F466102

General Info

Members Datasets Scaffolds Average Seq Length
581 249 1162 182

Family's Representative Sequence

Representative Sequence 3300046680|Ga0495646_0016234|Ga0495646_0016234_3093_3692
Length 199
Sequence MSHGFDAKPNAGPVLPAIPDHPAVAVLARVLERFNKLALYLSMAALMLTALIMTYSVVARYFFHVPSDWQDDATVFMLVGVIFLCAAYAQSYRGHIGIEALASILPAAVNTVRLLLVDLVSFVFCGFFSWKSWALFHEAWSEGQTTSSTFAPPLWIPYSLMALGMTALTLQLLVQVLARLTDRGMVADSKTDLQTVSGE

Samples

Sample ID Description Type Environment
1 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
2 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
3 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
4 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
5 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
6 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
7 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
8 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
9 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
10 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
11 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
12 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
13 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
14 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
15 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
16 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
17 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
18 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
19 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
20 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
21 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
22 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
23 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
24 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
25 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
26 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
27 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
28 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
29 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
30 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
31 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
32 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
33 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
34 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
35 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
36 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
37 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
38 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
39 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
40 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
41 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
42 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
43 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
44 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
45 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
46 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
47 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
48 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
49 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
50 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
51 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
52 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
53 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
54 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
55 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
56 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
57 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
58 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
59 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
60 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
61 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
62 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
63 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
64 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
65 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
66 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
67 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
68 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
69 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
70 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
71 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
72 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
73 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
74 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
75 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
76 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
77 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
78 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
79 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
80 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
81 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
82 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
83 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
84 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
85 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
86 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
87 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
88 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
89 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
90 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
91 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
92 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
93 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
94 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
95 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
96 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
127 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
128 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
129 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
130 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
131 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
132 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
133 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
134 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
135 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
136 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
137 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
138 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
139 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
140 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
141 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
142 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
143 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
144 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
145 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
146 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
147 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
148 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
149 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
150 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
151 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
152 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
153 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
154 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
155 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
156 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
157 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
158 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
159 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
160 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
161 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
162 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
163 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
164 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
165 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
166 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
167 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
168 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
169 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
170 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
171 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
172 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
173 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
174 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
175 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
176 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
177 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
178 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
179 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
180 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
181 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
182 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
183 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
184 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
185 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
186 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
187 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
188 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
189 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
190 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
191 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
192 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
193 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
194 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
195 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
196 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
197 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
198 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
199 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
200 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
201 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
202 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
203 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
204 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
205 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
206 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
207 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
208 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
209 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
210 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
211 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
212 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
213 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
214 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
215 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
216 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
217 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
218 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
219 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
220 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
221 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
222 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
223 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
224 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
225 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
226 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
227 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
228 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
229 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
230 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
231 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
232 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
233 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
234 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
235 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
236 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
237 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
238 3300053141 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere Metagenome Endosphere
239 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
240 2643221554 Duganella sp. Root1480D1 Isolate Unclassified
241 2643221638 Duganella sp. Root336D2 Isolate Unclassified
242 2643221645 Massilia sp. Root351 Isolate Unclassified
243 2643221664 Massilia sp. Root418 Isolate Unclassified
244 2738541280 Massilia sp. GV090 Isolate Unclassified
245 2738541300 Massilia sp. GV016 Isolate Unclassified
246 2738543018 Massilia sp. GV045 Isolate Unclassified
247 2738543030 Massilia sp. GV097 Isolate Unclassified
248 2818991436 Collimonas arenae 515 Isolate Unclassified
249 2904424332 Duganella sp. 1411 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.28
Metatranscriptomes 0
Isolates 1.72

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 14.97
Nodule 0
Rhizoplane 4.13
Rhizosphere 76.76
Stem 0
Stem Tuber 0
Unclassified 0.17

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495646_0016234 3300046680 Bacteria 4727
2 JGI25156J39149_1003286 3300002705 Bacteria 5357
3 JGI25162J39368_1000015 3300002737 Bacteria 316381
4 JGI25154J39366_1002712 3300002738 Bacteria 4310
5 JGI25158J39367_1000644 3300002739 Bacteria 6883
6 JGI25158J39367_1002306 3300002739 Bacteria 3137
7 JGI25157J39369_1017044 3300002741 Bacteria 884
8 JGI25164J39214_1003153 3300002772 Bacteria 2184
9 JGI25152J39213_1000242 3300002773 Bacteria 36400
10 JGI25152J39213_1007466 3300002773 Bacteria 2827
11 JGI25150J39212_1000335 3300002774 Bacteria 23131
12 JGI25150J39212_1021055 3300002774 Bacteria 997
13 JGI25159J45721_1001941 3300002987 Bacteria 8241
14 JGI25159J45721_1002166 3300002987 Bacteria 7649
15 JGI25165J46597_1000001 3300003214 Bacteria 1111887
16 rootH1_10180508 3300003323 Bacteria 1235
17 JGI25161J50226_1000166 3300003374 Bacteria 45462
18 Ga0055538_1000001 3300003751 Bacteria 1111887
19 Ga0055539_1000001 3300003752 Bacteria 1111887
20 Ga0055533_1000003 3300003756 Bacteria 1111887
21 Ga0055525_1000003 3300003759 Bacteria 962094
22 Ga0055526_1000061 3300003771 Bacteria 106054
23 Ga0055526_1000418 3300003771 Bacteria 34250
24 Ga0055526_1000602 3300003771 Bacteria 28135
25 Ga0055537_1003151 3300003773 Bacteria 5164
26 Ga0055537_1017949 3300003773 Bacteria 1146
27 Ga0055537_1021544 3300003773 Bacteria 956
28 Ga0055524_1000223 3300003775 Bacteria 60211
29 Ga0055524_1000861 3300003775 Bacteria 19849
30 Ga0055524_1010125 3300003775 Bacteria 3776
31 Ga0055524_1034421 3300003775 Bacteria 1401
32 Ga0055534_1000351 3300003784 Bacteria 29531
33 Ga0055534_1034154 3300003784 Bacteria 772
34 Ga0055528_1000036 3300003790 Bacteria 116393
35 Ga0055528_1020648 3300003790 Bacteria 2131
36 Ga0055530_10000262 3300003791 Bacteria 47466
37 Ga0055541_1000001 3300003841 Bacteria 1111887
38 Ga0055543_1000063 3300004625 Bacteria 98011
39 Ga0055543_1010078 3300004625 Bacteria 1998
40 Ga0065165_1000612 3300005262 Bacteria 51854
41 Ga0065165_1001278 3300005262 Bacteria 28419
42 Ga0065715_10017199 3300005293 Bacteria 3043
43 Ga0070676_10000460 3300005328 Bacteria 19460
44 Ga0070690_100097669 3300005330 Bacteria 1943
45 Ga0070670_100024282 3300005331 Bacteria 5215
46 Ga0068869_100003214 3300005334 Bacteria 9985
47 Ga0070666_10000439 3300005335 Bacteria 25357
48 Ga0068868_100004899 3300005338 Bacteria 9401
49 Ga0070668_100000714 3300005347 Bacteria 22756
50 Ga0070669_100000685 3300005353 Bacteria 24802
51 Ga0070675_100000769 3300005354 Bacteria 22360
52 Ga0070671_100039288 3300005355 Bacteria 3928
53 Ga0070674_100001488 3300005356 Bacteria 12489
54 Ga0070673_100001967 3300005364 Bacteria 12390
55 Ga0070667_100001175 3300005367 Bacteria 23800
56 Ga0070678_100000294 3300005456 Bacteria 23120
57 Ga0068867_100000643 3300005459 Bacteria 23109
58 Ga0070685_10004609 3300005466 Bacteria 6975
59 Ga0070672_100000479 3300005543 Bacteria 23258
60 Ga0070665_100004149 3300005548 Bacteria 15244
61 Ga0068854_100863193 3300005578 Bacteria 793
62 Ga0068859_100016181 3300005617 Bacteria 7492
63 Ga0068864_100001326 3300005618 Bacteria 20588
64 Ga0068861_100009480 3300005719 Bacteria 6723
65 Ga0068851_10082164 3300005834 Bacteria 1684
66 Ga0068863_100001375 3300005841 Bacteria 24143
67 Ga0068858_100001028 3300005842 Bacteria 28803
68 Ga0068860_100015302 3300005843 Bacteria 7492
69 Ga0068862_100526768 3300005844 Bacteria 1125
70 Ga0097621_100001008 3300006237 Bacteria 19831
71 Ga0068871_100009136 3300006358 Bacteria 7163
72 Ga0068865_100005487 3300006881 Bacteria 7694
73 Ga0068865_100288487 3300006881 Bacteria 1309
74 Ga0097620_100016180 3300006931 Bacteria 7492
75 Ga0105240_10338283 3300009093 Bacteria 1710
76 Ga0105243_10786438 3300009148 Bacteria 936
77 Ga0105241_10693363 3300009174 Bacteria 929
78 Ga0105239_10104239 3300010375 Bacteria 3140
79 Ga0105239_10860001 3300010375 Bacteria 1040
80 Ga0157374_10007694 3300013296 Bacteria 9200
81 Ga0157378_10106893 3300013297 Bacteria 2560
82 Ga0157380_10164792 3300014326 Bacteria 1930
83 Ga0182006_1006579 3300015261 Bacteria 5384
84 Ga0182007_10038828 3300015262 Bacteria 1595
85 Ga0182005_1000522 3300015265 Bacteria 19636
86 Ga0163161_10006917 3300017792 Bacteria 7846
87 Ga0209435_100181 3300025206 Bacteria 18859
88 Ga0209760_104522 3300025207 Bacteria 1188
89 Ga0209436_100056 3300025208 Bacteria 61172
90 Ga0209436_103176 3300025208 Bacteria 4490
91 Ga0209436_107064 3300025208 Bacteria 2394
92 Ga0209784_100004 3300025224 Bacteria 1378156
93 Ga0209566_100004 3300025225 Bacteria 1531866
94 Ga0209674_100006 3300025226 Bacteria 1531866
95 Ga0209563_100009 3300025230 Bacteria 1378156
96 Ga0207427_101473 3300025231 Bacteria 8475
97 Ga0209437_100004 3300025233 Bacteria 1378156
98 Ga0207425_1000001 3300025245 Bacteria 2525432
99 Ga0207425_1000039 3300025245 Bacteria 219078
100 Ga0209646_1000173 3300025246 Bacteria 84706
101 Ga0209026_1006724 3300025250 Bacteria 2751
102 Ga0209677_100005 3300025253 Bacteria 1378156
103 Ga0209759_1000224 3300025256 Bacteria 84649
104 Ga0209129_1000001 3300025258 Bacteria 1452436
105 Ga0209129_1005425 3300025258 Bacteria 4521
106 Ga0209233_1000005 3300025261 Bacteria 1531866
107 Ga0209565_1000017 3300025263 Bacteria 462438
108 Ga0209565_1000998 3300025263 Bacteria 14541
109 Ga0209565_1001338 3300025263 Bacteria 11213
110 Ga0209565_1001557 3300025263 Bacteria 9815
111 Ga0209565_1006500 3300025263 Bacteria 3270
112 Ga0209673_1000007 3300025273 Bacteria 634477
113 Ga0209673_1005138 3300025273 Bacteria 6697
114 Ga0209130_1000078 3300025284 Bacteria 169374
115 Ga0209130_1000128 3300025284 Bacteria 123595
116 Ga0209130_1005348 3300025284 Bacteria 4490
117 Ga0209675_1000009 3300025291 Bacteria 562872
118 Ga0209675_1002200 3300025291 Bacteria 10218
119 Ga0209564_1000036 3300025295 Bacteria 423455
120 Ga0209564_1000055 3300025295 Bacteria 343782
121 Ga0209564_1000089 3300025295 Bacteria 249694
122 Ga0209564_1000109 3300025295 Bacteria 212912
123 Ga0209564_1005064 3300025295 Bacteria 7695
124 Ga0209564_1005305 3300025295 Bacteria 7425
125 Ga0209564_1012464 3300025295 Bacteria 3707
126 Ga0209758_1000020 3300025297 Bacteria 734220
127 Ga0209050_1000074 3300025298 Bacteria 289334
128 Ga0209050_1000628 3300025298 Bacteria 55015
129 Ga0209256_1000028 3300025299 Bacteria 420213
130 Ga0209256_1000167 3300025299 Bacteria 133419
131 Ga0209256_1000621 3300025299 Bacteria 48888
132 Ga0207426_1001909 3300025302 Bacteria 15069
133 Ga0207426_1059131 3300025302 Bacteria 1109
134 Ga0207426_1064711 3300025302 Bacteria 1039
135 Ga0209257_1000003 3300025304 Bacteria 1702593
136 Ga0209257_1001374 3300025304 Bacteria 29209
137 Ga0207697_10008562 3300025315 Bacteria 4468
138 Ga0207656_10138751 3300025321 Bacteria 1144
139 Ga0207682_10131734 3300025893 Bacteria 1116
140 Ga0207680_10000461 3300025903 Bacteria 19199
141 Ga0207645_10000534 3300025907 Bacteria 31590
142 Ga0207643_10133245 3300025908 Bacteria 1480
143 Ga0207654_10606376 3300025911 Unclassified 781
144 Ga0207681_10000530 3300025923 Bacteria 26366
145 Ga0207650_10077415 3300025925 Bacteria 2514
146 Ga0207659_10000248 3300025926 Bacteria 32815
147 Ga0207644_10018482 3300025931 Bacteria 4717
148 Ga0207709_10419682 3300025935 Bacteria 1027
149 Ga0207669_10006845 3300025937 Bacteria 5243
150 Ga0207704_10000684 3300025938 Bacteria 15001
151 Ga0207704_10514165 3300025938 Bacteria 967
152 Ga0207691_10000022 3300025940 Bacteria 132936
153 Ga0207711_10014269 3300025941 Bacteria 6600
154 Ga0207689_10001287 3300025942 Bacteria 24173
155 Ga0207651_10009349 3300025960 Bacteria 5359
156 Ga0207668_10005408 3300025972 Bacteria 7521
157 Ga0207658_10000311 3300025986 Bacteria 49445
158 Ga0207677_10002948 3300026023 Bacteria 8989
159 Ga0207703_10010184 3300026035 Bacteria 7368
160 Ga0207641_10001378 3300026088 Bacteria 23986
161 Ga0207648_10001109 3300026089 Bacteria 30196
162 Ga0207676_10042365 3300026095 Bacteria 3501
163 Ga0207675_100014096 3300026118 Bacteria 7453
164 Ga0207683_10000108 3300026121 Bacteria 66917
165 Ga0268266_10074453 3300028379 Bacteria 2948
166 Ga0268265_10311714 3300028380 Bacteria 1421
167 Ga0268265_10803643 3300028380 Bacteria 917
168 Ga0268264_10002130 3300028381 Bacteria 17661
169 Ga0307515_10145879 3300028794 Bacteria 2507
170 Ga0307408_100000126 3300031548 Bacteria 84345
171 Ga0307408_100003761 3300031548 Bacteria 10329
172 Ga0307408_100082143 3300031548 Bacteria 2411
173 Ga0265314_10041691 3300031711 Bacteria 3282
174 Ga0395905_0015518 3300037471 Bacteria 7240
175 Ga0395905_0166240 3300037471 Bacteria 2073
176 Ga0395901_0521281 3300038443 Bacteria 1207
177 Ga0451577_0830818 3300042876 Bacteria 834
178 Ga0495617_000027 3300046452 Bacteria 157385
179 Ga0495617_001868 3300046452 Bacteria 8892
180 Ga0495617_006722 3300046452 Bacteria 4020
181 Ga0495617_025891 3300046452 Bacteria 1976
182 Ga0495627_000001 3300046453 Bacteria 1104709
183 Ga0495627_000277 3300046453 Bacteria 51556
184 Ga0495603_0087215 3300046455 Bacteria 1826
185 Ga0495591_000500 3300046458 Bacteria 30952
186 Ga0495591_058398 3300046458 Bacteria 1031
187 Ga0495629_0417096 3300046459 Bacteria 911
188 Ga0495638_0012397 3300046460 Bacteria 5845
189 Ga0495638_0023529 3300046460 Bacteria 4028
190 Ga0495638_0197927 3300046460 Bacteria 1136
191 Ga0495651_0001090 3300046462 Bacteria 20913
192 Ga0495651_0077368 3300046462 Bacteria 2518
193 Ga0495653_0012739 3300046463 Bacteria 6868
194 Ga0495653_0035107 3300046463 Bacteria 3959
195 Ga0495653_0044779 3300046463 Bacteria 3433
196 Ga0495650_0000019 3300046471 Bacteria 533849
197 Ga0495650_0006569 3300046471 Bacteria 7229
198 Ga0495650_0034066 3300046471 Bacteria 2259
199 Ga0495650_0127708 3300046471 Bacteria 930
200 Ga0495582_0044368 3300046473 Bacteria 2448
201 Ga0495605_0000135 3300046474 Bacteria 95104
202 Ga0495605_0011545 3300046474 Bacteria 4919
203 Ga0495605_0049768 3300046474 Bacteria 2046
204 Ga0495605_0066718 3300046474 Bacteria 1708
205 Ga0495605_0110249 3300046474 Bacteria 1256
206 Ga0495605_0201686 3300046474 Bacteria 866
207 Ga0495584_0000002 3300046491 Bacteria 512179
208 Ga0495584_0000300 3300046491 Bacteria 34910
209 Ga0495584_0000700 3300046491 Bacteria 22162
210 Ga0495584_0002291 3300046491 Bacteria 10919
211 Ga0495584_0004911 3300046491 Bacteria 7135
212 Ga0495584_0025777 3300046491 Bacteria 2981
213 Ga0495584_0166207 3300046491 Bacteria 1121
214 Ga0495584_0327096 3300046491 Bacteria 778
215 Ga0495585_0000002 3300046492 Bacteria 529316
216 Ga0495585_0001198 3300046492 Bacteria 21099
217 Ga0495585_0001944 3300046492 Bacteria 15432
218 Ga0495585_0008560 3300046492 Bacteria 6196
219 Ga0495585_0010157 3300046492 Bacteria 5622
220 Ga0495585_0013244 3300046492 Bacteria 4831
221 Ga0495585_0028547 3300046492 Bacteria 3181
222 Ga0495585_0028571 3300046492 Bacteria 3180
223 Ga0495585_0070103 3300046492 Bacteria 1912
224 Ga0495585_0161249 3300046492 Bacteria 1163
225 Ga0495585_0178326 3300046492 Bacteria 1093
226 Ga0495585_0377273 3300046492 Bacteria 685
227 Ga0495594_0045191 3300046499 Bacteria 2417
228 Ga0495594_0078810 3300046499 Bacteria 1838
229 Ga0495594_0091010 3300046499 Bacteria 1709
230 Ga0495596_0002268 3300046500 Bacteria 10461
231 Ga0495596_0002981 3300046500 Bacteria 8782
232 Ga0495596_0005474 3300046500 Bacteria 5991
233 Ga0495596_0010381 3300046500 Bacteria 4056
234 Ga0495596_0020324 3300046500 Bacteria 2720
235 Ga0495596_0025356 3300046500 Bacteria 2396
236 Ga0495607_0000264 3300046501 Bacteria 56345
237 Ga0495607_0004462 3300046501 Bacteria 10268
238 Ga0495607_0007161 3300046501 Bacteria 7750
239 Ga0495607_0019919 3300046501 Bacteria 4250
240 Ga0495607_0030417 3300046501 Bacteria 3315
241 Ga0495607_0042270 3300046501 Bacteria 2702
242 Ga0495607_0061549 3300046501 Bacteria 2132
243 Ga0495607_0132440 3300046501 Bacteria 1295
244 Ga0495607_0141317 3300046501 Bacteria 1241
245 Ga0495583_0000009 3300046506 Bacteria 372527
246 Ga0495583_0000026 3300046506 Bacteria 256777
247 Ga0495583_0000067 3300046506 Bacteria 189381
248 Ga0495583_0002853 3300046506 Bacteria 14060
249 Ga0495583_0006773 3300046506 Bacteria 7406
250 Ga0495583_0026944 3300046506 Bacteria 2842
251 Ga0495583_0027182 3300046506 Bacteria 2826
252 Ga0495583_0035591 3300046506 Bacteria 2375
253 Ga0495583_0035773 3300046506 Bacteria 2367
254 Ga0495583_0061227 3300046506 Bacteria 1680
255 Ga0495583_0078445 3300046506 Bacteria 1438
256 Ga0495583_0088751 3300046506 Bacteria 1334
257 Ga0495606_0002942 3300046507 Bacteria 18812
258 Ga0495606_0039263 3300046507 Bacteria 3193
259 Ga0495606_0043030 3300046507 Bacteria 3016
260 Ga0495606_0147179 3300046507 Bacteria 1385
261 Ga0495608_0040595 3300046511 Bacteria 3117
262 Ga0495610_0001136 3300046512 Bacteria 24193
263 Ga0495616_0000333 3300046513 Bacteria 37273
264 Ga0495616_0000531 3300046513 Bacteria 28814
265 Ga0495616_0000713 3300046513 Bacteria 24644
266 Ga0495616_0003242 3300046513 Bacteria 10468
267 Ga0495616_0006338 3300046513 Bacteria 7173
268 Ga0495616_0013282 3300046513 Bacteria 4651
269 Ga0495616_0032517 3300046513 Bacteria 2724
270 Ga0495616_0035360 3300046513 Bacteria 2586
271 Ga0495616_0044971 3300046513 Bacteria 2237
272 Ga0495616_0067563 3300046513 Bacteria 1737
273 Ga0495616_0069051 3300046513 Bacteria 1714
274 Ga0495618_0044788 3300046514 Bacteria 2790
275 Ga0495628_0000935 3300046516 Bacteria 26746
276 Ga0495628_0009156 3300046516 Bacteria 8466
277 Ga0495628_0045760 3300046516 Bacteria 3478
278 Ga0495631_0001148 3300046518 Bacteria 16396
279 Ga0495631_0010095 3300046518 Bacteria 4690
280 Ga0495631_0013306 3300046518 Bacteria 3995
281 Ga0495631_0018738 3300046518 Bacteria 3254
282 Ga0495631_0084952 3300046518 Bacteria 1363
283 Ga0495631_0131035 3300046518 Bacteria 1077
284 Ga0495632_0007007 3300046519 Bacteria 7150
285 Ga0495632_0258328 3300046519 Bacteria 780
286 Ga0495637_0000053 3300046520 Bacteria 99739
287 Ga0495637_0026817 3300046520 Bacteria 2582
288 Ga0495637_0074288 3300046520 Bacteria 1365
289 Ga0495637_0164975 3300046520 Bacteria 829
290 Ga0495643_0000121 3300046522 Bacteria 125932
291 Ga0495643_0000285 3300046522 Bacteria 72233
292 Ga0495643_0011896 3300046522 Bacteria 5271
293 Ga0495643_0058593 3300046522 Bacteria 2049
294 Ga0495643_0066182 3300046522 Bacteria 1906
295 Ga0495643_0165404 3300046522 Bacteria 1085
296 Ga0495644_0001029 3300046523 Bacteria 11616
297 Ga0495644_0001033 3300046523 Bacteria 11590
298 Ga0495644_0014976 3300046523 Bacteria 2969
299 Ga0495644_0024082 3300046523 Bacteria 2315
300 Ga0495644_0028378 3300046523 Bacteria 2118
301 Ga0495644_0037727 3300046523 Bacteria 1823
302 Ga0495644_0050851 3300046523 Bacteria 1556
303 Ga0495644_0099588 3300046523 Bacteria 1099
304 Ga0495644_0162451 3300046523 Bacteria 856
305 Ga0495648_0000012 3300046524 Bacteria 294111
306 Ga0495648_0000831 3300046524 Bacteria 32651
307 Ga0495648_0005856 3300046524 Bacteria 10117
308 Ga0495648_0034458 3300046524 Bacteria 3294
309 Ga0495648_0065116 3300046524 Bacteria 2144
310 Ga0495648_0094748 3300046524 Bacteria 1662
311 Ga0495648_0120273 3300046524 Bacteria 1413
312 Ga0495648_0127671 3300046524 Bacteria 1356
313 Ga0495648_0227113 3300046524 Bacteria 916
314 Ga0495648_0327505 3300046524 Bacteria 708
315 Ga0495663_0009796 3300046525 Bacteria 2659
316 Ga0495666_0000177 3300046526 Bacteria 27146
317 Ga0495642_0000137 3300046528 Bacteria 42614
318 Ga0495642_0000441 3300046528 Bacteria 21882
319 Ga0495642_0008116 3300046528 Bacteria 4018
320 Ga0495642_0078480 3300046528 Bacteria 1387
321 Ga0495642_0078486 3300046528 Bacteria 1387
322 Ga0495652_0032797 3300046529 Bacteria 4538
323 Ga0495652_0059389 3300046529 Bacteria 3235
324 Ga0495652_0168519 3300046529 Bacteria 1692
325 Ga0495654_0016492 3300046530 Bacteria 3904
326 Ga0495654_0018321 3300046530 Bacteria 3670
327 Ga0495654_0046435 3300046530 Bacteria 2139
328 Ga0495665_0003160 3300046531 Bacteria 8914
329 Ga0495665_0086043 3300046531 Bacteria 1652
330 Ga0495640_0017785 3300046533 Bacteria 5290
331 Ga0495586_0024037 3300046535 Bacteria 3254
332 Ga0495586_0039610 3300046535 Bacteria 2534
333 Ga0495587_0027700 3300046536 Bacteria 3450
334 Ga0495609_0000110 3300046538 Bacteria 96998
335 Ga0495609_0001214 3300046538 Bacteria 17758
336 Ga0495609_0001479 3300046538 Bacteria 15589
337 Ga0495609_0007094 3300046538 Bacteria 5638
338 Ga0495609_0016742 3300046538 Bacteria 3414
339 Ga0495609_0034455 3300046538 Bacteria 2295
340 Ga0495609_0052357 3300046538 Bacteria 1816
341 Ga0495609_0146642 3300046538 Bacteria 1005
342 Ga0495621_0071983 3300046539 Bacteria 1275
343 Ga0495597_0000284 3300046542 Bacteria 45727
344 Ga0495597_0000682 3300046542 Bacteria 27481
345 Ga0495597_0001719 3300046542 Bacteria 15127
346 Ga0495597_0110870 3300046542 Bacteria 1150
347 Ga0495597_0162384 3300046542 Bacteria 911
348 Ga0495645_0022671 3300046543 Bacteria 4543
349 Ga0495645_0048441 3300046543 Bacteria 3095
350 Ga0495622_0012657 3300046557 Bacteria 3910
351 Ga0495622_0131601 3300046557 Bacteria 1139
352 Ga0495633_0001718 3300046558 Bacteria 16399
353 Ga0495633_0002489 3300046558 Bacteria 12983
354 Ga0495633_0004979 3300046558 Bacteria 8288
355 Ga0495633_0007515 3300046558 Bacteria 6261
356 Ga0495633_0012965 3300046558 Bacteria 4410
357 Ga0495633_0013456 3300046558 Bacteria 4311
358 Ga0495633_0071649 3300046558 Bacteria 1616
359 Ga0495633_0152091 3300046558 Bacteria 1068
360 Ga0495633_0153392 3300046558 Bacteria 1063
361 Ga0495633_0199600 3300046558 Bacteria 918
362 Ga0495656_0029366 3300046615 Bacteria 2213
363 Ga0495668_0000018 3300046616 Bacteria 417480
364 Ga0495668_0000240 3300046616 Bacteria 78290
365 Ga0495668_0000962 3300046616 Bacteria 32005
366 Ga0495668_0006047 3300046616 Bacteria 8020
367 Ga0495668_0007753 3300046616 Bacteria 6812
368 Ga0495668_0021842 3300046616 Bacteria 3664
369 Ga0495668_0072528 3300046616 Bacteria 1891
370 Ga0495668_0131722 3300046616 Bacteria 1368
371 Ga0495668_0232504 3300046616 Bacteria 1009
372 Ga0495668_0305609 3300046616 Bacteria 872
373 Ga0495611_0000271 3300046648 Bacteria 35492
374 Ga0495611_0000479 3300046648 Bacteria 23881
375 Ga0495611_0016841 3300046648 Bacteria 3124
376 Ga0495611_0023459 3300046648 Bacteria 2678
377 Ga0495611_0028955 3300046648 Bacteria 2427
378 Ga0495611_0052234 3300046648 Bacteria 1843
379 Ga0495611_0133108 3300046648 Bacteria 1160
380 Ga0495625_0001599 3300046660 Bacteria 26771
381 Ga0495625_0002213 3300046660 Bacteria 21493
382 Ga0495625_0005751 3300046660 Bacteria 11210
383 Ga0495625_0035469 3300046660 Bacteria 3677
384 Ga0495625_0039242 3300046660 Bacteria 3459
385 Ga0495635_0013914 3300046663 Bacteria 5629
386 Ga0495635_0392633 3300046663 Bacteria 922
387 Ga0495659_0000478 3300046664 Bacteria 14785
388 Ga0495659_0000547 3300046664 Bacteria 13898
389 Ga0495659_0020425 3300046664 Bacteria 2224
390 Ga0495659_0044438 3300046664 Bacteria 1597
391 Ga0495661_0000549 3300046665 Bacteria 38859
392 Ga0495661_0001822 3300046665 Bacteria 17101
393 Ga0495661_0002589 3300046665 Bacteria 13872
394 Ga0495661_0013656 3300046665 Bacteria 5452
395 Ga0495661_0021584 3300046665 Bacteria 4196
396 Ga0495661_0028733 3300046665 Bacteria 3556
397 Ga0495661_0028948 3300046665 Bacteria 3539
398 Ga0495661_0084832 3300046665 Bacteria 1816
399 Ga0495661_0135526 3300046665 Bacteria 1344
400 Ga0495588_0040264 3300046674 Bacteria 2382
401 Ga0495588_0053733 3300046674 Bacteria 2077
402 Ga0495588_0148345 3300046674 Bacteria 1239
403 Ga0495623_0000991 3300046679 Bacteria 19145
404 Ga0495623_0076211 3300046679 Bacteria 2081
405 Ga0495623_0223277 3300046679 Bacteria 1072
406 Ga0495646_0049946 3300046680 Bacteria 2537
407 Ga0495669_0000073 3300046684 Bacteria 66387
408 Ga0495669_0000315 3300046684 Bacteria 26716
409 Ga0495669_0001109 3300046684 Bacteria 11158
410 Ga0495613_0060482 3300046689 Bacteria 2774
411 Ga0495613_0172752 3300046689 Bacteria 1533
412 Ga0495624_0014255 3300046690 Bacteria 5397
413 Ga0495624_0029666 3300046690 Bacteria 3567
414 Ga0495670_0000355 3300046691 Bacteria 21905
415 Ga0495670_0000576 3300046691 Bacteria 17526
416 Ga0495670_0000763 3300046691 Bacteria 15434
417 Ga0495670_0011039 3300046691 Bacteria 4441
418 Ga0495670_0011580 3300046691 Bacteria 4339
419 Ga0495670_0018084 3300046691 Bacteria 3471
420 Ga0495670_0044216 3300046691 Bacteria 2223
421 Ga0495670_0067436 3300046691 Bacteria 1806
422 Ga0495670_0168013 3300046691 Bacteria 1154
423 Ga0495670_0569263 3300046691 Bacteria 617
424 Ga0495671_0001538 3300046692 Bacteria 15368
425 Ga0495671_0041323 3300046692 Bacteria 2322
426 Ga0495671_0042745 3300046692 Bacteria 2276
427 Ga0495671_0048827 3300046692 Bacteria 2111
428 Ga0495671_0049263 3300046692 Bacteria 2100
429 Ga0495649_0000291 3300046694 Bacteria 44106
430 Ga0495649_0006056 3300046694 Bacteria 7563
431 Ga0495649_0177383 3300046694 Bacteria 1113
432 Ga0495649_0218626 3300046694 Bacteria 986
433 Ga0495589_0000905 3300046794 Bacteria 18315
434 Ga0495589_0018929 3300046794 Bacteria 3531
435 Ga0495589_0028541 3300046794 Bacteria 2815
436 Ga0495589_0105738 3300046794 Bacteria 1360
437 Ga0495589_0227776 3300046794 Bacteria 874
438 Ga0495600_0075535 3300046809 Bacteria 2200
439 Ga0495600_0270461 3300046809 Bacteria 1078
440 Ga0495660_0000470 3300046810 Bacteria 33476
441 Ga0495660_0069406 3300046810 Bacteria 1873
442 Ga0495660_0069540 3300046810 Bacteria 1871
443 Ga0495660_0072346 3300046810 Bacteria 1826
444 Ga0495660_0127896 3300046810 Bacteria 1277
445 Ga0495581_0029372 3300047315 Bacteria 3187
446 Ga0495581_0046968 3300047315 Bacteria 2495
447 Ga0495604_0004660 3300047317 Bacteria 10871
448 Ga0495604_0006448 3300047317 Bacteria 9307
449 Ga0495604_0043297 3300047317 Bacteria 3525
450 Ga0495636_0000414 3300047318 Bacteria 15875
451 Ga0495636_0001341 3300047318 Bacteria 9347
452 Ga0495636_0002533 3300047318 Bacteria 7015
453 Ga0495636_0017160 3300047318 Bacteria 2897
454 Ga0495636_0041335 3300047318 Bacteria 1913
455 Ga0495636_0067110 3300047318 Bacteria 1526
456 Ga0495636_0118799 3300047318 Bacteria 1168
457 Ga0495672_0000066 3300047320 Bacteria 193318
458 Ga0495672_0000135 3300047320 Bacteria 110114
459 Ga0495672_0002864 3300047320 Bacteria 15326
460 Ga0495672_0014181 3300047320 Bacteria 5468
461 Ga0495672_0240736 3300047320 Bacteria 883
462 Ga0495680_0032849 3300047322 Bacteria 4207
463 Ga0495680_0163949 3300047322 Bacteria 1612
464 Ga0495680_0285128 3300047322 Bacteria 1163
465 Ga0495683_0000133 3300047323 Bacteria 72553
466 Ga0495683_0001638 3300047323 Bacteria 14401
467 Ga0495683_0004123 3300047323 Bacteria 8320
468 Ga0495683_0011568 3300047323 Bacteria 4642
469 Ga0495683_0103766 3300047323 Bacteria 1364
470 Ga0495683_0138837 3300047323 Bacteria 1140
471 Ga0495687_000030 3300047443 Bacteria 279992
472 Ga0495687_000374 3300047443 Bacteria 55800
473 Ga0495687_002366 3300047443 Bacteria 15258
474 Ga0495687_004366 3300047443 Bacteria 9613
475 Ga0495687_054467 3300047443 Bacteria 1678
476 Ga0495675_0018114 3300047444 Bacteria 4466
477 Ga0495675_0030169 3300047444 Bacteria 3460
478 Ga0495675_0095315 3300047444 Bacteria 1866
479 Ga0495677_0000387 3300047445 Bacteria 18876
480 Ga0495677_0002991 3300047445 Bacteria 6575
481 Ga0495677_0004187 3300047445 Bacteria 5562
482 Ga0495677_0007503 3300047445 Bacteria 4073
483 Ga0495677_0007754 3300047445 Bacteria 4001
484 Ga0495677_0010425 3300047445 Bacteria 3413
485 Ga0495677_0032258 3300047445 Bacteria 1907
486 Ga0495677_0316446 3300047445 Bacteria 614
487 Ga0495679_030949 3300047446 Bacteria 1731
488 Ga0495679_049662 3300047446 Bacteria 1264
489 Ga0495679_068151 3300047446 Bacteria 1030
490 Ga0495685_000011 3300047447 Bacteria 83484
491 Ga0495685_000539 3300047447 Bacteria 11706
492 Ga0495673_0000035 3300047469 Bacteria 316861
493 Ga0495673_0010958 3300047469 Bacteria 4905
494 Ga0495673_0031534 3300047469 Bacteria 2480
495 Ga0495673_0063314 3300047469 Bacteria 1577
496 Ga0495681_0000864 3300047470 Bacteria 23321
497 Ga0495681_0002025 3300047470 Bacteria 14795
498 Ga0495681_0005144 3300047470 Bacteria 8809
499 Ga0495681_0017148 3300047470 Bacteria 4033
500 Ga0495681_0019937 3300047470 Bacteria 3648
501 Ga0495681_0053395 3300047470 Bacteria 1892
502 Ga0495681_0074842 3300047470 Bacteria 1525
503 Ga0495681_0242339 3300047470 Bacteria 715
504 Ga0495681_0273146 3300047470 Bacteria 661
505 Ga0495686_0000290 3300047472 Bacteria 88168
506 Ga0495686_0000802 3300047472 Bacteria 40756
507 Ga0495686_0008599 3300047472 Bacteria 7471
508 Ga0495686_0029885 3300047472 Bacteria 3541
509 Ga0495593_0023146 3300047673 Bacteria 3455
510 Ga0495614_0003706 3300048089 Bacteria 6861
511 Ga0495614_0014600 3300048089 Bacteria 3434
512 Ga0495615_0171303 3300048090 Bacteria 657
513 Ga0495626_0003232 3300048091 Bacteria 10566
514 Ga0495626_0009512 3300048091 Bacteria 5251
515 Ga0495626_0037188 3300048091 Bacteria 2314
516 Ga0495626_0038004 3300048091 Bacteria 2284
517 Ga0495626_0074361 3300048091 Bacteria 1520
518 Ga0495626_0083168 3300048091 Bacteria 1418
519 Ga0495626_0101612 3300048091 Bacteria 1253
520 Ga0495626_0107446 3300048091 Bacteria 1211
521 Ga0495626_0139023 3300048091 Bacteria 1031
522 Ga0496100_0132944 3300048903 Bacteria 1754
523 Ga0496100_0311337 3300048903 Bacteria 1181
524 Ga0496101_0025139 3300048904 Bacteria 4128
525 Ga0496102_0000150 3300048905 Bacteria 94718
526 Ga0496102_0002351 3300048905 Bacteria 16129
527 Ga0496102_0020140 3300048905 Bacteria 5889
528 Ga0496102_0129773 3300048905 Bacteria 2358
529 Ga0496102_0135694 3300048905 Bacteria 2305
530 Ga0496102_0907323 3300048905 Bacteria 803
531 Ga0496103_0012424 3300048906 Bacteria 5049
532 Ga0496103_0128382 3300048906 Bacteria 1618
533 Ga0496105_0454678 3300048908 Bacteria 1010
534 Ga0496106_0084552 3300048909 Bacteria 2442
535 Ga0496107_0082563 3300048910 Bacteria 2344
536 Ga0496108_0793925 3300048911 Bacteria 817
537 Ga0496108_0927752 3300048911 Bacteria 746
538 Ga0496109_0019715 3300048912 Bacteria 5950
539 Ga0496109_0299139 3300048912 Bacteria 1517
540 Ga0496110_0000462 3300048913 Bacteria 27650
541 Ga0496110_0266770 3300048913 Bacteria 1559
542 Ga0496112_0936729 3300048915 Bacteria 787
543 Ga0496113_0099945 3300048916 Bacteria 2247
544 Ga0496113_0429224 3300048916 Bacteria 1062
545 Ga0496115_0199749 3300048918 Bacteria 1652
546 Ga0496121_0027483 3300048924 Bacteria 5325
547 Ga0496122_0001744 3300048925 Bacteria 33606
548 Ga0496123_0013972 3300048926 Bacteria 6687
549 Ga0496124_0023330 3300048927 Bacteria 5650
550 Ga0496124_0119587 3300048927 Bacteria 2107
551 Ga0496125_0017792 3300048928 Bacteria 6764
552 Ga0495678_000002 3300049459 Bacteria 999613
553 Ga0495678_000190 3300049459 Bacteria 71878
554 Ga0495678_000831 3300049459 Bacteria 27649
555 Ga0495678_002497 3300049459 Bacteria 12404
556 Ga0495678_003814 3300049459 Bacteria 9090
557 Ga0495678_036083 3300049459 Bacteria 2020
558 Ga0495678_055558 3300049459 Bacteria 1510
559 Ga0495682_0000199 3300049460 Bacteria 48422
560 Ga0495682_0001816 3300049460 Bacteria 10735
561 Ga0495682_0016499 3300049460 Bacteria 2795
562 Ga0495682_0065246 3300049460 Bacteria 1312
563 Ga0501222_013360 3300049662 Bacteria 1080
564 Ga0501269_014057 3300049766 Bacteria 981
565 Ga0501279_008635 3300049775 Bacteria 1362
566 Ga0501279_062250 3300049775 Bacteria 613
567 Ga0500572_056231 3300053111 Bacteria 1185
568 Ga0500594_0004952 3300053118 Bacteria 2946
569 Ga0500595_023498 3300053119 Bacteria 2165
570 Ga0500574_000678 3300053141 Bacteria 4476
571 Ga0500619_001205 3300053154 Bacteria 4505
572 2643790772 2643221554 Bacteria 6603920
573 2644211694 2643221638 Bacteria 6579467
574 2644251348 2643221645 Bacteria 7207331
575 2644357451 2643221664 Bacteria 7272945
576 2738740046 2738541280 Bacteria 6630198
577 2738844198 2738541300 Bacteria 6675882
578 2739274242 2738543018 Bacteria 6718814
579 2739343286 2738543030 Bacteria 6719714
580 2819540777 2818991436 Bacteria 5376622
581 2904425654 2904424332 Bacteria 7633521
582 Ga0495646_0016234
583 JGI25156J39149_1003286
584 JGI25162J39368_1000015
585 JGI25154J39366_1002712
586 JGI25158J39367_1000644
587 JGI25158J39367_1002306
588 JGI25157J39369_1017044
589 JGI25164J39214_1003153
590 JGI25152J39213_1000242
591 JGI25152J39213_1007466
592 JGI25150J39212_1000335
593 JGI25150J39212_1021055
594 JGI25159J45721_1001941
595 JGI25159J45721_1002166
596 JGI25165J46597_1000001
597 rootH1_10180508
598 JGI25161J50226_1000166
599 Ga0055538_1000001
600 Ga0055539_1000001
601 Ga0055533_1000003
602 Ga0055525_1000003
603 Ga0055526_1000061
604 Ga0055526_1000418
605 Ga0055526_1000602
606 Ga0055537_1003151
607 Ga0055537_1017949
608 Ga0055537_1021544
609 Ga0055524_1000223
610 Ga0055524_1000861
611 Ga0055524_1010125
612 Ga0055524_1034421
613 Ga0055534_1000351
614 Ga0055534_1034154
615 Ga0055528_1000036
616 Ga0055528_1020648
617 Ga0055530_10000262
618 Ga0055541_1000001
619 Ga0055543_1000063
620 Ga0055543_1010078
621 Ga0065165_1000612
622 Ga0065165_1001278
623 Ga0065715_10017199
624 Ga0070676_10000460
625 Ga0070690_100097669
626 Ga0070670_100024282
627 Ga0068869_100003214
628 Ga0070666_10000439
629 Ga0068868_100004899
630 Ga0070668_100000714
631 Ga0070669_100000685
632 Ga0070675_100000769
633 Ga0070671_100039288
634 Ga0070674_100001488
635 Ga0070673_100001967
636 Ga0070667_100001175
637 Ga0070678_100000294
638 Ga0068867_100000643
639 Ga0070685_10004609
640 Ga0070672_100000479
641 Ga0070665_100004149
642 Ga0068854_100863193
643 Ga0068859_100016181
644 Ga0068864_100001326
645 Ga0068861_100009480
646 Ga0068851_10082164
647 Ga0068863_100001375
648 Ga0068858_100001028
649 Ga0068860_100015302
650 Ga0068862_100526768
651 Ga0097621_100001008
652 Ga0068871_100009136
653 Ga0068865_100005487
654 Ga0068865_100288487
655 Ga0097620_100016180
656 Ga0105240_10338283
657 Ga0105243_10786438
658 Ga0105241_10693363
659 Ga0105239_10104239
660 Ga0105239_10860001
661 Ga0157374_10007694
662 Ga0157378_10106893
663 Ga0157380_10164792
664 Ga0182006_1006579
665 Ga0182007_10038828
666 Ga0182005_1000522
667 Ga0163161_10006917
668 Ga0209435_100181
669 Ga0209760_104522
670 Ga0209436_100056
671 Ga0209436_103176
672 Ga0209436_107064
673 Ga0209784_100004
674 Ga0209566_100004
675 Ga0209674_100006
676 Ga0209563_100009
677 Ga0207427_101473
678 Ga0209437_100004
679 Ga0207425_1000001
680 Ga0207425_1000039
681 Ga0209646_1000173
682 Ga0209026_1006724
683 Ga0209677_100005
684 Ga0209759_1000224
685 Ga0209129_1000001
686 Ga0209129_1005425
687 Ga0209233_1000005
688 Ga0209565_1000017
689 Ga0209565_1000998
690 Ga0209565_1001338
691 Ga0209565_1001557
692 Ga0209565_1006500
693 Ga0209673_1000007
694 Ga0209673_1005138
695 Ga0209130_1000078
696 Ga0209130_1000128
697 Ga0209130_1005348
698 Ga0209675_1000009
699 Ga0209675_1002200
700 Ga0209564_1000036
701 Ga0209564_1000055
702 Ga0209564_1000089
703 Ga0209564_1000109
704 Ga0209564_1005064
705 Ga0209564_1005305
706 Ga0209564_1012464
707 Ga0209758_1000020
708 Ga0209050_1000074
709 Ga0209050_1000628
710 Ga0209256_1000028
711 Ga0209256_1000167
712 Ga0209256_1000621
713 Ga0207426_1001909
714 Ga0207426_1059131
715 Ga0207426_1064711
716 Ga0209257_1000003
717 Ga0209257_1001374
718 Ga0207697_10008562
719 Ga0207656_10138751
720 Ga0207682_10131734
721 Ga0207680_10000461
722 Ga0207645_10000534
723 Ga0207643_10133245
724 Ga0207654_10606376
725 Ga0207681_10000530
726 Ga0207650_10077415
727 Ga0207659_10000248
728 Ga0207644_10018482
729 Ga0207709_10419682
730 Ga0207669_10006845
731 Ga0207704_10000684
732 Ga0207704_10514165
733 Ga0207691_10000022
734 Ga0207711_10014269
735 Ga0207689_10001287
736 Ga0207651_10009349
737 Ga0207668_10005408
738 Ga0207658_10000311
739 Ga0207677_10002948
740 Ga0207703_10010184
741 Ga0207641_10001378
742 Ga0207648_10001109
743 Ga0207676_10042365
744 Ga0207675_100014096
745 Ga0207683_10000108
746 Ga0268266_10074453
747 Ga0268265_10311714
748 Ga0268265_10803643
749 Ga0268264_10002130
750 Ga0307515_10145879
751 Ga0307408_100000126
752 Ga0307408_100003761
753 Ga0307408_100082143
754 Ga0265314_10041691
755 Ga0395905_0015518
756 Ga0395905_0166240
757 Ga0395901_0521281
758 Ga0451577_0830818
759 Ga0495617_000027
760 Ga0495617_001868
761 Ga0495617_006722
762 Ga0495617_025891
763 Ga0495627_000001
764 Ga0495627_000277
765 Ga0495603_0087215
766 Ga0495591_000500
767 Ga0495591_058398
768 Ga0495629_0417096
769 Ga0495638_0012397
770 Ga0495638_0023529
771 Ga0495638_0197927
772 Ga0495651_0001090
773 Ga0495651_0077368
774 Ga0495653_0012739
775 Ga0495653_0035107
776 Ga0495653_0044779
777 Ga0495650_0000019
778 Ga0495650_0006569
779 Ga0495650_0034066
780 Ga0495650_0127708
781 Ga0495582_0044368
782 Ga0495605_0000135
783 Ga0495605_0011545
784 Ga0495605_0049768
785 Ga0495605_0066718
786 Ga0495605_0110249
787 Ga0495605_0201686
788 Ga0495584_0000002
789 Ga0495584_0000300
790 Ga0495584_0000700
791 Ga0495584_0002291
792 Ga0495584_0004911
793 Ga0495584_0025777
794 Ga0495584_0166207
795 Ga0495584_0327096
796 Ga0495585_0000002
797 Ga0495585_0001198
798 Ga0495585_0001944
799 Ga0495585_0008560
800 Ga0495585_0010157
801 Ga0495585_0013244
802 Ga0495585_0028547
803 Ga0495585_0028571
804 Ga0495585_0070103
805 Ga0495585_0161249
806 Ga0495585_0178326
807 Ga0495585_0377273
808 Ga0495594_0045191
809 Ga0495594_0078810
810 Ga0495594_0091010
811 Ga0495596_0002268
812 Ga0495596_0002981
813 Ga0495596_0005474
814 Ga0495596_0010381
815 Ga0495596_0020324
816 Ga0495596_0025356
817 Ga0495607_0000264
818 Ga0495607_0004462
819 Ga0495607_0007161
820 Ga0495607_0019919
821 Ga0495607_0030417
822 Ga0495607_0042270
823 Ga0495607_0061549
824 Ga0495607_0132440
825 Ga0495607_0141317
826 Ga0495583_0000009
827 Ga0495583_0000026
828 Ga0495583_0000067
829 Ga0495583_0002853
830 Ga0495583_0006773
831 Ga0495583_0026944
832 Ga0495583_0027182
833 Ga0495583_0035591
834 Ga0495583_0035773
835 Ga0495583_0061227
836 Ga0495583_0078445
837 Ga0495583_0088751
838 Ga0495606_0002942
839 Ga0495606_0039263
840 Ga0495606_0043030
841 Ga0495606_0147179
842 Ga0495608_0040595
843 Ga0495610_0001136
844 Ga0495616_0000333
845 Ga0495616_0000531
846 Ga0495616_0000713
847 Ga0495616_0003242
848 Ga0495616_0006338
849 Ga0495616_0013282
850 Ga0495616_0032517
851 Ga0495616_0035360
852 Ga0495616_0044971
853 Ga0495616_0067563
854 Ga0495616_0069051
855 Ga0495618_0044788
856 Ga0495628_0000935
857 Ga0495628_0009156
858 Ga0495628_0045760
859 Ga0495631_0001148
860 Ga0495631_0010095
861 Ga0495631_0013306
862 Ga0495631_0018738
863 Ga0495631_0084952
864 Ga0495631_0131035
865 Ga0495632_0007007
866 Ga0495632_0258328
867 Ga0495637_0000053
868 Ga0495637_0026817
869 Ga0495637_0074288
870 Ga0495637_0164975
871 Ga0495643_0000121
872 Ga0495643_0000285
873 Ga0495643_0011896
874 Ga0495643_0058593
875 Ga0495643_0066182
876 Ga0495643_0165404
877 Ga0495644_0001029
878 Ga0495644_0001033
879 Ga0495644_0014976
880 Ga0495644_0024082
881 Ga0495644_0028378
882 Ga0495644_0037727
883 Ga0495644_0050851
884 Ga0495644_0099588
885 Ga0495644_0162451
886 Ga0495648_0000012
887 Ga0495648_0000831
888 Ga0495648_0005856
889 Ga0495648_0034458
890 Ga0495648_0065116
891 Ga0495648_0094748
892 Ga0495648_0120273
893 Ga0495648_0127671
894 Ga0495648_0227113
895 Ga0495648_0327505
896 Ga0495663_0009796
897 Ga0495666_0000177
898 Ga0495642_0000137
899 Ga0495642_0000441
900 Ga0495642_0008116
901 Ga0495642_0078480
902 Ga0495642_0078486
903 Ga0495652_0032797
904 Ga0495652_0059389
905 Ga0495652_0168519
906 Ga0495654_0016492
907 Ga0495654_0018321
908 Ga0495654_0046435
909 Ga0495665_0003160
910 Ga0495665_0086043
911 Ga0495640_0017785
912 Ga0495586_0024037
913 Ga0495586_0039610
914 Ga0495587_0027700
915 Ga0495609_0000110
916 Ga0495609_0001214
917 Ga0495609_0001479
918 Ga0495609_0007094
919 Ga0495609_0016742
920 Ga0495609_0034455
921 Ga0495609_0052357
922 Ga0495609_0146642
923 Ga0495621_0071983
924 Ga0495597_0000284
925 Ga0495597_0000682
926 Ga0495597_0001719
927 Ga0495597_0110870
928 Ga0495597_0162384
929 Ga0495645_0022671
930 Ga0495645_0048441
931 Ga0495622_0012657
932 Ga0495622_0131601
933 Ga0495633_0001718
934 Ga0495633_0002489
935 Ga0495633_0004979
936 Ga0495633_0007515
937 Ga0495633_0012965
938 Ga0495633_0013456
939 Ga0495633_0071649
940 Ga0495633_0152091
941 Ga0495633_0153392
942 Ga0495633_0199600
943 Ga0495656_0029366
944 Ga0495668_0000018
945 Ga0495668_0000240
946 Ga0495668_0000962
947 Ga0495668_0006047
948 Ga0495668_0007753
949 Ga0495668_0021842
950 Ga0495668_0072528
951 Ga0495668_0131722
952 Ga0495668_0232504
953 Ga0495668_0305609
954 Ga0495611_0000271
955 Ga0495611_0000479
956 Ga0495611_0016841
957 Ga0495611_0023459
958 Ga0495611_0028955
959 Ga0495611_0052234
960 Ga0495611_0133108
961 Ga0495625_0001599
962 Ga0495625_0002213
963 Ga0495625_0005751
964 Ga0495625_0035469
965 Ga0495625_0039242
966 Ga0495635_0013914
967 Ga0495635_0392633
968 Ga0495659_0000478
969 Ga0495659_0000547
970 Ga0495659_0020425
971 Ga0495659_0044438
972 Ga0495661_0000549
973 Ga0495661_0001822
974 Ga0495661_0002589
975 Ga0495661_0013656
976 Ga0495661_0021584
977 Ga0495661_0028733
978 Ga0495661_0028948
979 Ga0495661_0084832
980 Ga0495661_0135526
981 Ga0495588_0040264
982 Ga0495588_0053733
983 Ga0495588_0148345
984 Ga0495623_0000991
985 Ga0495623_0076211
986 Ga0495623_0223277
987 Ga0495646_0049946
988 Ga0495669_0000073
989 Ga0495669_0000315
990 Ga0495669_0001109
991 Ga0495613_0060482
992 Ga0495613_0172752
993 Ga0495624_0014255
994 Ga0495624_0029666
995 Ga0495670_0000355
996 Ga0495670_0000576
997 Ga0495670_0000763
998 Ga0495670_0011039
999 Ga0495670_0011580
1000 Ga0495670_0018084
1001 Ga0495670_0044216
1002 Ga0495670_0067436
1003 Ga0495670_0168013
1004 Ga0495670_0569263
1005 Ga0495671_0001538
1006 Ga0495671_0041323
1007 Ga0495671_0042745
1008 Ga0495671_0048827
1009 Ga0495671_0049263
1010 Ga0495649_0000291
1011 Ga0495649_0006056
1012 Ga0495649_0177383
1013 Ga0495649_0218626
1014 Ga0495589_0000905
1015 Ga0495589_0018929
1016 Ga0495589_0028541
1017 Ga0495589_0105738
1018 Ga0495589_0227776
1019 Ga0495600_0075535
1020 Ga0495600_0270461
1021 Ga0495660_0000470
1022 Ga0495660_0069406
1023 Ga0495660_0069540
1024 Ga0495660_0072346
1025 Ga0495660_0127896
1026 Ga0495581_0029372
1027 Ga0495581_0046968
1028 Ga0495604_0004660
1029 Ga0495604_0006448
1030 Ga0495604_0043297
1031 Ga0495636_0000414
1032 Ga0495636_0001341
1033 Ga0495636_0002533
1034 Ga0495636_0017160
1035 Ga0495636_0041335
1036 Ga0495636_0067110
1037 Ga0495636_0118799
1038 Ga0495672_0000066
1039 Ga0495672_0000135
1040 Ga0495672_0002864
1041 Ga0495672_0014181
1042 Ga0495672_0240736
1043 Ga0495680_0032849
1044 Ga0495680_0163949
1045 Ga0495680_0285128
1046 Ga0495683_0000133
1047 Ga0495683_0001638
1048 Ga0495683_0004123
1049 Ga0495683_0011568
1050 Ga0495683_0103766
1051 Ga0495683_0138837
1052 Ga0495687_000030
1053 Ga0495687_000374
1054 Ga0495687_002366
1055 Ga0495687_004366
1056 Ga0495687_054467
1057 Ga0495675_0018114
1058 Ga0495675_0030169
1059 Ga0495675_0095315
1060 Ga0495677_0000387
1061 Ga0495677_0002991
1062 Ga0495677_0004187
1063 Ga0495677_0007503
1064 Ga0495677_0007754
1065 Ga0495677_0010425
1066 Ga0495677_0032258
1067 Ga0495677_0316446
1068 Ga0495679_030949
1069 Ga0495679_049662
1070 Ga0495679_068151
1071 Ga0495685_000011
1072 Ga0495685_000539
1073 Ga0495673_0000035
1074 Ga0495673_0010958
1075 Ga0495673_0031534
1076 Ga0495673_0063314
1077 Ga0495681_0000864
1078 Ga0495681_0002025
1079 Ga0495681_0005144
1080 Ga0495681_0017148
1081 Ga0495681_0019937
1082 Ga0495681_0053395
1083 Ga0495681_0074842
1084 Ga0495681_0242339
1085 Ga0495681_0273146
1086 Ga0495686_0000290
1087 Ga0495686_0000802
1088 Ga0495686_0008599
1089 Ga0495686_0029885
1090 Ga0495593_0023146
1091 Ga0495614_0003706
1092 Ga0495614_0014600
1093 Ga0495615_0171303
1094 Ga0495626_0003232
1095 Ga0495626_0009512
1096 Ga0495626_0037188
1097 Ga0495626_0038004
1098 Ga0495626_0074361
1099 Ga0495626_0083168
1100 Ga0495626_0101612
1101 Ga0495626_0107446
1102 Ga0495626_0139023
1103 Ga0496100_0132944
1104 Ga0496100_0311337
1105 Ga0496101_0025139
1106 Ga0496102_0000150
1107 Ga0496102_0002351
1108 Ga0496102_0020140
1109 Ga0496102_0129773
1110 Ga0496102_0135694
1111 Ga0496102_0907323
1112 Ga0496103_0012424
1113 Ga0496103_0128382
1114 Ga0496105_0454678
1115 Ga0496106_0084552
1116 Ga0496107_0082563
1117 Ga0496108_0793925
1118 Ga0496108_0927752
1119 Ga0496109_0019715
1120 Ga0496109_0299139
1121 Ga0496110_0000462
1122 Ga0496110_0266770
1123 Ga0496112_0936729
1124 Ga0496113_0099945
1125 Ga0496113_0429224
1126 Ga0496115_0199749
1127 Ga0496121_0027483
1128 Ga0496122_0001744
1129 Ga0496123_0013972
1130 Ga0496124_0023330
1131 Ga0496124_0119587
1132 Ga0496125_0017792
1133 Ga0495678_000002
1134 Ga0495678_000190
1135 Ga0495678_000831
1136 Ga0495678_002497
1137 Ga0495678_003814
1138 Ga0495678_036083
1139 Ga0495678_055558
1140 Ga0495682_0000199
1141 Ga0495682_0001816
1142 Ga0495682_0016499
1143 Ga0495682_0065246
1144 Ga0501222_013360
1145 Ga0501269_014057
1146 Ga0501279_008635
1147 Ga0501279_062250
1148 Ga0500572_056231
1149 Ga0500594_0004952
1150 Ga0500595_023498
1151 Ga0500574_000678
1152 Ga0500619_001205
1153 2643790772
1154 2644211694
1155 2644251348
1156 2644357451
1157 2738740046
1158 2738844198
1159 2739274242
1160 2739343286
1161 2819540777
1162 2904425654

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04290

DctQ

Tripartite ATP-independent periplasmic transporters, DctQ component

49

182

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
7qha-assembly1.cif.gz_A cryo-em structure of the tripartite atp-independent periplasmic (trap) transporter siaqm from photobacterium profundum in amphipol 0.8079 31 180
7qha-assembly1.cif.gz_A cryo-em structure of the tripartite atp-independent periplasmic (trap) transporter siaqm from photobacterium profundum in amphipol 0.7623 31 180
8thj-assembly1.cif.gz_B cryo-em structure of the tripartite atp-independent periplasmic (trap) transporter siaqm from haemophilus influenzae (antiparallel dimer) 0.76 30 190
8thj-assembly1.cif.gz_B cryo-em structure of the tripartite atp-independent periplasmic (trap) transporter siaqm from haemophilus influenzae (antiparallel dimer) 0.6499 30 190
4wpc-assembly1.cif.gz_B crystal structure of rgd1p f-bar domain in complex with inositol phosphate 0.4027 20 190
ID Description Score Start End Superfamily
af_P37674_16_146_1.20.120.550 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Membrane associated eicosanoid/glutathione metabolism-like domain 0.861 47 178 1.20.120.550
af_P37674_16_146_1.20.120.550 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Membrane associated eicosanoid/glutathione metabolism-like domain 0.8435 47 178 1.20.120.550
af_Q9W3L1_56_363_1.25.40.180 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat; 0.7 23 91 1.25.40.180
af_Q9VDT4_85_169_1.20.120.550 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Membrane associated eicosanoid/glutathione metabolism-like domain 0.6686 17 91 1.20.120.550
af_Q9VDT4_85_169_1.20.120.550 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Membrane associated eicosanoid/glutathione metabolism-like domain 0.5141 17 91 1.20.120.550
ID Description Score Start End GO Terms
AF-A0A661KE21-F1-model_v4 TRAP transporter small permease 0.9352 20 174 GO:0005886
GO:0015740
GO:0022857
AF-A0A7Z8LMW6-F1-model_v4 deleted 0.9292 20 178
AF-A0A1M7HH59-F1-model_v4 TRAP transporter small permease protein 0.9288 20 174 GO:0005886
GO:0015740
GO:0022857
AF-A0A259L5A4-F1-model_v4 TRAP transporter small permease protein 0.926 17 177 GO:0005886
GO:0015740
GO:0022857
AF-A0A7S9CZY3-F1-model_v4 TRAP transporter small permease protein 0.9241 19 173 GO:0005886
GO:0015740
GO:0022857

Map