425720 3300009098 Bacteria 1331
258 Ga0105245_10816248 3300009098 Bacteria 971
259 Ga0114129_10087793 3300009147 Bacteria 4312
260 Ga0114129_10520893 3300009147 Unclassified 1550
261 Ga0114129_10604583 3300009147 Bacteria 1420
262 Ga0114129_11170827 3300009147 Bacteria 959
263 Ga0114129_11174352 3300009147 Unclassified 957
264 Ga0105243_10248098 3300009148 Unclassified 1588
265 Ga0105243_11577555 3300009148 Unclassified 682
266 Ga0105241_10291386 3300009174 Unclassified 1397
267 Ga0105241_10593150 3300009174 Bacteria 1000
268 Ga0105241_11950072 3300009174 Unclassified 577
269 Ga0105242_10005209 3300009176 Bacteria 10038
270 Ga0105242_10241976 3300009176 Bacteria 1622
271 Ga0105242_10283014 3300009176 Bacteria 1507
272 Ga0105242_10290406 3300009176 Bacteria 1489
273 Ga0105242_10295709 3300009176 Unclassified 1476
274 Ga0105242_10968432 3300009176 Unclassified 856
275 Ga0105242_11494094 3300009176 Unclassified 706
276 Ga0105248_10018439 3300009177 Bacteria 7712
277 Ga0105248_10024686 3300009177 Bacteria 6684
278 Ga0105248_10416422 3300009177 Bacteria 1513
279 Ga0105238_10029936 3300009551 Bacteria 5543
280 Ga0105238_10141753 3300009551 Bacteria 2380
281 Ga0105249_10000628 3300009553 Bacteria 32164
282 Ga0105249_10001477 3300009553 Bacteria 20591
283 Ga0105249_10002990 3300009553 Bacteria 14581
284 Ga0105249_10009699 3300009553 Bacteria 8439
285 Ga0105249_10033670 3300009553 Unclassified 4640
286 Ga0105249_10064795 3300009553 Bacteria 3360
287 Ga0105249_10444717 3300009553 Bacteria 1334
288 Ga0105249_10451408 3300009553 Bacteria 1324
289 Ga0105249_10743469 3300009553 Unclassified 1043
290 Ga0105239_10198889 3300010375 Unclassified 2245
291 Ga0105246_10076476 3300011119 Bacteria 2372
292 Ga0105246_10203036 3300011119 Unclassified 1542
293 Ga0157327_1030453 3300012512 Bacteria 670
294 Ga0157371_10046687 3300013102 Bacteria 3080
295 Ga0157370_10617196 3300013104 Unclassified 992
296 Ga0157369_10000858 3300013105 Bacteria 38766
297 Ga0157374_10163924 3300013296 Unclassified 2166
298 Ga0157374_11346675 3300013296 Unclassified 736
299 Ga0157374_11588663 3300013296 Bacteria 678
300 Ga0157374_11617003 3300013296 Unclassified 672
301 Ga0157378_10574434 3300013297 Bacteria 1136
302 Ga0157378_10936283 3300013297 Bacteria 898
303 Ga0157378_11457686 3300013297 Unclassified 728
304 Ga0163162_10031737 3300013306 Bacteria 5241
305 Ga0163162_10045235 3300013306 Bacteria 4411
306 Ga0163162_10194071 3300013306 Unclassified 2159
307 Ga0163162_10533360 3300013306 Bacteria 1303
308 Ga0163162_10745945 3300013306 Bacteria 1099
309 Ga0163162_10766744 3300013306 Bacteria 1083
310 Ga0157372_10002923 3300013307 Bacteria 18449
311 Ga0157372_10980297 3300013307 Bacteria 979
312 Ga0157375_10097196 3300013308 Unclassified 3019
313 Ga0157375_10107165 3300013308 Unclassified 2887
314 Ga0157375_10296820 3300013308 Bacteria 1779
315 Ga0157375_10371380 3300013308 Bacteria 1597
316 Ga0157375_10435800 3300013308 Bacteria 1476
317 Ga0157375_10463172 3300013308 Unclassified 1433
318 Ga0157375_11602747 3300013308 Bacteria 770
319 Ga0157375_11624113 3300013308 Unclassified 764
320 Ga0163163_10008994 3300014325 Bacteria 8899
321 Ga0163163_10143710 3300014325 Bacteria 2429
322 Ga0163163_11043407 3300014325 Unclassified 881
323 Ga0163163_12459073 3300014325 Bacteria 579
324 Ga0157380_10065917 3300014326 Unclassified 2912
325 Ga0157380_10124542 3300014326 Unclassified 2188
326 Ga0157380_10303403 3300014326 Bacteria 1472
327 Ga0157377_10029061 3300014745 Bacteria 2981
328 Ga0157377_10219197 3300014745 Bacteria 1217
329 Ga0157377_10398541 3300014745 Bacteria 937
330 Ga0157377_10529021 3300014745 Unclassified 829
331 Ga0157379_10013353 3300014968 Bacteria 7192
332 Ga0157376_10293617 3300014969 Unclassified 1536
333 Ga0157376_10434463 3300014969 Bacteria 1277
334 Ga0157376_10817832 3300014969 Bacteria 945
335 Ga0157376_11828210 3300014969 Unclassified 644
336 Ga0163161_10016870 3300017792 Bacteria 5105
337 Ga0163161_10213393 3300017792 Unclassified 1492
338 Ga0163161_10643362 3300017792 Unclassified 878
339 Ga0207697_10002357 3300025315 Bacteria 9839
340 Ga0207697_10007557 3300025315 Bacteria 4834
341 Ga0207656_10010671 3300025321 Unclassified 3448
342 Ga0207656_10403206 3300025321 Unclassified 687
343 Ga0207653_10008383 3300025885 Bacteria 3219
344 Ga0207642_10012552 3300025899 Bacteria 3062
345 Ga0207688_10435950 3300025901 Bacteria 816
346 Ga0207647_10077598 3300025904 Unclassified 1996
347 Ga0207699_10007814 3300025906 Bacteria 5242
348 Ga0207645_10001751 3300025907 Bacteria 17605
349 Ga0207645_10110905 3300025907 Unclassified 1776
350 Ga0207645_10149053 3300025907 Bacteria 1526
351 Ga0207705_10586809 3300025909 Bacteria 866
352 Ga0207684_10049020 3300025910 Bacteria 3583
353 Ga0207684_10375225 3300025910 Unclassified 1223
354 Ga0207654_10102000 3300025911 Unclassified 1769
355 Ga0207654_11190243 3300025911 Unclassified 555
356 Ga0207707_10571026 3300025912 Bacteria 959
357 Ga0207695_10321727 3300025913 Unclassified 1436
358 Ga0207663_10000099 3300025916 Bacteria 41165
359 Ga0207663_10003317 3300025916 Bacteria 7855
360 Ga0207663_10118445 3300025916 Bacteria 1809
361 Ga0207663_10244314 3300025916 Unclassified 1318
362 Ga0207663_10457310 3300025916 Bacteria 985
363 Ga0207660_10583037 3300025917 Bacteria 910
364 Ga0207662_10046589 3300025918 Unclassified 2565
365 Ga0207657_10037512 3300025919 Bacteria 4326
366 Ga0207649_10029910 3300025920 Unclassified 3220
367 Ga0207649_10530663 3300025920 Bacteria 898
368 Ga0207652_10262376 3300025921 Bacteria 1558
369 Ga0207646_10037919 3300025922 Bacteria 4343
370 Ga0207646_10265935 3300025922 Bacteria 1550
371 Ga0207646_11723762 3300025922 Bacteria 538
372 Ga0207681_10022101 3300025923 Unclassified 4052
373 Ga0207681_10294777 3300025923 Bacteria 1281
374 Ga0207694_10091848 3300025924 Bacteria 2396
375 Ga0207650_10027467 3300025925 Unclassified 4075
376 Ga0207650_10047551 3300025925 Bacteria 3162
377 Ga0207650_10404873 3300025925 Unclassified 1130
378 Ga0207659_10006536 3300025926 Bacteria 7151
379 Ga0207659_10010153 3300025926 Bacteria 5905
380 Ga0207659_10188377 3300025926 Bacteria 1640
381 Ga0207687_10295747 3300025927 Bacteria 1303
382 Ga0207687_11003697 3300025927 Unclassified 716
383 Ga0207644_10054218 3300025931 Bacteria 2887
384 Ga0207644_10319296 3300025931 Bacteria 1256
385 Ga0207644_10506449 3300025931 Unclassified 996
386 Ga0207644_11026590 3300025931 Archaea 692
387 Ga0207644_11186722 3300025931 Bacteria 642
388 Ga0207690_10061140 3300025932 Unclassified 2559
389 Ga0207706_10004024 3300025933 Bacteria 13910
390 Ga0207686_10011670 3300025934 Bacteria 4819
391 Ga0207686_10396487 3300025934 Bacteria 1050
392 Ga0207686_10595870 3300025934 Bacteria 869
393 Ga0207686_10763300 3300025934 Unclassified 773
394 Ga0207686_11325697 3300025934 Unclassified 591
395 Ga0207709_10806690 3300025935 Bacteria 758
396 Ga0207670_10081693 3300025936 Unclassified 2263
397 Ga0207669_10173453 3300025937 Bacteria 1538
398 Ga0207669_10695346 3300025937 Bacteria 835
399 Ga0207704_10054646 3300025938 Unclassified 2436
400 Ga0207665_10101076 3300025939 Bacteria 2013
401 Ga0207691_10002077 3300025940 Bacteria 19544
402 Ga0207691_10023884 3300025940 Bacteria 5753
403 Ga0207691_10175806 3300025940 Unclassified 1872
404 Ga0207711_10040694 3300025941 Bacteria 3955
405 Ga0207711_10111002 3300025941 Bacteria 2439
406 Ga0207711_10162883 3300025941 Unclassified 2020
407 Ga0207711_10851617 3300025941 Unclassified 848
408 Ga0207689_10010199 3300025942 Bacteria 8097
409 Ga0207689_10031538 3300025942 Bacteria 4411
410 Ga0207689_10358877 3300025942 Unclassified 1212
411 Ga0207661_10000654 3300025944 Bacteria 22372
412 Ga0207661_10048341 3300025944 Unclassified 3380
413 Ga0207661_10074416 3300025944 Bacteria 2784
414 Ga0207661_10182540 3300025944 Bacteria 1834
415 Ga0207661_10231399 3300025944 Bacteria 1637
416 Ga0207679_10013194 3300025945 Bacteria 5413
417 Ga0207679_10167795 3300025945 Bacteria 1804
418 Ga0207679_10190882 3300025945 Bacteria 1703
419 Ga0207679_10780326 3300025945 Bacteria 870
420 Ga0207651_10066428 3300025960 Unclassified 2534
421 Ga0207651_10078954 3300025960 Bacteria 2363
422 Ga0207712_10007731 3300025961 Bacteria 6797
423 Ga0207712_10019181 3300025961 Unclassified 4463
424 Ga0207712_10040845 3300025961 Bacteria 3186
425 Ga0207668_10054736 3300025972 Bacteria 2771
426 Ga0207668_10118373 3300025972 Bacteria 2001
427 Ga0207668_10242294 3300025972 Unclassified 1459
428 Ga0207658_10459620 3300025986 Unclassified 1128
429 Ga0207658_10575912 3300025986 Unclassified 1009
430 Ga0207677_10013631 3300026023 Bacteria 4717
431 Ga0207677_10309662 3300026023 Bacteria 1308
432 Ga0207677_11159925 3300026023 Unclassified 706
433 Ga0207703_10614347 3300026035 Unclassified 1029
434 Ga0207703_10623798 3300026035 Bacteria 1021
435 Ga0207639_10060227 3300026041 Bacteria 2928
436 Ga0207639_10307364 3300026041 Unclassified 1403
437 Ga0207708_10007175 3300026075 Bacteria 8237
438 Ga0207708_10180051 3300026075 Bacteria 1678
439 Ga0207641_10289891 3300026088 Unclassified 1542
440 Ga0207641_10548170 3300026088 Bacteria 1127
441 Ga0207641_10618707 3300026088 Bacteria 1062
442 Ga0207648_10685323 3300026089 Unclassified 949
443 Ga0207648_10804813 3300026089 Unclassified 875
444 Ga0207676_10003490 3300026095 Bacteria 11130
445 Ga0207676_10413720 3300026095 Unclassified 1263
446 Ga0207674_10012305 3300026116 Bacteria 9567
447 Ga0207674_10160084 3300026116 Bacteria 2206
448 Ga0207674_10376796 3300026116 Unclassified 1372
449 Ga0207675_100003327 3300026118 Bacteria 15736
450 Ga0207675_100063079 3300026118 Bacteria 3462
451 Ga0207675_100671523 3300026118 Unclassified 1043
452 Ga0207683_10217497 3300026121 Bacteria 1740
453 Ga0207683_10576564 3300026121 Unclassified 1041
454 Ga0207698_10016338 3300026142 Bacteria 5000
455 Ga0207698_10117962 3300026142 Unclassified 2240
456 Ga0207428_10107872 3300027907 Unclassified 2145
457 Ga0268266_10208487 3300028379 Unclassified 1792
458 Ga0268265_10047370 3300028380 Unclassified 3221
459 Ga0268265_10057203 3300028380 Bacteria 2971
460 Ga0268265_10082781 3300028380 Unclassified 2538
461 Ga0268265_10211834 3300028380 Unclassified 1689
462 Ga0268264_10286874 3300028381 Unclassified 1544
463 Ga0268264_10639973 3300028381 Unclassified 1051
464 Ga0268264_11657178 3300028381 Unclassified 650
465 Ga0307408_100058870 3300031548 Unclassified 2794
466 Ga0307406_10003532 3300031901 Bacteria 8519
467 Ga0373934_0021419 3300035086 Bacteria 2488
468 Ga0373949_0008336 3300035090 Unclassified 2269
469 Ga0373923_0141276 3300035111 Bacteria 1088
470 Ga0373953_0057962 3300035117 Bacteria 1578
471 Ga0373956_0019449 3300035119 Bacteria 2880
472 Ga0373957_0232965 3300035120 Bacteria 772
473 Ga0373955_0177608 3300035172 Bacteria 1262
474 Ga0373927_0445504 3300035695 Unclassified 855
475 Ga0373933_0028146 3300035724 Bacteria 3240
476 Ga0373947_0907092 3300035725 Unclassified 602
477 Ga0373937_0013315 3300036401 Bacteria 7246
478 Ga0373937_0641264 3300036401 Bacteria 1007
479 Ga0373925_0149119 3300037068 Bacteria 1835
480 Ga0395900_1447381 3300037418 Bacteria 600
481 Ga0439441_003190 3300042001 Unclassified 2389
482 Ga0439448_0092843 3300042005 Unclassified 1021
483 Ga0450890_008708 3300042127 Bacteria 1299
484 Ga0439444_0022450 3300042437 Bacteria 1125
485 Ga0439464_0043855 3300042439 Bacteria 1280
486 Ga0451577_0397434 3300042876 Bacteria 1251
487 Ga0439440_0033681 3300042993 Bacteria 1222
488 Ga0466963_0220612 3300044694 Bacteria 1328
489 Ga0451576_0478837 3300045051 Unclassified 1307
490 Ga0495592_0307160 3300046454 Bacteria 1029
491 Ga0495629_0130696 3300046459 Bacteria 1749
492 Ga0495651_0014374 3300046462 Bacteria 6120
493 Ga0495580_0093847 3300046472 Bacteria 2088
494 Ga0495580_0380261 3300046472 Bacteria 954
495 Ga0495582_0455838 3300046473 Unclassified 738
496 Ga0495582_0577094 3300046473 Unclassified 651
497 Ga0495605_0348055 3300046474 Unclassified 622
498 Ga0495639_0010225 3300046475 Bacteria 4037
499 Ga0495664_0049868 3300046477 Unclassified 2485
500 Ga0495594_0012077 3300046499 Bacteria 4497
501 Ga0495594_0049710 3300046499 Bacteria 2305
502 Ga0495594_0059470 3300046499 Bacteria 2113
503 Ga0495594_0357720 3300046499 Bacteria 831
504 Ga0495608_0039704 3300046511 Bacteria 3154
505 Ga0495628_0086263 3300046516 Bacteria 2434
506 Ga0495666_0064567 3300046526 Bacteria 1747
507 Ga0495652_0002095 3300046529 Bacteria 21058
508 Ga0495665_0008586 3300046531 Bacteria 5544
509 Ga0495586_0122997 3300046535 Unclassified 1450
510 Ga0495586_0164290 3300046535 Unclassified 1253
511 Ga0495587_0002671 3300046536 Bacteria 11907
512 Ga0495587_0028208 3300046536 Bacteria 3415
513 Ga0495645_0001059 3300046543 Bacteria 18743
514 Ga0495667_0001095 3300046559 Bacteria 17594
515 Ga0495634_0161791 3300046642 Bacteria 1411
516 Ga0495635_0072402 3300046663 Bacteria 2361
517 Ga0495588_0000731 3300046674 Bacteria 15040
518 Ga0495599_0003972 3300046678 Bacteria 8709
519 Ga0495623_0018223 3300046679 Bacteria 4533
520 Ga0495658_0263173 3300046683 Unclassified 1086
521 Ga0495600_0532491 3300046809 Bacteria 719
522 Ga0495581_0544222 3300047315 Unclassified 674
523 Ga0495604_0411159 3300047317 Bacteria 889
524 Ga0495680_0811282 3300047322 Unclassified 610
525 Ga0495675_0115504 3300047444 Unclassified 1674
526 Ga0495675_0229191 3300047444 Unclassified 1122
527 Ga0495684_0007077 3300047471 Bacteria 8709
528 Ga0495684_0381751 3300047471 Bacteria 993
529 Ga0495602_0015265 3300048088 Bacteria 7757
530 Ga0495602_0441140 3300048088 Unclassified 920
531 Ga0496100_0845880 3300048903 Bacteria 718
532 Ga0496102_0111291 3300048905 Bacteria 2553
533 Ga0496104_0167306 3300048907 Bacteria 2108
534 Ga0496105_0101278 3300048908 Unclassified 2379
535 Ga0496106_0112132 3300048909 Unclassified 2124
536 Ga0496106_0398513 3300048909 Unclassified 1106
537 Ga0496107_0436120 3300048910 Bacteria 974
538 Ga0496108_0017458 3300048911 Bacteria 5872
539 Ga0496108_0321868 3300048911 Bacteria 1348
540 Ga0496109_0000620 3300048912 Bacteria 29596
541 Ga0496109_1326749 3300048912 Bacteria 655
542 Ga0496110_0000742 3300048913 Bacteria 22522
543 Ga0496111_0577203 3300048914 Bacteria 824
544 Ga0496112_0010003 3300048915 Bacteria 8584
545 Ga0501031_0224493 3300049568 Unclassified 1223
546 Ga0501034_0154811 3300049571 Unclassified 2267
547 Ga0501037_0634775 3300049573 Bacteria 715
548 Ga0501041_0168614 3300049577 Bacteria 1370
549 Ga0501043_0031439 3300049579 Bacteria 4173
550 Ga0501047_0513881 3300049581 Unclassified 1024
551 Ga0501073_1264837 3300049589 Bacteria 506
552 Ga0501075_0255123 3300049591 Unclassified 1337
553 Ga0501075_0578270 3300049591 Bacteria 857
554 Ga0501076_1068959 3300049592 Unclassified 665
555 Ga0501077_0485621 3300049593 Unclassified 792
556 Ga0501081_0741372 3300049743 Unclassified 738
557 Ga0501083_0144421 3300049744 Bacteria 1558
558 Ga0501035_1010083 3300049822 Bacteria 654
559 Ga0501044_0066258 3300049823 Bacteria 3683
560 nmdc:mga05p37_427940_c1 3300050507 Unclassified 1538
561 nmdc:mga05p37_520053_c1 3300050507 Bacteria 1361
562 nmdc:mga05p37_77999_c1 3300050507 Bacteria 4078
563 nmdc:mga06r32_1125118_c1 3300050510 Unclassified 734
564 nmdc:mga06r32_1340701_c1 3300050510 Bacteria 658
565 nmdc:mga08y16_1069951_c1 3300050511 Bacteria 783
566 nmdc:mga08y16_30718_c1 3300050511 Bacteria 5650
567 nmdc:mga08y16_756775_c1 3300050511 Bacteria 967
568 nmdc:mga0n895_2455_c1 3300050512 Bacteria 14487
569 nmdc:mga0rr50_11304_c1 3300050513 Bacteria 5707
570 nmdc:mga0rr50_141134_c1 3300050513 Unclassified 1938
571 nmdc:mga0rr50_168151_c1 3300050513 Unclassified 1784
572 nmdc:mga0rr50_76407_c1 3300050513 Bacteria 2571
573 nmdc:mga08x19_295697_c1 3300050514 Bacteria 1124
574 nmdc:mga08x19_9127_c2 3300050514 Bacteria 2872
575 nmdc:mga0a205_17409_c1 3300050515 Bacteria 6736
576 nmdc:mga0a205_35332_c1 3300050515 Bacteria 4799
577 nmdc:mga0a205_72079_c1 3300050515 Bacteria 3336
578 Ga0495601_0394772 3300053077 Unclassified 897
579 Ga0495612_0042167 3300053078 Bacteria 1862
580 Ga0495595_0064408 3300053084 Bacteria 1723
581 Ga0495619_0030338 3300053085 Bacteria 3500
582 Ga0501084_0328855 3300054114 Unclassified 1291
583 Ga0501082_1091574 3300060353 Bacteria 698
584 Ga0157377_10373855
585 JGI24750J21931_1008639
586 Ga0065714_10070213
587 Ga0065704_10093650
588 Ga0065704_10124220
589 Ga0065704_10228986
590 Ga0065704_10325791
591 Ga0065712_10000249
592 Ga0065712_10001435
593 Ga0065712_10236051
594 Ga0065715_10000224
595 Ga0065715_10036063
596 Ga0065715_10138251
597 Ga0065715_10573191
598 Ga0065715_11060808
599 Ga0065707_10358690
600 Ga0065707_10501834
601 Ga0070658_10357428
602 Ga0070676_10010188
603 Ga0070676_10081859
604 Ga0070676_10471279
605 Ga0070676_10709592
606 Ga0070683_100005831
607 Ga0070683_100030095
608 Ga0070683_100088519
609 Ga0070683_100106232
610 Ga0070683_100140796
611 Ga0070683_100214994
612 Ga0070683_102005506
613 Ga0070690_100008521
614 Ga0070690_100101459
615 Ga0070670_100004578
616 Ga0070670_100019707
617 Ga0070670_100072944
618 Ga0070670_100092550
619 Ga0070670_100546573
620 Ga0070670_100801100
621 Ga0070677_10046852
622 Ga0068869_100031593
623 Ga0068869_100057929
624 Ga0068869_100089321
625 Ga0070666_10473790
626 Ga0070682_100803734
627 Ga0068868_100023328
628 Ga0068868_100344855
629 Ga0068868_100386741
630 Ga0070689_100041576
631 Ga0070689_100041727
632 Ga0070689_100275357
633 Ga0070691_10004081
634 Ga0070687_100022735
635 Ga0070687_100324087
636 Ga0070661_100006304
637 Ga0070661_100116870
638 Ga0070661_100344962
639 Ga0070661_100606971
640 Ga0070692_10445612
641 Ga0070668_100006874
642 Ga0070668_100223103
643 Ga0070668_100760839
644 Ga0070669_100075086
645 Ga0070669_101418304
646 Ga0070675_100002696
647 Ga0070675_100015164
648 Ga0070675_100159725
649 Ga0070675_100318497
650 Ga0070671_100037794
651 Ga0070671_100074386
652 Ga0070671_100478941
653 Ga0070671_100768147
654 Ga0070671_101355877
655 Ga0070674_100205372
656 Ga0070673_100020256
657 Ga0070673_100112259
658 Ga0070673_100359954
659 Ga0070688_100020006
660 Ga0070688_100410217
661 Ga0070659_100045024
662 Ga0070659_100912118
663 Ga0070667_100021189
664 Ga0070667_100604433
665 Ga0070667_101414281
666 Ga0070709_10005264
667 Ga0070713_100021727
668 Ga0070710_10782069
669 Ga0070701_10035689
670 Ga0070701_10063194
671 Ga0070711_100000553
672 Ga0070711_100005421
673 Ga0070711_100100296
674 Ga0070711_100339360
675 Ga0070700_100034292
676 Ga0070694_100076830
677 Ga0070694_100156944
678 Ga0070694_100592785
679 Ga0070694_100763761
680 Ga0070708_100006387
681 Ga0070708_100157182
682 Ga0070708_100178546
683 Ga0070708_100771885
684 Ga0070678_100059095
685 Ga0070678_101131012
686 Ga0070678_101219891
687 Ga0070678_101255685
688 Ga0070678_101924161
689 Ga0070662_100041686
690 Ga0070681_10500243
691 Ga0068867_100052191
692 Ga0068867_100589485
693 Ga0068867_101249722
694 Ga0070685_10002545
695 Ga0070685_10006105
696 Ga0070685_10009608
697 Ga0070685_10064139
698 Ga0070685_10104581
699 Ga0070706_100429223
700 Ga0070707_100014254
701 Ga0070707_100158620
702 Ga0070707_100666354
703 Ga0070707_100824358
704 Ga0070707_101120768
705 Ga0070698_100005201
706 Ga0070698_100031381
707 Ga0070698_100321836
708 Ga0070698_100380730
709 Ga0070698_100502218
710 Ga0070699_100002807
711 Ga0070699_100019273
712 Ga0070699_100022802
713 Ga0070679_100221638
714 Ga0070684_100016274
715 Ga0070684_100261693
716 Ga0070684_100294203
717 Ga0070684_100460625
718 Ga0070697_100044788
719 Ga0070697_100153427
720 Ga0070697_100186397
721 Ga0068853_100151506
722 Ga0068853_100181451
723 Ga0068853_100205411
724 Ga0068853_100992782
725 Ga0068853_101029582
726 Ga0070672_100007109
727 Ga0070672_100009008
728 Ga0070672_100180383
729 Ga0070672_100582431
730 Ga0070686_100096310
731 Ga0070686_100277885
732 Ga0070695_100004369
733 Ga0070695_100009292
734 Ga0070696_100841788
735 Ga0070665_100022608
736 Ga0070704_100020263
737 Ga0070704_100096782
738 Ga0070704_100845635
739 Ga0068855_100302296
740 Ga0068855_100413100
741 Ga0070664_100024448
742 Ga0070664_100070815
743 Ga0070664_100072274
744 Ga0070664_100224241
745 Ga0068857_100031673
746 Ga0068857_100104553
747 Ga0068857_100563389
748 Ga0068854_100338664
749 Ga0068856_100019445
750 Ga0070702_100328134
751 Ga0068852_100012731
752 Ga0068852_100039811
753 Ga0068852_100044520
754 Ga0068852_100313179
755 Ga0068859_100050039
756 Ga0068859_100194682
757 Ga0068859_100262991
758 Ga0068859_100448880
759 Ga0068859_100497326
760 Ga0068864_100000641
761 Ga0068864_100351015
762 Ga0068864_100351038
763 Ga0068864_100430860
764 Ga0068861_100007187
765 Ga0068861_100121165
766 Ga0068861_101644672
767 Ga0068851_10126537
768 Ga0068851_10929173
769 Ga0068870_10172324
770 Ga0068870_10476388
771 Ga0068863_100098465
772 Ga0068863_100100858
773 Ga0068863_100305953
774 Ga0068863_100405814
775 Ga0068863_100648431
776 Ga0068863_100807318
777 Ga0068863_101093305
778 Ga0068858_100116738
779 Ga0068858_100256462
780 Ga0068858_100587583
781 Ga0068858_100985798
782 Ga0068860_100433261
783 Ga0068860_100995258
784 Ga0068862_100038283
785 Ga0068862_100056852
786 Ga0068862_100582663
787 Ga0068862_100609483
788 Ga0068862_101536379
789 Ga0070717_10430108
790 Ga0075432_10238168
791 Ga0070715_10116158
792 Ga0070716_100405125
793 Ga0070712_100336707
794 Ga0070712_100850815
795 Ga0070712_101175171
796 Ga0097621_100083101
797 Ga0097621_100167242
798 Ga0097621_100293987
799 Ga0097621_100390321
800 Ga0097621_100662646
801 Ga0068871_100129934
802 Ga0068871_100316667
803 Ga0068871_100645774
804 Ga0068871_101085676
805 Ga0075428_100018610
806 Ga0075428_101631331
807 Ga0075431_100081100
808 Ga0075431_100273279
809 Ga0075431_100895561
810 Ga0075433_10001882
811 Ga0075433_10025266
812 Ga0075433_10096025
813 Ga0075433_11132032
814 Ga0075434_100149265
815 Ga0075434_100171984
816 Ga0075434_100469135
817 Ga0075434_102130309
818 Ga0075429_100003589
819 Ga0068865_100029573
820 Ga0068865_100124535
821 Ga0068865_100296291
822 Ga0068865_100543238
823 Ga0068865_101067804
824 Ga0075436_100204303
825 Ga0075436_100289707
826 Ga0097620_100050041
827 Ga0097620_100194676
828 Ga0097620_100262987
829 Ga0097620_100448915
830 Ga0097620_100497327
831 Ga0075435_100020052
832 Ga0075435_100092550
833 Ga0075435_100216388
834 Ga0105240_10093803
835 Ga0105240_10183991
836 Ga0111539_10047674
837 Ga0111539_10322809
838 Ga0111539_10473947
839 Ga0111539_11665046
840 Ga0105245_10425720
841 Ga0105245_10816248
842 Ga0114129_10087793
843 Ga0114129_10520893
844 Ga0114129_10604583
845 Ga0114129_11170827
846 Ga0114129_11174352
847 Ga0105243_10248098
848 Ga0105243_11577555
849 Ga0105241_10291386
850 Ga0105241_10593150
851 Ga0105241_11950072
852 Ga0105242_10005209
853 Ga0105242_10241976
854 Ga0105242_10283014
855 Ga0105242_10290406
856 Ga0105242_10295709
857 Ga0105242_10968432
858 Ga0105242_11494094
859 Ga0105248_10018439
860 Ga0105248_10024686
861 Ga0105248_10416422
862 Ga0105238_10029936
863 Ga0105238_10141753
864 Ga0105249_10000628
865 Ga0105249_10001477
866 Ga0105249_10002990
867 Ga0105249_10009699
868 Ga0105249_10033670
869 Ga0105249_10064795
870 Ga0105249_10444717
871 Ga0105249_10451408
872 Ga0105249_10743469
873 Ga0105239_10198889
874 Ga0105246_10076476
875 Ga0105246_10203036
876 Ga0157327_1030453
877 Ga0157371_10046687
878 Ga0157370_10617196
879 Ga0157369_10000858
880 Ga0157374_10163924
881 Ga0157374_11346675
882 Ga0157374_11588663
883 Ga0157374_11617003
884 Ga0157378_10574434
885 Ga0157378_10936283
886 Ga0157378_11457686
887 Ga0163162_10031737
888 Ga0163162_10045235
889 Ga0163162_10194071
890 Ga0163162_10533360
891 Ga0163162_10745945
892 Ga0163162_10766744
893 Ga0157372_10002923
894 Ga0157372_10980297
895 Ga0157375_10097196
896 Ga0157375_10107165
897 Ga0157375_10296820
898 Ga0157375_10371380
899 Ga0157375_10435800
900 Ga0157375_10463172
901 Ga0157375_11602747
902 Ga0157375_11624113
903 Ga0163163_10008994
904 Ga0163163_10143710
905 Ga0163163_11043407
906 Ga0163163_12459073
907 Ga0157380_10065917
908 Ga0157380_10124542
909 Ga0157380_10303403
910 Ga0157377_10029061
911 Ga0157377_10219197
912 Ga0157377_10398541
913 Ga0157377_10529021
914 Ga0157379_10013353
915 Ga0157376_10293617
916 Ga0157376_10434463
917 Ga0157376_10817832
918 Ga0157376_11828210
919 Ga0163161_10016870
920 Ga0163161_10213393
921 Ga0163161_10643362
922 Ga0207697_10002357
923 Ga0207697_10007557
924 Ga0207656_10010671
925 Ga0207656_10403206
926 Ga0207653_10008383
927 Ga0207642_10012552
928 Ga0207688_10435950
929 Ga0207647_10077598
930 Ga0207699_10007814
931 Ga0207645_10001751
932 Ga0207645_10110905
933 Ga0207645_10149053
934 Ga0207705_10586809
935 Ga0207684_10049020
936 Ga0207684_10375225
937 Ga0207654_10102000
938 Ga0207654_11190243
939 Ga0207707_10571026
940 Ga0207695_10321727
941 Ga0207663_10000099
942 Ga0207663_10003317
943 Ga0207663_10118445
944 Ga0207663_10244314
945 Ga0207663_10457310
946 Ga0207660_10583037
947 Ga0207662_10046589
948 Ga0207657_10037512
949 Ga0207649_10029910
950 Ga0207649_10530663
951 Ga0207652_10262376
952 Ga0207646_10037919
953 Ga0207646_10265935
954 Ga0207646_11723762
955 Ga0207681_10022101
956 Ga0207681_10294777
957 Ga0207694_10091848
958 Ga0207650_10027467
959 Ga0207650_10047551
960 Ga0207650_10404873
961 Ga0207659_10006536
962 Ga0207659_10010153
963 Ga0207659_10188377
964 Ga0207687_10295747
965 Ga0207687_11003697
966 Ga0207644_10054218
967 Ga0207644_10319296
968 Ga0207644_10506449
969 Ga0207644_11026590
970 Ga0207644_11186722
971 Ga0207690_10061140
972 Ga0207706_10004024
973 Ga0207686_10011670
974 Ga0207686_10396487
975 Ga0207686_10595870
976 Ga0207686_10763300
977 Ga0207686_11325697
978 Ga0207709_10806690
979 Ga0207670_10081693
980 Ga0207669_10173453
981 Ga0207669_10695346
982 Ga0207704_10054646
983 Ga0207665_10101076
984 Ga0207691_10002077
985 Ga0207691_10023884
986 Ga0207691_10175806
987 Ga0207711_10040694
988 Ga0207711_10111002
989 Ga0207711_10162883
990 Ga0207711_10851617
991 Ga0207689_10010199
992 Ga0207689_10031538
993 Ga0207689_10358877
994 Ga0207661_10000654
995 Ga0207661_10048341
996 Ga0207661_10074416
997 Ga0207661_10182540
998 Ga0207661_10231399
999 Ga0207679_10013194
1000 Ga0207679_10167795
1001 Ga0207679_10190882
1002 Ga0207679_10780326
1003 Ga0207651_10066428
1004 Ga0207651_10078954
1005 Ga0207712_10007731
1006 Ga0207712_10019181
1007 Ga0207712_10040845
1008 Ga0207668_10054736
1009 Ga0207668_10118373
1010 Ga0207668_10242294
1011 Ga0207658_10459620
1012 Ga0207658_10575912
1013 Ga0207677_10013631
1014 Ga0207677_10309662
1015 Ga0207677_11159925
1016 Ga0207703_10614347
1017 Ga0207703_10623798
1018 Ga0207639_10060227
1019 Ga0207639_10307364
1020 Ga0207708_10007175
1021 Ga0207708_10180051
1022 Ga0207641_10289891
1023 Ga0207641_10548170
1024 Ga0207641_10618707
1025 Ga0207648_10685323
1026 Ga0207648_10804813
1027 Ga0207676_10003490
1028 Ga0207676_10413720
1029 Ga0207674_10012305
1030 Ga0207674_10160084
1031 Ga0207674_10376796
1032 Ga0207675_100003327
1033 Ga0207675_100063079
1034 Ga0207675_100671523
1035 Ga0207683_10217497
1036 Ga0207683_10576564
1037 Ga0207698_10016338
1038 Ga0207698_10117962
1039 Ga0207428_10107872
1040 Ga0268266_10208487
1041 Ga0268265_10047370
1042 Ga0268265_10057203
1043 Ga0268265_10082781
1044 Ga0268265_10211834
1045 Ga0268264_10286874
1046 Ga0268264_10639973
1047 Ga0268264_11657178
1048 Ga0307408_100058870
1049 Ga0307406_10003532
1050 Ga0373934_0021419
1051 Ga0373949_0008336
1052 Ga0373923_0141276
1053 Ga0373953_0057962
1054 Ga0373956_0019449
1055 Ga0373957_0232965
1056 Ga0373955_0177608
1057 Ga0373927_0445504
1058 Ga0373933_0028146
1059 Ga0373947_0907092
1060 Ga0373937_0013315
1061 Ga0373937_0641264
1062 Ga0373925_0149119
1063 Ga0395900_1447381
1064 Ga0439441_003190
1065 Ga0439448_0092843
1066 Ga0450890_008708
1067 Ga0439444_0022450
1068 Ga0439464_0043855
1069 Ga0451577_0397434
1070 Ga0439440_0033681
1071 Ga0466963_0220612
1072 Ga0451576_0478837
1073 Ga0495592_0307160
1074 Ga0495629_0130696
1075 Ga0495651_0014374
1076 Ga0495580_0093847
1077 Ga0495580_0380261
1078 Ga0495582_0455838
1079 Ga0495582_0577094
1080 Ga0495605_0348055
1081 Ga0495639_0010225
1082 Ga0495664_0049868
1083 Ga0495594_0012077
1084 Ga0495594_0049710
1085 Ga0495594_0059470
1086 Ga0495594_0357720
1087 Ga0495608_0039704
1088 Ga0495628_0086263
1089 Ga0495666_0064567
1090 Ga0495652_0002095
1091 Ga0495665_0008586
1092 Ga0495586_0122997
1093 Ga0495586_0164290
1094 Ga0495587_0002671
1095 Ga0495587_0028208
1096 Ga0495645_0001059
1097 Ga0495667_0001095
1098 Ga0495634_0161791
1099 Ga0495635_0072402
1100 Ga0495588_0000731
1101 Ga0495599_0003972
1102 Ga0495623_0018223
1103 Ga0495658_0263173
1104 Ga0495600_0532491
1105 Ga0495581_0544222
1106 Ga0495604_0411159
1107 Ga0495680_0811282
1108 Ga0495675_0115504
1109 Ga0495675_0229191
1110 Ga0495684_0007077
1111 Ga0495684_0381751
1112 Ga0495602_0015265
1113 Ga0495602_0441140
1114 Ga0496100_0845880
1115 Ga0496102_0111291
1116 Ga0496104_0167306
1117 Ga0496105_0101278
1118 Ga0496106_0112132
1119 Ga0496106_0398513
1120 Ga0496107_0436120
1121 Ga0496108_0017458
1122 Ga0496108_0321868
1123 Ga0496109_0000620
1124 Ga0496109_1326749
1125 Ga0496110_0000742
1126 Ga0496111_0577203
1127 Ga0496112_0010003
1128 Ga0501031_0224493
1129 Ga0501034_0154811
1130 Ga0501037_0634775
1131 Ga0501041_0168614
1132 Ga0501043_0031439
1133 Ga0501047_0513881
1134 Ga0501073_1264837
1135 Ga0501075_0255123
1136 Ga0501075_0578270
1137 Ga0501076_1068959
1138 Ga0501077_0485621
1139 Ga0501081_0741372
1140 Ga0501083_0144421
1141 Ga0501035_1010083
1142 Ga0501044_0066258
1143 nmdc:mga05p37_427940_c1
1144 nmdc:mga05p37_520053_c1
1145 nmdc:mga05p37_77999_c1
1146 nmdc:mga06r32_1125118_c1
1147 nmdc:mga06r32_1340701_c1
1148 nmdc:mga08y16_1069951_c1
1149 nmdc:mga08y16_30718_c1
1150 nmdc:mga08y16_756775_c1
1151 nmdc:mga0n895_2455_c1
1152 nmdc:mga0rr50_11304_c1
1153 nmdc:mga0rr50_141134_c1
1154 nmdc:mga0rr50_168151_c1
1155 nmdc:mga0rr50_76407_c1
1156 nmdc:mga08x19_295697_c1
1157 nmdc:mga08x19_9127_c2
1158 nmdc:mga0a205_17409_c1
1159 nmdc:mga0a205_35332_c1
1160 nmdc:mga0a205_72079_c1
1161 Ga0495601_0394772
1162 Ga0495612_0042167
1163 Ga0495595_0064408
1164 Ga0495619_0030338
1165 Ga0501084_0328855
1166 Ga0501082_1091574

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01575

MaoC_dehydratas

MaoC like domain

2

123

0.88

PF13452

MaoC_dehydrat_N

N-terminal half of MaoC dehydratase

4

123

0.82

Structural Annotation

Top 5 Hits

ID Description Score Start End
1iq6-assembly1.cif.gz_A (r)-hydratase from a. caviae involved in pha biosynthesis 0.9446 2 131
3k67-assembly1.cif.gz_A crystal structure of protein af1124 from archaeoglobus fulgidus 0.9314 1 131
1iq6-assembly1.cif.gz_A (r)-hydratase from a. caviae involved in pha biosynthesis 0.9243 2 131
3ir3-assembly1.cif.gz_B crystal structure of human 3-hydroxyacyl-thioester dehydratase 2 (htd2) 0.8872 1 135
3ir3-assembly1.cif.gz_B crystal structure of human 3-hydroxyacyl-thioester dehydratase 2 (htd2) 0.8804 1 135
ID Description Score Start End Superfamily
af_A0A2R8QPM6_23_166_3.10.129.10 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9592 1 132 3.10.129.10
1iq6A00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9446 2 131 3.10.129.10
3k67A00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9314 1 131 3.10.129.10
1iq6A00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9243 2 131 3.10.129.10
af_A4HT66_2_132_3.10.129.10 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.9169 1 121 3.10.129.10
ID Description Score Start End GO Terms
AF-A0A2V7K448-F1-model_v4 Acyl dehydratase 0.99 3 137 GO:0006633
GO:0019171
AF-A0A2V6SY34-F1-model_v4 MaoC-like domain-containing protein 0.987 3 134 GO:0006633
GO:0019171
AF-A0A2V2SHK0-F1-model_v4 deleted 0.986 3 134
AF-A0A2V6TUC0-F1-model_v4 Acyl dehydratase 0.9845 4 134 GO:0006633
GO:0019171
AF-A0A541CD47-F1-model_v4 MaoC family dehydratase 0.9838 3 131 GO:0006633
GO:0019171

Map