F466102
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 581 | 249 | 1162 | 182 |
Family's Representative Sequence
| Representative Sequence | 3300046680|Ga0495646_0016234|Ga0495646_0016234_3093_3692 |
| Length | 199 |
| Sequence | MSHGFDAKPNAGPVLPAIPDHPAVAVLARVLERFNKLALYLSMAALMLTALIMTYSVVARYFFHVPSDWQDDATVFMLVGVIFLCAAYAQSYRGHIGIEALASILPAAVNTVRLLLVDLVSFVFCGFFSWKSWALFHEAWSEGQTTSSTFAPPLWIPYSLMALGMTALTLQLLVQVLARLTDRGMVADSKTDLQTVSGE |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 2 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 3 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 4 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 5 | 3300002739 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA | Metagenome | Endosphere |
| 6 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 7 | 3300002772 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS | Metagenome | Endosphere |
| 8 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 9 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 10 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 11 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 12 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 13 | 3300003374 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF | Metagenome | Endosphere |
| 14 | 3300003751 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 | Metagenome | Endosphere |
| 15 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 16 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 17 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 18 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 19 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 20 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 21 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 22 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 23 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 24 | 3300003841 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 25 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 26 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 27 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 28 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 30 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 32 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 34 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 43 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 44 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 47 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 48 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 49 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 50 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 51 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 52 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 53 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 54 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 55 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 56 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 57 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 58 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 59 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 60 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 61 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 62 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 63 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 64 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 65 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 66 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 67 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 68 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 69 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 70 | 3300025206 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) | Metagenome | Unclassified |
| 71 | 3300025207 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 72 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 73 | 3300025224 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 74 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 75 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 76 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 77 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 78 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 79 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 80 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 81 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 82 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 83 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 84 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 85 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 86 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 87 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 88 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 89 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 90 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 91 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 92 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 93 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 94 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 95 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 96 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 127 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 128 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 129 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 130 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 131 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 132 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 133 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 134 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 135 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 136 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 137 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 138 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 139 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 140 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 141 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 142 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 143 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 144 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 145 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 146 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 147 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 148 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 149 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 150 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 151 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 152 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 153 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 154 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 155 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 156 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 157 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 158 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 159 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 160 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 161 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 164 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 166 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 213 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 214 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 215 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 216 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 217 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 218 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 219 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 220 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 221 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 222 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 223 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 224 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 225 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 226 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 227 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 228 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 229 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 230 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300049662 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control | Metagenome | Rhizosphere |
| 233 | 3300049766 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought | Metagenome | Rhizosphere |
| 234 | 3300049775 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought | Metagenome | Rhizosphere |
| 235 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 236 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 237 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 238 | 3300053141 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere | Metagenome | Endosphere |
| 239 | 3300053154 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere | Metagenome | Endosphere |
| 240 | 2643221554 | Duganella sp. Root1480D1 | Isolate | Unclassified |
| 241 | 2643221638 | Duganella sp. Root336D2 | Isolate | Unclassified |
| 242 | 2643221645 | Massilia sp. Root351 | Isolate | Unclassified |
| 243 | 2643221664 | Massilia sp. Root418 | Isolate | Unclassified |
| 244 | 2738541280 | Massilia sp. GV090 | Isolate | Unclassified |
| 245 | 2738541300 | Massilia sp. GV016 | Isolate | Unclassified |
| 246 | 2738543018 | Massilia sp. GV045 | Isolate | Unclassified |
| 247 | 2738543030 | Massilia sp. GV097 | Isolate | Unclassified |
| 248 | 2818991436 | Collimonas arenae 515 | Isolate | Unclassified |
| 249 | 2904424332 | Duganella sp. 1411 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.28 |
| Metatranscriptomes | 0 |
| Isolates | 1.72 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 14.97 |
| Nodule | 0 |
| Rhizoplane | 4.13 |
| Rhizosphere | 76.76 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.17 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0495646_0016234 | 3300046680 | Bacteria | 4727 |
| 2 | JGI25156J39149_1003286 | 3300002705 | Bacteria | 5357 |
| 3 | JGI25162J39368_1000015 | 3300002737 | Bacteria | 316381 |
| 4 | JGI25154J39366_1002712 | 3300002738 | Bacteria | 4310 |
| 5 | JGI25158J39367_1000644 | 3300002739 | Bacteria | 6883 |
| 6 | JGI25158J39367_1002306 | 3300002739 | Bacteria | 3137 |
| 7 | JGI25157J39369_1017044 | 3300002741 | Bacteria | 884 |
| 8 | JGI25164J39214_1003153 | 3300002772 | Bacteria | 2184 |
| 9 | JGI25152J39213_1000242 | 3300002773 | Bacteria | 36400 |
| 10 | JGI25152J39213_1007466 | 3300002773 | Bacteria | 2827 |
| 11 | JGI25150J39212_1000335 | 3300002774 | Bacteria | 23131 |
| 12 | JGI25150J39212_1021055 | 3300002774 | Bacteria | 997 |
| 13 | JGI25159J45721_1001941 | 3300002987 | Bacteria | 8241 |
| 14 | JGI25159J45721_1002166 | 3300002987 | Bacteria | 7649 |
| 15 | JGI25165J46597_1000001 | 3300003214 | Bacteria | 1111887 |
| 16 | rootH1_10180508 | 3300003323 | Bacteria | 1235 |
| 17 | JGI25161J50226_1000166 | 3300003374 | Bacteria | 45462 |
| 18 | Ga0055538_1000001 | 3300003751 | Bacteria | 1111887 |
| 19 | Ga0055539_1000001 | 3300003752 | Bacteria | 1111887 |
| 20 | Ga0055533_1000003 | 3300003756 | Bacteria | 1111887 |
| 21 | Ga0055525_1000003 | 3300003759 | Bacteria | 962094 |
| 22 | Ga0055526_1000061 | 3300003771 | Bacteria | 106054 |
| 23 | Ga0055526_1000418 | 3300003771 | Bacteria | 34250 |
| 24 | Ga0055526_1000602 | 3300003771 | Bacteria | 28135 |
| 25 | Ga0055537_1003151 | 3300003773 | Bacteria | 5164 |
| 26 | Ga0055537_1017949 | 3300003773 | Bacteria | 1146 |
| 27 | Ga0055537_1021544 | 3300003773 | Bacteria | 956 |
| 28 | Ga0055524_1000223 | 3300003775 | Bacteria | 60211 |
| 29 | Ga0055524_1000861 | 3300003775 | Bacteria | 19849 |
| 30 | Ga0055524_1010125 | 3300003775 | Bacteria | 3776 |
| 31 | Ga0055524_1034421 | 3300003775 | Bacteria | 1401 |
| 32 | Ga0055534_1000351 | 3300003784 | Bacteria | 29531 |
| 33 | Ga0055534_1034154 | 3300003784 | Bacteria | 772 |
| 34 | Ga0055528_1000036 | 3300003790 | Bacteria | 116393 |
| 35 | Ga0055528_1020648 | 3300003790 | Bacteria | 2131 |
| 36 | Ga0055530_10000262 | 3300003791 | Bacteria | 47466 |
| 37 | Ga0055541_1000001 | 3300003841 | Bacteria | 1111887 |
| 38 | Ga0055543_1000063 | 3300004625 | Bacteria | 98011 |
| 39 | Ga0055543_1010078 | 3300004625 | Bacteria | 1998 |
| 40 | Ga0065165_1000612 | 3300005262 | Bacteria | 51854 |
| 41 | Ga0065165_1001278 | 3300005262 | Bacteria | 28419 |
| 42 | Ga0065715_10017199 | 3300005293 | Bacteria | 3043 |
| 43 | Ga0070676_10000460 | 3300005328 | Bacteria | 19460 |
| 44 | Ga0070690_100097669 | 3300005330 | Bacteria | 1943 |
| 45 | Ga0070670_100024282 | 3300005331 | Bacteria | 5215 |
| 46 | Ga0068869_100003214 | 3300005334 | Bacteria | 9985 |
| 47 | Ga0070666_10000439 | 3300005335 | Bacteria | 25357 |
| 48 | Ga0068868_100004899 | 3300005338 | Bacteria | 9401 |
| 49 | Ga0070668_100000714 | 3300005347 | Bacteria | 22756 |
| 50 | Ga0070669_100000685 | 3300005353 | Bacteria | 24802 |
| 51 | Ga0070675_100000769 | 3300005354 | Bacteria | 22360 |
| 52 | Ga0070671_100039288 | 3300005355 | Bacteria | 3928 |
| 53 | Ga0070674_100001488 | 3300005356 | Bacteria | 12489 |
| 54 | Ga0070673_100001967 | 3300005364 | Bacteria | 12390 |
| 55 | Ga0070667_100001175 | 3300005367 | Bacteria | 23800 |
| 56 | Ga0070678_100000294 | 3300005456 | Bacteria | 23120 |
| 57 | Ga0068867_100000643 | 3300005459 | Bacteria | 23109 |
| 58 | Ga0070685_10004609 | 3300005466 | Bacteria | 6975 |
| 59 | Ga0070672_100000479 | 3300005543 | Bacteria | 23258 |
| 60 | Ga0070665_100004149 | 3300005548 | Bacteria | 15244 |
| 61 | Ga0068854_100863193 | 3300005578 | Bacteria | 793 |
| 62 | Ga0068859_100016181 | 3300005617 | Bacteria | 7492 |
| 63 | Ga0068864_100001326 | 3300005618 | Bacteria | 20588 |
| 64 | Ga0068861_100009480 | 3300005719 | Bacteria | 6723 |
| 65 | Ga0068851_10082164 | 3300005834 | Bacteria | 1684 |
| 66 | Ga0068863_100001375 | 3300005841 | Bacteria | 24143 |
| 67 | Ga0068858_100001028 | 3300005842 | Bacteria | 28803 |
| 68 | Ga0068860_100015302 | 3300005843 | Bacteria | 7492 |
| 69 | Ga0068862_100526768 | 3300005844 | Bacteria | 1125 |
| 70 | Ga0097621_100001008 | 3300006237 | Bacteria | 19831 |
| 71 | Ga0068871_100009136 | 3300006358 | Bacteria | 7163 |
| 72 | Ga0068865_100005487 | 3300006881 | Bacteria | 7694 |
| 73 | Ga0068865_100288487 | 3300006881 | Bacteria | 1309 |
| 74 | Ga0097620_100016180 | 3300006931 | Bacteria | 7492 |
| 75 | Ga0105240_10338283 | 3300009093 | Bacteria | 1710 |
| 76 | Ga0105243_10786438 | 3300009148 | Bacteria | 936 |
| 77 | Ga0105241_10693363 | 3300009174 | Bacteria | 929 |
| 78 | Ga0105239_10104239 | 3300010375 | Bacteria | 3140 |
| 79 | Ga0105239_10860001 | 3300010375 | Bacteria | 1040 |
| 80 | Ga0157374_10007694 | 3300013296 | Bacteria | 9200 |
| 81 | Ga0157378_10106893 | 3300013297 | Bacteria | 2560 |
| 82 | Ga0157380_10164792 | 3300014326 | Bacteria | 1930 |
| 83 | Ga0182006_1006579 | 3300015261 | Bacteria | 5384 |
| 84 | Ga0182007_10038828 | 3300015262 | Bacteria | 1595 |
| 85 | Ga0182005_1000522 | 3300015265 | Bacteria | 19636 |
| 86 | Ga0163161_10006917 | 3300017792 | Bacteria | 7846 |
| 87 | Ga0209435_100181 | 3300025206 | Bacteria | 18859 |
| 88 | Ga0209760_104522 | 3300025207 | Bacteria | 1188 |
| 89 | Ga0209436_100056 | 3300025208 | Bacteria | 61172 |
| 90 | Ga0209436_103176 | 3300025208 | Bacteria | 4490 |
| 91 | Ga0209436_107064 | 3300025208 | Bacteria | 2394 |
| 92 | Ga0209784_100004 | 3300025224 | Bacteria | 1378156 |
| 93 | Ga0209566_100004 | 3300025225 | Bacteria | 1531866 |
| 94 | Ga0209674_100006 | 3300025226 | Bacteria | 1531866 |
| 95 | Ga0209563_100009 | 3300025230 | Bacteria | 1378156 |
| 96 | Ga0207427_101473 | 3300025231 | Bacteria | 8475 |
| 97 | Ga0209437_100004 | 3300025233 | Bacteria | 1378156 |
| 98 | Ga0207425_1000001 | 3300025245 | Bacteria | 2525432 |
| 99 | Ga0207425_1000039 | 3300025245 | Bacteria | 219078 |
| 100 | Ga0209646_1000173 | 3300025246 | Bacteria | 84706 |
| 101 | Ga0209026_1006724 | 3300025250 | Bacteria | 2751 |
| 102 | Ga0209677_100005 | 3300025253 | Bacteria | 1378156 |
| 103 | Ga0209759_1000224 | 3300025256 | Bacteria | 84649 |
| 104 | Ga0209129_1000001 | 3300025258 | Bacteria | 1452436 |
| 105 | Ga0209129_1005425 | 3300025258 | Bacteria | 4521 |
| 106 | Ga0209233_1000005 | 3300025261 | Bacteria | 1531866 |
| 107 | Ga0209565_1000017 | 3300025263 | Bacteria | 462438 |
| 108 | Ga0209565_1000998 | 3300025263 | Bacteria | 14541 |
| 109 | Ga0209565_1001338 | 3300025263 | Bacteria | 11213 |
| 110 | Ga0209565_1001557 | 3300025263 | Bacteria | 9815 |
| 111 | Ga0209565_1006500 | 3300025263 | Bacteria | 3270 |
| 112 | Ga0209673_1000007 | 3300025273 | Bacteria | 634477 |
| 113 | Ga0209673_1005138 | 3300025273 | Bacteria | 6697 |
| 114 | Ga0209130_1000078 | 3300025284 | Bacteria | 169374 |
| 115 | Ga0209130_1000128 | 3300025284 | Bacteria | 123595 |
| 116 | Ga0209130_1005348 | 3300025284 | Bacteria | 4490 |
| 117 | Ga0209675_1000009 | 3300025291 | Bacteria | 562872 |
| 118 | Ga0209675_1002200 | 3300025291 | Bacteria | 10218 |
| 119 | Ga0209564_1000036 | 3300025295 | Bacteria | 423455 |
| 120 | Ga0209564_1000055 | 3300025295 | Bacteria | 343782 |
| 121 | Ga0209564_1000089 | 3300025295 | Bacteria | 249694 |
| 122 | Ga0209564_1000109 | 3300025295 | Bacteria | 212912 |
| 123 | Ga0209564_1005064 | 3300025295 | Bacteria | 7695 |
| 124 | Ga0209564_1005305 | 3300025295 | Bacteria | 7425 |
| 125 | Ga0209564_1012464 | 3300025295 | Bacteria | 3707 |
| 126 | Ga0209758_1000020 | 3300025297 | Bacteria | 734220 |
| 127 | Ga0209050_1000074 | 3300025298 | Bacteria | 289334 |
| 128 | Ga0209050_1000628 | 3300025298 | Bacteria | 55015 |
| 129 | Ga0209256_1000028 | 3300025299 | Bacteria | 420213 |
| 130 | Ga0209256_1000167 | 3300025299 | Bacteria | 133419 |
| 131 | Ga0209256_1000621 | 3300025299 | Bacteria | 48888 |
| 132 | Ga0207426_1001909 | 3300025302 | Bacteria | 15069 |
| 133 | Ga0207426_1059131 | 3300025302 | Bacteria | 1109 |
| 134 | Ga0207426_1064711 | 3300025302 | Bacteria | 1039 |
| 135 | Ga0209257_1000003 | 3300025304 | Bacteria | 1702593 |
| 136 | Ga0209257_1001374 | 3300025304 | Bacteria | 29209 |
| 137 | Ga0207697_10008562 | 3300025315 | Bacteria | 4468 |
| 138 | Ga0207656_10138751 | 3300025321 | Bacteria | 1144 |
| 139 | Ga0207682_10131734 | 3300025893 | Bacteria | 1116 |
| 140 | Ga0207680_10000461 | 3300025903 | Bacteria | 19199 |
| 141 | Ga0207645_10000534 | 3300025907 | Bacteria | 31590 |
| 142 | Ga0207643_10133245 | 3300025908 | Bacteria | 1480 |
| 143 | Ga0207654_10606376 | 3300025911 | Unclassified | 781 |
| 144 | Ga0207681_10000530 | 3300025923 | Bacteria | 26366 |
| 145 | Ga0207650_10077415 | 3300025925 | Bacteria | 2514 |
| 146 | Ga0207659_10000248 | 3300025926 | Bacteria | 32815 |
| 147 | Ga0207644_10018482 | 3300025931 | Bacteria | 4717 |
| 148 | Ga0207709_10419682 | 3300025935 | Bacteria | 1027 |
| 149 | Ga0207669_10006845 | 3300025937 | Bacteria | 5243 |
| 150 | Ga0207704_10000684 | 3300025938 | Bacteria | 15001 |
| 151 | Ga0207704_10514165 | 3300025938 | Bacteria | 967 |
| 152 | Ga0207691_10000022 | 3300025940 | Bacteria | 132936 |
| 153 | Ga0207711_10014269 | 3300025941 | Bacteria | 6600 |
| 154 | Ga0207689_10001287 | 3300025942 | Bacteria | 24173 |
| 155 | Ga0207651_10009349 | 3300025960 | Bacteria | 5359 |
| 156 | Ga0207668_10005408 | 3300025972 | Bacteria | 7521 |
| 157 | Ga0207658_10000311 | 3300025986 | Bacteria | 49445 |
| 158 | Ga0207677_10002948 | 3300026023 | Bacteria | 8989 |
| 159 | Ga0207703_10010184 | 3300026035 | Bacteria | 7368 |
| 160 | Ga0207641_10001378 | 3300026088 | Bacteria | 23986 |
| 161 | Ga0207648_10001109 | 3300026089 | Bacteria | 30196 |
| 162 | Ga0207676_10042365 | 3300026095 | Bacteria | 3501 |
| 163 | Ga0207675_100014096 | 3300026118 | Bacteria | 7453 |
| 164 | Ga0207683_10000108 | 3300026121 | Bacteria | 66917 |
| 165 | Ga0268266_10074453 | 3300028379 | Bacteria | 2948 |
| 166 | Ga0268265_10311714 | 3300028380 | Bacteria | 1421 |
| 167 | Ga0268265_10803643 | 3300028380 | Bacteria | 917 |
| 168 | Ga0268264_10002130 | 3300028381 | Bacteria | 17661 |
| 169 | Ga0307515_10145879 | 3300028794 | Bacteria | 2507 |
| 170 | Ga0307408_100000126 | 3300031548 | Bacteria | 84345 |
| 171 | Ga0307408_100003761 | 3300031548 | Bacteria | 10329 |
| 172 | Ga0307408_100082143 | 3300031548 | Bacteria | 2411 |
| 173 | Ga0265314_10041691 | 3300031711 | Bacteria | 3282 |
| 174 | Ga0395905_0015518 | 3300037471 | Bacteria | 7240 |
| 175 | Ga0395905_0166240 | 3300037471 | Bacteria | 2073 |
| 176 | Ga0395901_0521281 | 3300038443 | Bacteria | 1207 |
| 177 | Ga0451577_0830818 | 3300042876 | Bacteria | 834 |
| 178 | Ga0495617_000027 | 3300046452 | Bacteria | 157385 |
| 179 | Ga0495617_001868 | 3300046452 | Bacteria | 8892 |
| 180 | Ga0495617_006722 | 3300046452 | Bacteria | 4020 |
| 181 | Ga0495617_025891 | 3300046452 | Bacteria | 1976 |
| 182 | Ga0495627_000001 | 3300046453 | Bacteria | 1104709 |
| 183 | Ga0495627_000277 | 3300046453 | Bacteria | 51556 |
| 184 | Ga0495603_0087215 | 3300046455 | Bacteria | 1826 |
| 185 | Ga0495591_000500 | 3300046458 | Bacteria | 30952 |
| 186 | Ga0495591_058398 | 3300046458 | Bacteria | 1031 |
| 187 | Ga0495629_0417096 | 3300046459 | Bacteria | 911 |
| 188 | Ga0495638_0012397 | 3300046460 | Bacteria | 5845 |
| 189 | Ga0495638_0023529 | 3300046460 | Bacteria | 4028 |
| 190 | Ga0495638_0197927 | 3300046460 | Bacteria | 1136 |
| 191 | Ga0495651_0001090 | 3300046462 | Bacteria | 20913 |
| 192 | Ga0495651_0077368 | 3300046462 | Bacteria | 2518 |
| 193 | Ga0495653_0012739 | 3300046463 | Bacteria | 6868 |
| 194 | Ga0495653_0035107 | 3300046463 | Bacteria | 3959 |
| 195 | Ga0495653_0044779 | 3300046463 | Bacteria | 3433 |
| 196 | Ga0495650_0000019 | 3300046471 | Bacteria | 533849 |
| 197 | Ga0495650_0006569 | 3300046471 | Bacteria | 7229 |
| 198 | Ga0495650_0034066 | 3300046471 | Bacteria | 2259 |
| 199 | Ga0495650_0127708 | 3300046471 | Bacteria | 930 |
| 200 | Ga0495582_0044368 | 3300046473 | Bacteria | 2448 |
| 201 | Ga0495605_0000135 | 3300046474 | Bacteria | 95104 |
| 202 | Ga0495605_0011545 | 3300046474 | Bacteria | 4919 |
| 203 | Ga0495605_0049768 | 3300046474 | Bacteria | 2046 |
| 204 | Ga0495605_0066718 | 3300046474 | Bacteria | 1708 |
| 205 | Ga0495605_0110249 | 3300046474 | Bacteria | 1256 |
| 206 | Ga0495605_0201686 | 3300046474 | Bacteria | 866 |
| 207 | Ga0495584_0000002 | 3300046491 | Bacteria | 512179 |
| 208 | Ga0495584_0000300 | 3300046491 | Bacteria | 34910 |
| 209 | Ga0495584_0000700 | 3300046491 | Bacteria | 22162 |
| 210 | Ga0495584_0002291 | 3300046491 | Bacteria | 10919 |
| 211 | Ga0495584_0004911 | 3300046491 | Bacteria | 7135 |
| 212 | Ga0495584_0025777 | 3300046491 | Bacteria | 2981 |
| 213 | Ga0495584_0166207 | 3300046491 | Bacteria | 1121 |
| 214 | Ga0495584_0327096 | 3300046491 | Bacteria | 778 |
| 215 | Ga0495585_0000002 | 3300046492 | Bacteria | 529316 |
| 216 | Ga0495585_0001198 | 3300046492 | Bacteria | 21099 |
| 217 | Ga0495585_0001944 | 3300046492 | Bacteria | 15432 |
| 218 | Ga0495585_0008560 | 3300046492 | Bacteria | 6196 |
| 219 | Ga0495585_0010157 | 3300046492 | Bacteria | 5622 |
| 220 | Ga0495585_0013244 | 3300046492 | Bacteria | 4831 |
| 221 | Ga0495585_0028547 | 3300046492 | Bacteria | 3181 |
| 222 | Ga0495585_0028571 | 3300046492 | Bacteria | 3180 |
| 223 | Ga0495585_0070103 | 3300046492 | Bacteria | 1912 |
| 224 | Ga0495585_0161249 | 3300046492 | Bacteria | 1163 |
| 225 | Ga0495585_0178326 | 3300046492 | Bacteria | 1093 |
| 226 | Ga0495585_0377273 | 3300046492 | Bacteria | 685 |
| 227 | Ga0495594_0045191 | 3300046499 | Bacteria | 2417 |
| 228 | Ga0495594_0078810 | 3300046499 | Bacteria | 1838 |
| 229 | Ga0495594_0091010 | 3300046499 | Bacteria | 1709 |
| 230 | Ga0495596_0002268 | 3300046500 | Bacteria | 10461 |
| 231 | Ga0495596_0002981 | 3300046500 | Bacteria | 8782 |
| 232 | Ga0495596_0005474 | 3300046500 | Bacteria | 5991 |
| 233 | Ga0495596_0010381 | 3300046500 | Bacteria | 4056 |
| 234 | Ga0495596_0020324 | 3300046500 | Bacteria | 2720 |
| 235 | Ga0495596_0025356 | 3300046500 | Bacteria | 2396 |
| 236 | Ga0495607_0000264 | 3300046501 | Bacteria | 56345 |
| 237 | Ga0495607_0004462 | 3300046501 | Bacteria | 10268 |
| 238 | Ga0495607_0007161 | 3300046501 | Bacteria | 7750 |
| 239 | Ga0495607_0019919 | 3300046501 | Bacteria | 4250 |
| 240 | Ga0495607_0030417 | 3300046501 | Bacteria | 3315 |
| 241 | Ga0495607_0042270 | 3300046501 | Bacteria | 2702 |
| 242 | Ga0495607_0061549 | 3300046501 | Bacteria | 2132 |
| 243 | Ga0495607_0132440 | 3300046501 | Bacteria | 1295 |
| 244 | Ga0495607_0141317 | 3300046501 | Bacteria | 1241 |
| 245 | Ga0495583_0000009 | 3300046506 | Bacteria | 372527 |
| 246 | Ga0495583_0000026 | 3300046506 | Bacteria | 256777 |
| 247 | Ga0495583_0000067 | 3300046506 | Bacteria | 189381 |
| 248 | Ga0495583_0002853 | 3300046506 | Bacteria | 14060 |
| 249 | Ga0495583_0006773 | 3300046506 | Bacteria | 7406 |
| 250 | Ga0495583_0026944 | 3300046506 | Bacteria | 2842 |
| 251 | Ga0495583_0027182 | 3300046506 | Bacteria | 2826 |
| 252 | Ga0495583_0035591 | 3300046506 | Bacteria | 2375 |
| 253 | Ga0495583_0035773 | 3300046506 | Bacteria | 2367 |
| 254 | Ga0495583_0061227 | 3300046506 | Bacteria | 1680 |
| 255 | Ga0495583_0078445 | 3300046506 | Bacteria | 1438 |
| 256 | Ga0495583_0088751 | 3300046506 | Bacteria | 1334 |
| 257 | Ga0495606_0002942 | 3300046507 | Bacteria | 18812 |
| 258 | Ga0495606_0039263 | 3300046507 | Bacteria | 3193 |
| 259 | Ga0495606_0043030 | 3300046507 | Bacteria | 3016 |
| 260 | Ga0495606_0147179 | 3300046507 | Bacteria | 1385 |
| 261 | Ga0495608_0040595 | 3300046511 | Bacteria | 3117 |
| 262 | Ga0495610_0001136 | 3300046512 | Bacteria | 24193 |
| 263 | Ga0495616_0000333 | 3300046513 | Bacteria | 37273 |
| 264 | Ga0495616_0000531 | 3300046513 | Bacteria | 28814 |
| 265 | Ga0495616_0000713 | 3300046513 | Bacteria | 24644 |
| 266 | Ga0495616_0003242 | 3300046513 | Bacteria | 10468 |
| 267 | Ga0495616_0006338 | 3300046513 | Bacteria | 7173 |
| 268 | Ga0495616_0013282 | 3300046513 | Bacteria | 4651 |
| 269 | Ga0495616_0032517 | 3300046513 | Bacteria | 2724 |
| 270 | Ga0495616_0035360 | 3300046513 | Bacteria | 2586 |
| 271 | Ga0495616_0044971 | 3300046513 | Bacteria | 2237 |
| 272 | Ga0495616_0067563 | 3300046513 | Bacteria | 1737 |
| 273 | Ga0495616_0069051 | 3300046513 | Bacteria | 1714 |
| 274 | Ga0495618_0044788 | 3300046514 | Bacteria | 2790 |
| 275 | Ga0495628_0000935 | 3300046516 | Bacteria | 26746 |
| 276 | Ga0495628_0009156 | 3300046516 | Bacteria | 8466 |
| 277 | Ga0495628_0045760 | 3300046516 | Bacteria | 3478 |
| 278 | Ga0495631_0001148 | 3300046518 | Bacteria | 16396 |
| 279 | Ga0495631_0010095 | 3300046518 | Bacteria | 4690 |
| 280 | Ga0495631_0013306 | 3300046518 | Bacteria | 3995 |
| 281 | Ga0495631_0018738 | 3300046518 | Bacteria | 3254 |
| 282 | Ga0495631_0084952 | 3300046518 | Bacteria | 1363 |
| 283 | Ga0495631_0131035 | 3300046518 | Bacteria | 1077 |
| 284 | Ga0495632_0007007 | 3300046519 | Bacteria | 7150 |
| 285 | Ga0495632_0258328 | 3300046519 | Bacteria | 780 |
| 286 | Ga0495637_0000053 | 3300046520 | Bacteria | 99739 |
| 287 | Ga0495637_0026817 | 3300046520 | Bacteria | 2582 |
| 288 | Ga0495637_0074288 | 3300046520 | Bacteria | 1365 |
| 289 | Ga0495637_0164975 | 3300046520 | Bacteria | 829 |
| 290 | Ga0495643_0000121 | 3300046522 | Bacteria | 125932 |
| 291 | Ga0495643_0000285 | 3300046522 | Bacteria | 72233 |
| 292 | Ga0495643_0011896 | 3300046522 | Bacteria | 5271 |
| 293 | Ga0495643_0058593 | 3300046522 | Bacteria | 2049 |
| 294 | Ga0495643_0066182 | 3300046522 | Bacteria | 1906 |
| 295 | Ga0495643_0165404 | 3300046522 | Bacteria | 1085 |
| 296 | Ga0495644_0001029 | 3300046523 | Bacteria | 11616 |
| 297 | Ga0495644_0001033 | 3300046523 | Bacteria | 11590 |
| 298 | Ga0495644_0014976 | 3300046523 | Bacteria | 2969 |
| 299 | Ga0495644_0024082 | 3300046523 | Bacteria | 2315 |
| 300 | Ga0495644_0028378 | 3300046523 | Bacteria | 2118 |
| 301 | Ga0495644_0037727 | 3300046523 | Bacteria | 1823 |
| 302 | Ga0495644_0050851 | 3300046523 | Bacteria | 1556 |
| 303 | Ga0495644_0099588 | 3300046523 | Bacteria | 1099 |
| 304 | Ga0495644_0162451 | 3300046523 | Bacteria | 856 |
| 305 | Ga0495648_0000012 | 3300046524 | Bacteria | 294111 |
| 306 | Ga0495648_0000831 | 3300046524 | Bacteria | 32651 |
| 307 | Ga0495648_0005856 | 3300046524 | Bacteria | 10117 |
| 308 | Ga0495648_0034458 | 3300046524 | Bacteria | 3294 |
| 309 | Ga0495648_0065116 | 3300046524 | Bacteria | 2144 |
| 310 | Ga0495648_0094748 | 3300046524 | Bacteria | 1662 |
| 311 | Ga0495648_0120273 | 3300046524 | Bacteria | 1413 |
| 312 | Ga0495648_0127671 | 3300046524 | Bacteria | 1356 |
| 313 | Ga0495648_0227113 | 3300046524 | Bacteria | 916 |
| 314 | Ga0495648_0327505 | 3300046524 | Bacteria | 708 |
| 315 | Ga0495663_0009796 | 3300046525 | Bacteria | 2659 |
| 316 | Ga0495666_0000177 | 3300046526 | Bacteria | 27146 |
| 317 | Ga0495642_0000137 | 3300046528 | Bacteria | 42614 |
| 318 | Ga0495642_0000441 | 3300046528 | Bacteria | 21882 |
| 319 | Ga0495642_0008116 | 3300046528 | Bacteria | 4018 |
| 320 | Ga0495642_0078480 | 3300046528 | Bacteria | 1387 |
| 321 | Ga0495642_0078486 | 3300046528 | Bacteria | 1387 |
| 322 | Ga0495652_0032797 | 3300046529 | Bacteria | 4538 |
| 323 | Ga0495652_0059389 | 3300046529 | Bacteria | 3235 |
| 324 | Ga0495652_0168519 | 3300046529 | Bacteria | 1692 |
| 325 | Ga0495654_0016492 | 3300046530 | Bacteria | 3904 |
| 326 | Ga0495654_0018321 | 3300046530 | Bacteria | 3670 |
| 327 | Ga0495654_0046435 | 3300046530 | Bacteria | 2139 |
| 328 | Ga0495665_0003160 | 3300046531 | Bacteria | 8914 |
| 329 | Ga0495665_0086043 | 3300046531 | Bacteria | 1652 |
| 330 | Ga0495640_0017785 | 3300046533 | Bacteria | 5290 |
| 331 | Ga0495586_0024037 | 3300046535 | Bacteria | 3254 |
| 332 | Ga0495586_0039610 | 3300046535 | Bacteria | 2534 |
| 333 | Ga0495587_0027700 | 3300046536 | Bacteria | 3450 |
| 334 | Ga0495609_0000110 | 3300046538 | Bacteria | 96998 |
| 335 | Ga0495609_0001214 | 3300046538 | Bacteria | 17758 |
| 336 | Ga0495609_0001479 | 3300046538 | Bacteria | 15589 |
| 337 | Ga0495609_0007094 | 3300046538 | Bacteria | 5638 |
| 338 | Ga0495609_0016742 | 3300046538 | Bacteria | 3414 |
| 339 | Ga0495609_0034455 | 3300046538 | Bacteria | 2295 |
| 340 | Ga0495609_0052357 | 3300046538 | Bacteria | 1816 |
| 341 | Ga0495609_0146642 | 3300046538 | Bacteria | 1005 |
| 342 | Ga0495621_0071983 | 3300046539 | Bacteria | 1275 |
| 343 | Ga0495597_0000284 | 3300046542 | Bacteria | 45727 |
| 344 | Ga0495597_0000682 | 3300046542 | Bacteria | 27481 |
| 345 | Ga0495597_0001719 | 3300046542 | Bacteria | 15127 |
| 346 | Ga0495597_0110870 | 3300046542 | Bacteria | 1150 |
| 347 | Ga0495597_0162384 | 3300046542 | Bacteria | 911 |
| 348 | Ga0495645_0022671 | 3300046543 | Bacteria | 4543 |
| 349 | Ga0495645_0048441 | 3300046543 | Bacteria | 3095 |
| 350 | Ga0495622_0012657 | 3300046557 | Bacteria | 3910 |
| 351 | Ga0495622_0131601 | 3300046557 | Bacteria | 1139 |
| 352 | Ga0495633_0001718 | 3300046558 | Bacteria | 16399 |
| 353 | Ga0495633_0002489 | 3300046558 | Bacteria | 12983 |
| 354 | Ga0495633_0004979 | 3300046558 | Bacteria | 8288 |
| 355 | Ga0495633_0007515 | 3300046558 | Bacteria | 6261 |
| 356 | Ga0495633_0012965 | 3300046558 | Bacteria | 4410 |
| 357 | Ga0495633_0013456 | 3300046558 | Bacteria | 4311 |
| 358 | Ga0495633_0071649 | 3300046558 | Bacteria | 1616 |
| 359 | Ga0495633_0152091 | 3300046558 | Bacteria | 1068 |
| 360 | Ga0495633_0153392 | 3300046558 | Bacteria | 1063 |
| 361 | Ga0495633_0199600 | 3300046558 | Bacteria | 918 |
| 362 | Ga0495656_0029366 | 3300046615 | Bacteria | 2213 |
| 363 | Ga0495668_0000018 | 3300046616 | Bacteria | 417480 |
| 364 | Ga0495668_0000240 | 3300046616 | Bacteria | 78290 |
| 365 | Ga0495668_0000962 | 3300046616 | Bacteria | 32005 |
| 366 | Ga0495668_0006047 | 3300046616 | Bacteria | 8020 |
| 367 | Ga0495668_0007753 | 3300046616 | Bacteria | 6812 |
| 368 | Ga0495668_0021842 | 3300046616 | Bacteria | 3664 |
| 369 | Ga0495668_0072528 | 3300046616 | Bacteria | 1891 |
| 370 | Ga0495668_0131722 | 3300046616 | Bacteria | 1368 |
| 371 | Ga0495668_0232504 | 3300046616 | Bacteria | 1009 |
| 372 | Ga0495668_0305609 | 3300046616 | Bacteria | 872 |
| 373 | Ga0495611_0000271 | 3300046648 | Bacteria | 35492 |
| 374 | Ga0495611_0000479 | 3300046648 | Bacteria | 23881 |
| 375 | Ga0495611_0016841 | 3300046648 | Bacteria | 3124 |
| 376 | Ga0495611_0023459 | 3300046648 | Bacteria | 2678 |
| 377 | Ga0495611_0028955 | 3300046648 | Bacteria | 2427 |
| 378 | Ga0495611_0052234 | 3300046648 | Bacteria | 1843 |
| 379 | Ga0495611_0133108 | 3300046648 | Bacteria | 1160 |
| 380 | Ga0495625_0001599 | 3300046660 | Bacteria | 26771 |
| 381 | Ga0495625_0002213 | 3300046660 | Bacteria | 21493 |
| 382 | Ga0495625_0005751 | 3300046660 | Bacteria | 11210 |
| 383 | Ga0495625_0035469 | 3300046660 | Bacteria | 3677 |
| 384 | Ga0495625_0039242 | 3300046660 | Bacteria | 3459 |
| 385 | Ga0495635_0013914 | 3300046663 | Bacteria | 5629 |
| 386 | Ga0495635_0392633 | 3300046663 | Bacteria | 922 |
| 387 | Ga0495659_0000478 | 3300046664 | Bacteria | 14785 |
| 388 | Ga0495659_0000547 | 3300046664 | Bacteria | 13898 |
| 389 | Ga0495659_0020425 | 3300046664 | Bacteria | 2224 |
| 390 | Ga0495659_0044438 | 3300046664 | Bacteria | 1597 |
| 391 | Ga0495661_0000549 | 3300046665 | Bacteria | 38859 |
| 392 | Ga0495661_0001822 | 3300046665 | Bacteria | 17101 |
| 393 | Ga0495661_0002589 | 3300046665 | Bacteria | 13872 |
| 394 | Ga0495661_0013656 | 3300046665 | Bacteria | 5452 |
| 395 | Ga0495661_0021584 | 3300046665 | Bacteria | 4196 |
| 396 | Ga0495661_0028733 | 3300046665 | Bacteria | 3556 |
| 397 | Ga0495661_0028948 | 3300046665 | Bacteria | 3539 |
| 398 | Ga0495661_0084832 | 3300046665 | Bacteria | 1816 |
| 399 | Ga0495661_0135526 | 3300046665 | Bacteria | 1344 |
| 400 | Ga0495588_0040264 | 3300046674 | Bacteria | 2382 |
| 401 | Ga0495588_0053733 | 3300046674 | Bacteria | 2077 |
| 402 | Ga0495588_0148345 | 3300046674 | Bacteria | 1239 |
| 403 | Ga0495623_0000991 | 3300046679 | Bacteria | 19145 |
| 404 | Ga0495623_0076211 | 3300046679 | Bacteria | 2081 |
| 405 | Ga0495623_0223277 | 3300046679 | Bacteria | 1072 |
| 406 | Ga0495646_0049946 | 3300046680 | Bacteria | 2537 |
| 407 | Ga0495669_0000073 | 3300046684 | Bacteria | 66387 |
| 408 | Ga0495669_0000315 | 3300046684 | Bacteria | 26716 |
| 409 | Ga0495669_0001109 | 3300046684 | Bacteria | 11158 |
| 410 | Ga0495613_0060482 | 3300046689 | Bacteria | 2774 |
| 411 | Ga0495613_0172752 | 3300046689 | Bacteria | 1533 |
| 412 | Ga0495624_0014255 | 3300046690 | Bacteria | 5397 |
| 413 | Ga0495624_0029666 | 3300046690 | Bacteria | 3567 |
| 414 | Ga0495670_0000355 | 3300046691 | Bacteria | 21905 |
| 415 | Ga0495670_0000576 | 3300046691 | Bacteria | 17526 |
| 416 | Ga0495670_0000763 | 3300046691 | Bacteria | 15434 |
| 417 | Ga0495670_0011039 | 3300046691 | Bacteria | 4441 |
| 418 | Ga0495670_0011580 | 3300046691 | Bacteria | 4339 |
| 419 | Ga0495670_0018084 | 3300046691 | Bacteria | 3471 |
| 420 | Ga0495670_0044216 | 3300046691 | Bacteria | 2223 |
| 421 | Ga0495670_0067436 | 3300046691 | Bacteria | 1806 |
| 422 | Ga0495670_0168013 | 3300046691 | Bacteria | 1154 |
| 423 | Ga0495670_0569263 | 3300046691 | Bacteria | 617 |
| 424 | Ga0495671_0001538 | 3300046692 | Bacteria | 15368 |
| 425 | Ga0495671_0041323 | 3300046692 | Bacteria | 2322 |
| 426 | Ga0495671_0042745 | 3300046692 | Bacteria | 2276 |
| 427 | Ga0495671_0048827 | 3300046692 | Bacteria | 2111 |
| 428 | Ga0495671_0049263 | 3300046692 | Bacteria | 2100 |
| 429 | Ga0495649_0000291 | 3300046694 | Bacteria | 44106 |
| 430 | Ga0495649_0006056 | 3300046694 | Bacteria | 7563 |
| 431 | Ga0495649_0177383 | 3300046694 | Bacteria | 1113 |
| 432 | Ga0495649_0218626 | 3300046694 | Bacteria | 986 |
| 433 | Ga0495589_0000905 | 3300046794 | Bacteria | 18315 |
| 434 | Ga0495589_0018929 | 3300046794 | Bacteria | 3531 |
| 435 | Ga0495589_0028541 | 3300046794 | Bacteria | 2815 |
| 436 | Ga0495589_0105738 | 3300046794 | Bacteria | 1360 |
| 437 | Ga0495589_0227776 | 3300046794 | Bacteria | 874 |
| 438 | Ga0495600_0075535 | 3300046809 | Bacteria | 2200 |
| 439 | Ga0495600_0270461 | 3300046809 | Bacteria | 1078 |
| 440 | Ga0495660_0000470 | 3300046810 | Bacteria | 33476 |
| 441 | Ga0495660_0069406 | 3300046810 | Bacteria | 1873 |
| 442 | Ga0495660_0069540 | 3300046810 | Bacteria | 1871 |
| 443 | Ga0495660_0072346 | 3300046810 | Bacteria | 1826 |
| 444 | Ga0495660_0127896 | 3300046810 | Bacteria | 1277 |
| 445 | Ga0495581_0029372 | 3300047315 | Bacteria | 3187 |
| 446 | Ga0495581_0046968 | 3300047315 | Bacteria | 2495 |
| 447 | Ga0495604_0004660 | 3300047317 | Bacteria | 10871 |
| 448 | Ga0495604_0006448 | 3300047317 | Bacteria | 9307 |
| 449 | Ga0495604_0043297 | 3300047317 | Bacteria | 3525 |
| 450 | Ga0495636_0000414 | 3300047318 | Bacteria | 15875 |
| 451 | Ga0495636_0001341 | 3300047318 | Bacteria | 9347 |
| 452 | Ga0495636_0002533 | 3300047318 | Bacteria | 7015 |
| 453 | Ga0495636_0017160 | 3300047318 | Bacteria | 2897 |
| 454 | Ga0495636_0041335 | 3300047318 | Bacteria | 1913 |
| 455 | Ga0495636_0067110 | 3300047318 | Bacteria | 1526 |
| 456 | Ga0495636_0118799 | 3300047318 | Bacteria | 1168 |
| 457 | Ga0495672_0000066 | 3300047320 | Bacteria | 193318 |
| 458 | Ga0495672_0000135 | 3300047320 | Bacteria | 110114 |
| 459 | Ga0495672_0002864 | 3300047320 | Bacteria | 15326 |
| 460 | Ga0495672_0014181 | 3300047320 | Bacteria | 5468 |
| 461 | Ga0495672_0240736 | 3300047320 | Bacteria | 883 |
| 462 | Ga0495680_0032849 | 3300047322 | Bacteria | 4207 |
| 463 | Ga0495680_0163949 | 3300047322 | Bacteria | 1612 |
| 464 | Ga0495680_0285128 | 3300047322 | Bacteria | 1163 |
| 465 | Ga0495683_0000133 | 3300047323 | Bacteria | 72553 |
| 466 | Ga0495683_0001638 | 3300047323 | Bacteria | 14401 |
| 467 | Ga0495683_0004123 | 3300047323 | Bacteria | 8320 |
| 468 | Ga0495683_0011568 | 3300047323 | Bacteria | 4642 |
| 469 | Ga0495683_0103766 | 3300047323 | Bacteria | 1364 |
| 470 | Ga0495683_0138837 | 3300047323 | Bacteria | 1140 |
| 471 | Ga0495687_000030 | 3300047443 | Bacteria | 279992 |
| 472 | Ga0495687_000374 | 3300047443 | Bacteria | 55800 |
| 473 | Ga0495687_002366 | 3300047443 | Bacteria | 15258 |
| 474 | Ga0495687_004366 | 3300047443 | Bacteria | 9613 |
| 475 | Ga0495687_054467 | 3300047443 | Bacteria | 1678 |
| 476 | Ga0495675_0018114 | 3300047444 | Bacteria | 4466 |
| 477 | Ga0495675_0030169 | 3300047444 | Bacteria | 3460 |
| 478 | Ga0495675_0095315 | 3300047444 | Bacteria | 1866 |
| 479 | Ga0495677_0000387 | 3300047445 | Bacteria | 18876 |
| 480 | Ga0495677_0002991 | 3300047445 | Bacteria | 6575 |
| 481 | Ga0495677_0004187 | 3300047445 | Bacteria | 5562 |
| 482 | Ga0495677_0007503 | 3300047445 | Bacteria | 4073 |
| 483 | Ga0495677_0007754 | 3300047445 | Bacteria | 4001 |
| 484 | Ga0495677_0010425 | 3300047445 | Bacteria | 3413 |
| 485 | Ga0495677_0032258 | 3300047445 | Bacteria | 1907 |
| 486 | Ga0495677_0316446 | 3300047445 | Bacteria | 614 |
| 487 | Ga0495679_030949 | 3300047446 | Bacteria | 1731 |
| 488 | Ga0495679_049662 | 3300047446 | Bacteria | 1264 |
| 489 | Ga0495679_068151 | 3300047446 | Bacteria | 1030 |
| 490 | Ga0495685_000011 | 3300047447 | Bacteria | 83484 |
| 491 | Ga0495685_000539 | 3300047447 | Bacteria | 11706 |
| 492 | Ga0495673_0000035 | 3300047469 | Bacteria | 316861 |
| 493 | Ga0495673_0010958 | 3300047469 | Bacteria | 4905 |
| 494 | Ga0495673_0031534 | 3300047469 | Bacteria | 2480 |
| 495 | Ga0495673_0063314 | 3300047469 | Bacteria | 1577 |
| 496 | Ga0495681_0000864 | 3300047470 | Bacteria | 23321 |
| 497 | Ga0495681_0002025 | 3300047470 | Bacteria | 14795 |
| 498 | Ga0495681_0005144 | 3300047470 | Bacteria | 8809 |
| 499 | Ga0495681_0017148 | 3300047470 | Bacteria | 4033 |
| 500 | Ga0495681_0019937 | 3300047470 | Bacteria | 3648 |
| 501 | Ga0495681_0053395 | 3300047470 | Bacteria | 1892 |
| 502 | Ga0495681_0074842 | 3300047470 | Bacteria | 1525 |
| 503 | Ga0495681_0242339 | 3300047470 | Bacteria | 715 |
| 504 | Ga0495681_0273146 | 3300047470 | Bacteria | 661 |
| 505 | Ga0495686_0000290 | 3300047472 | Bacteria | 88168 |
| 506 | Ga0495686_0000802 | 3300047472 | Bacteria | 40756 |
| 507 | Ga0495686_0008599 | 3300047472 | Bacteria | 7471 |
| 508 | Ga0495686_0029885 | 3300047472 | Bacteria | 3541 |
| 509 | Ga0495593_0023146 | 3300047673 | Bacteria | 3455 |
| 510 | Ga0495614_0003706 | 3300048089 | Bacteria | 6861 |
| 511 | Ga0495614_0014600 | 3300048089 | Bacteria | 3434 |
| 512 | Ga0495615_0171303 | 3300048090 | Bacteria | 657 |
| 513 | Ga0495626_0003232 | 3300048091 | Bacteria | 10566 |
| 514 | Ga0495626_0009512 | 3300048091 | Bacteria | 5251 |
| 515 | Ga0495626_0037188 | 3300048091 | Bacteria | 2314 |
| 516 | Ga0495626_0038004 | 3300048091 | Bacteria | 2284 |
| 517 | Ga0495626_0074361 | 3300048091 | Bacteria | 1520 |
| 518 | Ga0495626_0083168 | 3300048091 | Bacteria | 1418 |
| 519 | Ga0495626_0101612 | 3300048091 | Bacteria | 1253 |
| 520 | Ga0495626_0107446 | 3300048091 | Bacteria | 1211 |
| 521 | Ga0495626_0139023 | 3300048091 | Bacteria | 1031 |
| 522 | Ga0496100_0132944 | 3300048903 | Bacteria | 1754 |
| 523 | Ga0496100_0311337 | 3300048903 | Bacteria | 1181 |
| 524 | Ga0496101_0025139 | 3300048904 | Bacteria | 4128 |
| 525 | Ga0496102_0000150 | 3300048905 | Bacteria | 94718 |
| 526 | Ga0496102_0002351 | 3300048905 | Bacteria | 16129 |
| 527 | Ga0496102_0020140 | 3300048905 | Bacteria | 5889 |
| 528 | Ga0496102_0129773 | 3300048905 | Bacteria | 2358 |
| 529 | Ga0496102_0135694 | 3300048905 | Bacteria | 2305 |
| 530 | Ga0496102_0907323 | 3300048905 | Bacteria | 803 |
| 531 | Ga0496103_0012424 | 3300048906 | Bacteria | 5049 |
| 532 | Ga0496103_0128382 | 3300048906 | Bacteria | 1618 |
| 533 | Ga0496105_0454678 | 3300048908 | Bacteria | 1010 |
| 534 | Ga0496106_0084552 | 3300048909 | Bacteria | 2442 |
| 535 | Ga0496107_0082563 | 3300048910 | Bacteria | 2344 |
| 536 | Ga0496108_0793925 | 3300048911 | Bacteria | 817 |
| 537 | Ga0496108_0927752 | 3300048911 | Bacteria | 746 |
| 538 | Ga0496109_0019715 | 3300048912 | Bacteria | 5950 |
| 539 | Ga0496109_0299139 | 3300048912 | Bacteria | 1517 |
| 540 | Ga0496110_0000462 | 3300048913 | Bacteria | 27650 |
| 541 | Ga0496110_0266770 | 3300048913 | Bacteria | 1559 |
| 542 | Ga0496112_0936729 | 3300048915 | Bacteria | 787 |
| 543 | Ga0496113_0099945 | 3300048916 | Bacteria | 2247 |
| 544 | Ga0496113_0429224 | 3300048916 | Bacteria | 1062 |
| 545 | Ga0496115_0199749 | 3300048918 | Bacteria | 1652 |
| 546 | Ga0496121_0027483 | 3300048924 | Bacteria | 5325 |
| 547 | Ga0496122_0001744 | 3300048925 | Bacteria | 33606 |
| 548 | Ga0496123_0013972 | 3300048926 | Bacteria | 6687 |
| 549 | Ga0496124_0023330 | 3300048927 | Bacteria | 5650 |
| 550 | Ga0496124_0119587 | 3300048927 | Bacteria | 2107 |
| 551 | Ga0496125_0017792 | 3300048928 | Bacteria | 6764 |
| 552 | Ga0495678_000002 | 3300049459 | Bacteria | 999613 |
| 553 | Ga0495678_000190 | 3300049459 | Bacteria | 71878 |
| 554 | Ga0495678_000831 | 3300049459 | Bacteria | 27649 |
| 555 | Ga0495678_002497 | 3300049459 | Bacteria | 12404 |
| 556 | Ga0495678_003814 | 3300049459 | Bacteria | 9090 |
| 557 | Ga0495678_036083 | 3300049459 | Bacteria | 2020 |
| 558 | Ga0495678_055558 | 3300049459 | Bacteria | 1510 |
| 559 | Ga0495682_0000199 | 3300049460 | Bacteria | 48422 |
| 560 | Ga0495682_0001816 | 3300049460 | Bacteria | 10735 |
| 561 | Ga0495682_0016499 | 3300049460 | Bacteria | 2795 |
| 562 | Ga0495682_0065246 | 3300049460 | Bacteria | 1312 |
| 563 | Ga0501222_013360 | 3300049662 | Bacteria | 1080 |
| 564 | Ga0501269_014057 | 3300049766 | Bacteria | 981 |
| 565 | Ga0501279_008635 | 3300049775 | Bacteria | 1362 |
| 566 | Ga0501279_062250 | 3300049775 | Bacteria | 613 |
| 567 | Ga0500572_056231 | 3300053111 | Bacteria | 1185 |
| 568 | Ga0500594_0004952 | 3300053118 | Bacteria | 2946 |
| 569 | Ga0500595_023498 | 3300053119 | Bacteria | 2165 |
| 570 | Ga0500574_000678 | 3300053141 | Bacteria | 4476 |
| 571 | Ga0500619_001205 | 3300053154 | Bacteria | 4505 |
| 572 | 2643790772 | 2643221554 | Bacteria | 6603920 |
| 573 | 2644211694 | 2643221638 | Bacteria | 6579467 |
| 574 | 2644251348 | 2643221645 | Bacteria | 7207331 |
| 575 | 2644357451 | 2643221664 | Bacteria | 7272945 |
| 576 | 2738740046 | 2738541280 | Bacteria | 6630198 |
| 577 | 2738844198 | 2738541300 | Bacteria | 6675882 |
| 578 | 2739274242 | 2738543018 | Bacteria | 6718814 |
| 579 | 2739343286 | 2738543030 | Bacteria | 6719714 |
| 580 | 2819540777 | 2818991436 | Bacteria | 5376622 |
| 581 | 2904425654 | 2904424332 | Bacteria | 7633521 |
| 582 | Ga0495646_0016234 | |||
| 583 | JGI25156J39149_1003286 | |||
| 584 | JGI25162J39368_1000015 | |||
| 585 | JGI25154J39366_1002712 | |||
| 586 | JGI25158J39367_1000644 | |||
| 587 | JGI25158J39367_1002306 | |||
| 588 | JGI25157J39369_1017044 | |||
| 589 | JGI25164J39214_1003153 | |||
| 590 | JGI25152J39213_1000242 | |||
| 591 | JGI25152J39213_1007466 | |||
| 592 | JGI25150J39212_1000335 | |||
| 593 | JGI25150J39212_1021055 | |||
| 594 | JGI25159J45721_1001941 | |||
| 595 | JGI25159J45721_1002166 | |||
| 596 | JGI25165J46597_1000001 | |||
| 597 | rootH1_10180508 | |||
| 598 | JGI25161J50226_1000166 | |||
| 599 | Ga0055538_1000001 | |||
| 600 | Ga0055539_1000001 | |||
| 601 | Ga0055533_1000003 | |||
| 602 | Ga0055525_1000003 | |||
| 603 | Ga0055526_1000061 | |||
| 604 | Ga0055526_1000418 | |||
| 605 | Ga0055526_1000602 | |||
| 606 | Ga0055537_1003151 | |||
| 607 | Ga0055537_1017949 | |||
| 608 | Ga0055537_1021544 | |||
| 609 | Ga0055524_1000223 | |||
| 610 | Ga0055524_1000861 | |||
| 611 | Ga0055524_1010125 | |||
| 612 | Ga0055524_1034421 | |||
| 613 | Ga0055534_1000351 | |||
| 614 | Ga0055534_1034154 | |||
| 615 | Ga0055528_1000036 | |||
| 616 | Ga0055528_1020648 | |||
| 617 | Ga0055530_10000262 | |||
| 618 | Ga0055541_1000001 | |||
| 619 | Ga0055543_1000063 | |||
| 620 | Ga0055543_1010078 | |||
| 621 | Ga0065165_1000612 | |||
| 622 | Ga0065165_1001278 | |||
| 623 | Ga0065715_10017199 | |||
| 624 | Ga0070676_10000460 | |||
| 625 | Ga0070690_100097669 | |||
| 626 | Ga0070670_100024282 | |||
| 627 | Ga0068869_100003214 | |||
| 628 | Ga0070666_10000439 | |||
| 629 | Ga0068868_100004899 | |||
| 630 | Ga0070668_100000714 | |||
| 631 | Ga0070669_100000685 | |||
| 632 | Ga0070675_100000769 | |||
| 633 | Ga0070671_100039288 | |||
| 634 | Ga0070674_100001488 | |||
| 635 | Ga0070673_100001967 | |||
| 636 | Ga0070667_100001175 | |||
| 637 | Ga0070678_100000294 | |||
| 638 | Ga0068867_100000643 | |||
| 639 | Ga0070685_10004609 | |||
| 640 | Ga0070672_100000479 | |||
| 641 | Ga0070665_100004149 | |||
| 642 | Ga0068854_100863193 | |||
| 643 | Ga0068859_100016181 | |||
| 644 | Ga0068864_100001326 | |||
| 645 | Ga0068861_100009480 | |||
| 646 | Ga0068851_10082164 | |||
| 647 | Ga0068863_100001375 | |||
| 648 | Ga0068858_100001028 | |||
| 649 | Ga0068860_100015302 | |||
| 650 | Ga0068862_100526768 | |||
| 651 | Ga0097621_100001008 | |||
| 652 | Ga0068871_100009136 | |||
| 653 | Ga0068865_100005487 | |||
| 654 | Ga0068865_100288487 | |||
| 655 | Ga0097620_100016180 | |||
| 656 | Ga0105240_10338283 | |||
| 657 | Ga0105243_10786438 | |||
| 658 | Ga0105241_10693363 | |||
| 659 | Ga0105239_10104239 | |||
| 660 | Ga0105239_10860001 | |||
| 661 | Ga0157374_10007694 | |||
| 662 | Ga0157378_10106893 | |||
| 663 | Ga0157380_10164792 | |||
| 664 | Ga0182006_1006579 | |||
| 665 | Ga0182007_10038828 | |||
| 666 | Ga0182005_1000522 | |||
| 667 | Ga0163161_10006917 | |||
| 668 | Ga0209435_100181 | |||
| 669 | Ga0209760_104522 | |||
| 670 | Ga0209436_100056 | |||
| 671 | Ga0209436_103176 | |||
| 672 | Ga0209436_107064 | |||
| 673 | Ga0209784_100004 | |||
| 674 | Ga0209566_100004 | |||
| 675 | Ga0209674_100006 | |||
| 676 | Ga0209563_100009 | |||
| 677 | Ga0207427_101473 | |||
| 678 | Ga0209437_100004 | |||
| 679 | Ga0207425_1000001 | |||
| 680 | Ga0207425_1000039 | |||
| 681 | Ga0209646_1000173 | |||
| 682 | Ga0209026_1006724 | |||
| 683 | Ga0209677_100005 | |||
| 684 | Ga0209759_1000224 | |||
| 685 | Ga0209129_1000001 | |||
| 686 | Ga0209129_1005425 | |||
| 687 | Ga0209233_1000005 | |||
| 688 | Ga0209565_1000017 | |||
| 689 | Ga0209565_1000998 | |||
| 690 | Ga0209565_1001338 | |||
| 691 | Ga0209565_1001557 | |||
| 692 | Ga0209565_1006500 | |||
| 693 | Ga0209673_1000007 | |||
| 694 | Ga0209673_1005138 | |||
| 695 | Ga0209130_1000078 | |||
| 696 | Ga0209130_1000128 | |||
| 697 | Ga0209130_1005348 | |||
| 698 | Ga0209675_1000009 | |||
| 699 | Ga0209675_1002200 | |||
| 700 | Ga0209564_1000036 | |||
| 701 | Ga0209564_1000055 | |||
| 702 | Ga0209564_1000089 | |||
| 703 | Ga0209564_1000109 | |||
| 704 | Ga0209564_1005064 | |||
| 705 | Ga0209564_1005305 | |||
| 706 | Ga0209564_1012464 | |||
| 707 | Ga0209758_1000020 | |||
| 708 | Ga0209050_1000074 | |||
| 709 | Ga0209050_1000628 | |||
| 710 | Ga0209256_1000028 | |||
| 711 | Ga0209256_1000167 | |||
| 712 | Ga0209256_1000621 | |||
| 713 | Ga0207426_1001909 | |||
| 714 | Ga0207426_1059131 | |||
| 715 | Ga0207426_1064711 | |||
| 716 | Ga0209257_1000003 | |||
| 717 | Ga0209257_1001374 | |||
| 718 | Ga0207697_10008562 | |||
| 719 | Ga0207656_10138751 | |||
| 720 | Ga0207682_10131734 | |||
| 721 | Ga0207680_10000461 | |||
| 722 | Ga0207645_10000534 | |||
| 723 | Ga0207643_10133245 | |||
| 724 | Ga0207654_10606376 | |||
| 725 | Ga0207681_10000530 | |||
| 726 | Ga0207650_10077415 | |||
| 727 | Ga0207659_10000248 | |||
| 728 | Ga0207644_10018482 | |||
| 729 | Ga0207709_10419682 | |||
| 730 | Ga0207669_10006845 | |||
| 731 | Ga0207704_10000684 | |||
| 732 | Ga0207704_10514165 | |||
| 733 | Ga0207691_10000022 | |||
| 734 | Ga0207711_10014269 | |||
| 735 | Ga0207689_10001287 | |||
| 736 | Ga0207651_10009349 | |||
| 737 | Ga0207668_10005408 | |||
| 738 | Ga0207658_10000311 | |||
| 739 | Ga0207677_10002948 | |||
| 740 | Ga0207703_10010184 | |||
| 741 | Ga0207641_10001378 | |||
| 742 | Ga0207648_10001109 | |||
| 743 | Ga0207676_10042365 | |||
| 744 | Ga0207675_100014096 | |||
| 745 | Ga0207683_10000108 | |||
| 746 | Ga0268266_10074453 | |||
| 747 | Ga0268265_10311714 | |||
| 748 | Ga0268265_10803643 | |||
| 749 | Ga0268264_10002130 | |||
| 750 | Ga0307515_10145879 | |||
| 751 | Ga0307408_100000126 | |||
| 752 | Ga0307408_100003761 | |||
| 753 | Ga0307408_100082143 | |||
| 754 | Ga0265314_10041691 | |||
| 755 | Ga0395905_0015518 | |||
| 756 | Ga0395905_0166240 | |||
| 757 | Ga0395901_0521281 | |||
| 758 | Ga0451577_0830818 | |||
| 759 | Ga0495617_000027 | |||
| 760 | Ga0495617_001868 | |||
| 761 | Ga0495617_006722 | |||
| 762 | Ga0495617_025891 | |||
| 763 | Ga0495627_000001 | |||
| 764 | Ga0495627_000277 | |||
| 765 | Ga0495603_0087215 | |||
| 766 | Ga0495591_000500 | |||
| 767 | Ga0495591_058398 | |||
| 768 | Ga0495629_0417096 | |||
| 769 | Ga0495638_0012397 | |||
| 770 | Ga0495638_0023529 | |||
| 771 | Ga0495638_0197927 | |||
| 772 | Ga0495651_0001090 | |||
| 773 | Ga0495651_0077368 | |||
| 774 | Ga0495653_0012739 | |||
| 775 | Ga0495653_0035107 | |||
| 776 | Ga0495653_0044779 | |||
| 777 | Ga0495650_0000019 | |||
| 778 | Ga0495650_0006569 | |||
| 779 | Ga0495650_0034066 | |||
| 780 | Ga0495650_0127708 | |||
| 781 | Ga0495582_0044368 | |||
| 782 | Ga0495605_0000135 | |||
| 783 | Ga0495605_0011545 | |||
| 784 | Ga0495605_0049768 | |||
| 785 | Ga0495605_0066718 | |||
| 786 | Ga0495605_0110249 | |||
| 787 | Ga0495605_0201686 | |||
| 788 | Ga0495584_0000002 | |||
| 789 | Ga0495584_0000300 | |||
| 790 | Ga0495584_0000700 | |||
| 791 | Ga0495584_0002291 | |||
| 792 | Ga0495584_0004911 | |||
| 793 | Ga0495584_0025777 | |||
| 794 | Ga0495584_0166207 | |||
| 795 | Ga0495584_0327096 | |||
| 796 | Ga0495585_0000002 | |||
| 797 | Ga0495585_0001198 | |||
| 798 | Ga0495585_0001944 | |||
| 799 | Ga0495585_0008560 | |||
| 800 | Ga0495585_0010157 | |||
| 801 | Ga0495585_0013244 | |||
| 802 | Ga0495585_0028547 | |||
| 803 | Ga0495585_0028571 | |||
| 804 | Ga0495585_0070103 | |||
| 805 | Ga0495585_0161249 | |||
| 806 | Ga0495585_0178326 | |||
| 807 | Ga0495585_0377273 | |||
| 808 | Ga0495594_0045191 | |||
| 809 | Ga0495594_0078810 | |||
| 810 | Ga0495594_0091010 | |||
| 811 | Ga0495596_0002268 | |||
| 812 | Ga0495596_0002981 | |||
| 813 | Ga0495596_0005474 | |||
| 814 | Ga0495596_0010381 | |||
| 815 | Ga0495596_0020324 | |||
| 816 | Ga0495596_0025356 | |||
| 817 | Ga0495607_0000264 | |||
| 818 | Ga0495607_0004462 | |||
| 819 | Ga0495607_0007161 | |||
| 820 | Ga0495607_0019919 | |||
| 821 | Ga0495607_0030417 | |||
| 822 | Ga0495607_0042270 | |||
| 823 | Ga0495607_0061549 | |||
| 824 | Ga0495607_0132440 | |||
| 825 | Ga0495607_0141317 | |||
| 826 | Ga0495583_0000009 | |||
| 827 | Ga0495583_0000026 | |||
| 828 | Ga0495583_0000067 | |||
| 829 | Ga0495583_0002853 | |||
| 830 | Ga0495583_0006773 | |||
| 831 | Ga0495583_0026944 | |||
| 832 | Ga0495583_0027182 | |||
| 833 | Ga0495583_0035591 | |||
| 834 | Ga0495583_0035773 | |||
| 835 | Ga0495583_0061227 | |||
| 836 | Ga0495583_0078445 | |||
| 837 | Ga0495583_0088751 | |||
| 838 | Ga0495606_0002942 | |||
| 839 | Ga0495606_0039263 | |||
| 840 | Ga0495606_0043030 | |||
| 841 | Ga0495606_0147179 | |||
| 842 | Ga0495608_0040595 | |||
| 843 | Ga0495610_0001136 | |||
| 844 | Ga0495616_0000333 | |||
| 845 | Ga0495616_0000531 | |||
| 846 | Ga0495616_0000713 | |||
| 847 | Ga0495616_0003242 | |||
| 848 | Ga0495616_0006338 | |||
| 849 | Ga0495616_0013282 | |||
| 850 | Ga0495616_0032517 | |||
| 851 | Ga0495616_0035360 | |||
| 852 | Ga0495616_0044971 | |||
| 853 | Ga0495616_0067563 | |||
| 854 | Ga0495616_0069051 | |||
| 855 | Ga0495618_0044788 | |||
| 856 | Ga0495628_0000935 | |||
| 857 | Ga0495628_0009156 | |||
| 858 | Ga0495628_0045760 | |||
| 859 | Ga0495631_0001148 | |||
| 860 | Ga0495631_0010095 | |||
| 861 | Ga0495631_0013306 | |||
| 862 | Ga0495631_0018738 | |||
| 863 | Ga0495631_0084952 | |||
| 864 | Ga0495631_0131035 | |||
| 865 | Ga0495632_0007007 | |||
| 866 | Ga0495632_0258328 | |||
| 867 | Ga0495637_0000053 | |||
| 868 | Ga0495637_0026817 | |||
| 869 | Ga0495637_0074288 | |||
| 870 | Ga0495637_0164975 | |||
| 871 | Ga0495643_0000121 | |||
| 872 | Ga0495643_0000285 | |||
| 873 | Ga0495643_0011896 | |||
| 874 | Ga0495643_0058593 | |||
| 875 | Ga0495643_0066182 | |||
| 876 | Ga0495643_0165404 | |||
| 877 | Ga0495644_0001029 | |||
| 878 | Ga0495644_0001033 | |||
| 879 | Ga0495644_0014976 | |||
| 880 | Ga0495644_0024082 | |||
| 881 | Ga0495644_0028378 | |||
| 882 | Ga0495644_0037727 | |||
| 883 | Ga0495644_0050851 | |||
| 884 | Ga0495644_0099588 | |||
| 885 | Ga0495644_0162451 | |||
| 886 | Ga0495648_0000012 | |||
| 887 | Ga0495648_0000831 | |||
| 888 | Ga0495648_0005856 | |||
| 889 | Ga0495648_0034458 | |||
| 890 | Ga0495648_0065116 | |||
| 891 | Ga0495648_0094748 | |||
| 892 | Ga0495648_0120273 | |||
| 893 | Ga0495648_0127671 | |||
| 894 | Ga0495648_0227113 | |||
| 895 | Ga0495648_0327505 | |||
| 896 | Ga0495663_0009796 | |||
| 897 | Ga0495666_0000177 | |||
| 898 | Ga0495642_0000137 | |||
| 899 | Ga0495642_0000441 | |||
| 900 | Ga0495642_0008116 | |||
| 901 | Ga0495642_0078480 | |||
| 902 | Ga0495642_0078486 | |||
| 903 | Ga0495652_0032797 | |||
| 904 | Ga0495652_0059389 | |||
| 905 | Ga0495652_0168519 | |||
| 906 | Ga0495654_0016492 | |||
| 907 | Ga0495654_0018321 | |||
| 908 | Ga0495654_0046435 | |||
| 909 | Ga0495665_0003160 | |||
| 910 | Ga0495665_0086043 | |||
| 911 | Ga0495640_0017785 | |||
| 912 | Ga0495586_0024037 | |||
| 913 | Ga0495586_0039610 | |||
| 914 | Ga0495587_0027700 | |||
| 915 | Ga0495609_0000110 | |||
| 916 | Ga0495609_0001214 | |||
| 917 | Ga0495609_0001479 | |||
| 918 | Ga0495609_0007094 | |||
| 919 | Ga0495609_0016742 | |||
| 920 | Ga0495609_0034455 | |||
| 921 | Ga0495609_0052357 | |||
| 922 | Ga0495609_0146642 | |||
| 923 | Ga0495621_0071983 | |||
| 924 | Ga0495597_0000284 | |||
| 925 | Ga0495597_0000682 | |||
| 926 | Ga0495597_0001719 | |||
| 927 | Ga0495597_0110870 | |||
| 928 | Ga0495597_0162384 | |||
| 929 | Ga0495645_0022671 | |||
| 930 | Ga0495645_0048441 | |||
| 931 | Ga0495622_0012657 | |||
| 932 | Ga0495622_0131601 | |||
| 933 | Ga0495633_0001718 | |||
| 934 | Ga0495633_0002489 | |||
| 935 | Ga0495633_0004979 | |||
| 936 | Ga0495633_0007515 | |||
| 937 | Ga0495633_0012965 | |||
| 938 | Ga0495633_0013456 | |||
| 939 | Ga0495633_0071649 | |||
| 940 | Ga0495633_0152091 | |||
| 941 | Ga0495633_0153392 | |||
| 942 | Ga0495633_0199600 | |||
| 943 | Ga0495656_0029366 | |||
| 944 | Ga0495668_0000018 | |||
| 945 | Ga0495668_0000240 | |||
| 946 | Ga0495668_0000962 | |||
| 947 | Ga0495668_0006047 | |||
| 948 | Ga0495668_0007753 | |||
| 949 | Ga0495668_0021842 | |||
| 950 | Ga0495668_0072528 | |||
| 951 | Ga0495668_0131722 | |||
| 952 | Ga0495668_0232504 | |||
| 953 | Ga0495668_0305609 | |||
| 954 | Ga0495611_0000271 | |||
| 955 | Ga0495611_0000479 | |||
| 956 | Ga0495611_0016841 | |||
| 957 | Ga0495611_0023459 | |||
| 958 | Ga0495611_0028955 | |||
| 959 | Ga0495611_0052234 | |||
| 960 | Ga0495611_0133108 | |||
| 961 | Ga0495625_0001599 | |||
| 962 | Ga0495625_0002213 | |||
| 963 | Ga0495625_0005751 | |||
| 964 | Ga0495625_0035469 | |||
| 965 | Ga0495625_0039242 | |||
| 966 | Ga0495635_0013914 | |||
| 967 | Ga0495635_0392633 | |||
| 968 | Ga0495659_0000478 | |||
| 969 | Ga0495659_0000547 | |||
| 970 | Ga0495659_0020425 | |||
| 971 | Ga0495659_0044438 | |||
| 972 | Ga0495661_0000549 | |||
| 973 | Ga0495661_0001822 | |||
| 974 | Ga0495661_0002589 | |||
| 975 | Ga0495661_0013656 | |||
| 976 | Ga0495661_0021584 | |||
| 977 | Ga0495661_0028733 | |||
| 978 | Ga0495661_0028948 | |||
| 979 | Ga0495661_0084832 | |||
| 980 | Ga0495661_0135526 | |||
| 981 | Ga0495588_0040264 | |||
| 982 | Ga0495588_0053733 | |||
| 983 | Ga0495588_0148345 | |||
| 984 | Ga0495623_0000991 | |||
| 985 | Ga0495623_0076211 | |||
| 986 | Ga0495623_0223277 | |||
| 987 | Ga0495646_0049946 | |||
| 988 | Ga0495669_0000073 | |||
| 989 | Ga0495669_0000315 | |||
| 990 | Ga0495669_0001109 | |||
| 991 | Ga0495613_0060482 | |||
| 992 | Ga0495613_0172752 | |||
| 993 | Ga0495624_0014255 | |||
| 994 | Ga0495624_0029666 | |||
| 995 | Ga0495670_0000355 | |||
| 996 | Ga0495670_0000576 | |||
| 997 | Ga0495670_0000763 | |||
| 998 | Ga0495670_0011039 | |||
| 999 | Ga0495670_0011580 | |||
| 1000 | Ga0495670_0018084 | |||
| 1001 | Ga0495670_0044216 | |||
| 1002 | Ga0495670_0067436 | |||
| 1003 | Ga0495670_0168013 | |||
| 1004 | Ga0495670_0569263 | |||
| 1005 | Ga0495671_0001538 | |||
| 1006 | Ga0495671_0041323 | |||
| 1007 | Ga0495671_0042745 | |||
| 1008 | Ga0495671_0048827 | |||
| 1009 | Ga0495671_0049263 | |||
| 1010 | Ga0495649_0000291 | |||
| 1011 | Ga0495649_0006056 | |||
| 1012 | Ga0495649_0177383 | |||
| 1013 | Ga0495649_0218626 | |||
| 1014 | Ga0495589_0000905 | |||
| 1015 | Ga0495589_0018929 | |||
| 1016 | Ga0495589_0028541 | |||
| 1017 | Ga0495589_0105738 | |||
| 1018 | Ga0495589_0227776 | |||
| 1019 | Ga0495600_0075535 | |||
| 1020 | Ga0495600_0270461 | |||
| 1021 | Ga0495660_0000470 | |||
| 1022 | Ga0495660_0069406 | |||
| 1023 | Ga0495660_0069540 | |||
| 1024 | Ga0495660_0072346 | |||
| 1025 | Ga0495660_0127896 | |||
| 1026 | Ga0495581_0029372 | |||
| 1027 | Ga0495581_0046968 | |||
| 1028 | Ga0495604_0004660 | |||
| 1029 | Ga0495604_0006448 | |||
| 1030 | Ga0495604_0043297 | |||
| 1031 | Ga0495636_0000414 | |||
| 1032 | Ga0495636_0001341 | |||
| 1033 | Ga0495636_0002533 | |||
| 1034 | Ga0495636_0017160 | |||
| 1035 | Ga0495636_0041335 | |||
| 1036 | Ga0495636_0067110 | |||
| 1037 | Ga0495636_0118799 | |||
| 1038 | Ga0495672_0000066 | |||
| 1039 | Ga0495672_0000135 | |||
| 1040 | Ga0495672_0002864 | |||
| 1041 | Ga0495672_0014181 | |||
| 1042 | Ga0495672_0240736 | |||
| 1043 | Ga0495680_0032849 | |||
| 1044 | Ga0495680_0163949 | |||
| 1045 | Ga0495680_0285128 | |||
| 1046 | Ga0495683_0000133 | |||
| 1047 | Ga0495683_0001638 | |||
| 1048 | Ga0495683_0004123 | |||
| 1049 | Ga0495683_0011568 | |||
| 1050 | Ga0495683_0103766 | |||
| 1051 | Ga0495683_0138837 | |||
| 1052 | Ga0495687_000030 | |||
| 1053 | Ga0495687_000374 | |||
| 1054 | Ga0495687_002366 | |||
| 1055 | Ga0495687_004366 | |||
| 1056 | Ga0495687_054467 | |||
| 1057 | Ga0495675_0018114 | |||
| 1058 | Ga0495675_0030169 | |||
| 1059 | Ga0495675_0095315 | |||
| 1060 | Ga0495677_0000387 | |||
| 1061 | Ga0495677_0002991 | |||
| 1062 | Ga0495677_0004187 | |||
| 1063 | Ga0495677_0007503 | |||
| 1064 | Ga0495677_0007754 | |||
| 1065 | Ga0495677_0010425 | |||
| 1066 | Ga0495677_0032258 | |||
| 1067 | Ga0495677_0316446 | |||
| 1068 | Ga0495679_030949 | |||
| 1069 | Ga0495679_049662 | |||
| 1070 | Ga0495679_068151 | |||
| 1071 | Ga0495685_000011 | |||
| 1072 | Ga0495685_000539 | |||
| 1073 | Ga0495673_0000035 | |||
| 1074 | Ga0495673_0010958 | |||
| 1075 | Ga0495673_0031534 | |||
| 1076 | Ga0495673_0063314 | |||
| 1077 | Ga0495681_0000864 | |||
| 1078 | Ga0495681_0002025 | |||
| 1079 | Ga0495681_0005144 | |||
| 1080 | Ga0495681_0017148 | |||
| 1081 | Ga0495681_0019937 | |||
| 1082 | Ga0495681_0053395 | |||
| 1083 | Ga0495681_0074842 | |||
| 1084 | Ga0495681_0242339 | |||
| 1085 | Ga0495681_0273146 | |||
| 1086 | Ga0495686_0000290 | |||
| 1087 | Ga0495686_0000802 | |||
| 1088 | Ga0495686_0008599 | |||
| 1089 | Ga0495686_0029885 | |||
| 1090 | Ga0495593_0023146 | |||
| 1091 | Ga0495614_0003706 | |||
| 1092 | Ga0495614_0014600 | |||
| 1093 | Ga0495615_0171303 | |||
| 1094 | Ga0495626_0003232 | |||
| 1095 | Ga0495626_0009512 | |||
| 1096 | Ga0495626_0037188 | |||
| 1097 | Ga0495626_0038004 | |||
| 1098 | Ga0495626_0074361 | |||
| 1099 | Ga0495626_0083168 | |||
| 1100 | Ga0495626_0101612 | |||
| 1101 | Ga0495626_0107446 | |||
| 1102 | Ga0495626_0139023 | |||
| 1103 | Ga0496100_0132944 | |||
| 1104 | Ga0496100_0311337 | |||
| 1105 | Ga0496101_0025139 | |||
| 1106 | Ga0496102_0000150 | |||
| 1107 | Ga0496102_0002351 | |||
| 1108 | Ga0496102_0020140 | |||
| 1109 | Ga0496102_0129773 | |||
| 1110 | Ga0496102_0135694 | |||
| 1111 | Ga0496102_0907323 | |||
| 1112 | Ga0496103_0012424 | |||
| 1113 | Ga0496103_0128382 | |||
| 1114 | Ga0496105_0454678 | |||
| 1115 | Ga0496106_0084552 | |||
| 1116 | Ga0496107_0082563 | |||
| 1117 | Ga0496108_0793925 | |||
| 1118 | Ga0496108_0927752 | |||
| 1119 | Ga0496109_0019715 | |||
| 1120 | Ga0496109_0299139 | |||
| 1121 | Ga0496110_0000462 | |||
| 1122 | Ga0496110_0266770 | |||
| 1123 | Ga0496112_0936729 | |||
| 1124 | Ga0496113_0099945 | |||
| 1125 | Ga0496113_0429224 | |||
| 1126 | Ga0496115_0199749 | |||
| 1127 | Ga0496121_0027483 | |||
| 1128 | Ga0496122_0001744 | |||
| 1129 | Ga0496123_0013972 | |||
| 1130 | Ga0496124_0023330 | |||
| 1131 | Ga0496124_0119587 | |||
| 1132 | Ga0496125_0017792 | |||
| 1133 | Ga0495678_000002 | |||
| 1134 | Ga0495678_000190 | |||
| 1135 | Ga0495678_000831 | |||
| 1136 | Ga0495678_002497 | |||
| 1137 | Ga0495678_003814 | |||
| 1138 | Ga0495678_036083 | |||
| 1139 | Ga0495678_055558 | |||
| 1140 | Ga0495682_0000199 | |||
| 1141 | Ga0495682_0001816 | |||
| 1142 | Ga0495682_0016499 | |||
| 1143 | Ga0495682_0065246 | |||
| 1144 | Ga0501222_013360 | |||
| 1145 | Ga0501269_014057 | |||
| 1146 | Ga0501279_008635 | |||
| 1147 | Ga0501279_062250 | |||
| 1148 | Ga0500572_056231 | |||
| 1149 | Ga0500594_0004952 | |||
| 1150 | Ga0500595_023498 | |||
| 1151 | Ga0500574_000678 | |||
| 1152 | Ga0500619_001205 | |||
| 1153 | 2643790772 | |||
| 1154 | 2644211694 | |||
| 1155 | 2644251348 | |||
| 1156 | 2644357451 | |||
| 1157 | 2738740046 | |||
| 1158 | 2738844198 | |||
| 1159 | 2739274242 | |||
| 1160 | 2739343286 | |||
| 1161 | 2819540777 | |||
| 1162 | 2904425654 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7qha-assembly1.cif.gz_A | cryo-em structure of the tripartite atp-independent periplasmic (trap) transporter siaqm from photobacterium profundum in amphipol | 0.8079 | 31 | 180 |
| 7qha-assembly1.cif.gz_A | cryo-em structure of the tripartite atp-independent periplasmic (trap) transporter siaqm from photobacterium profundum in amphipol | 0.7623 | 31 | 180 |
| 8thj-assembly1.cif.gz_B | cryo-em structure of the tripartite atp-independent periplasmic (trap) transporter siaqm from haemophilus influenzae (antiparallel dimer) | 0.76 | 30 | 190 |
| 8thj-assembly1.cif.gz_B | cryo-em structure of the tripartite atp-independent periplasmic (trap) transporter siaqm from haemophilus influenzae (antiparallel dimer) | 0.6499 | 30 | 190 |
| 4wpc-assembly1.cif.gz_B | crystal structure of rgd1p f-bar domain in complex with inositol phosphate | 0.4027 | 20 | 190 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P37674_16_146_1.20.120.550 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Membrane associated eicosanoid/glutathione metabolism-like domain | 0.861 | 47 | 178 | 1.20.120.550 |
| af_P37674_16_146_1.20.120.550 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Membrane associated eicosanoid/glutathione metabolism-like domain | 0.8435 | 47 | 178 | 1.20.120.550 |
| af_Q9W3L1_56_363_1.25.40.180 | Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat; | 0.7 | 23 | 91 | 1.25.40.180 |
| af_Q9VDT4_85_169_1.20.120.550 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Membrane associated eicosanoid/glutathione metabolism-like domain | 0.6686 | 17 | 91 | 1.20.120.550 |
| af_Q9VDT4_85_169_1.20.120.550 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Membrane associated eicosanoid/glutathione metabolism-like domain | 0.5141 | 17 | 91 | 1.20.120.550 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A661KE21-F1-model_v4 | TRAP transporter small permease | 0.9352 | 20 | 174 |
GO:0005886
GO:0015740 GO:0022857 |
| AF-A0A7Z8LMW6-F1-model_v4 | deleted | 0.9292 | 20 | 178 |
|
| AF-A0A1M7HH59-F1-model_v4 | TRAP transporter small permease protein | 0.9288 | 20 | 174 |
GO:0005886
GO:0015740 GO:0022857 |
| AF-A0A259L5A4-F1-model_v4 | TRAP transporter small permease protein | 0.926 | 17 | 177 |
GO:0005886
GO:0015740 GO:0022857 |
| AF-A0A7S9CZY3-F1-model_v4 | TRAP transporter small permease protein | 0.9241 | 19 | 173 |
GO:0005886
GO:0015740 GO:0022857 |