F466086

General Info

Members Datasets Scaffolds Average Seq Length
581 251 1162 190

Family's Representative Sequence

Representative Sequence 3300037312|Ga0395899_0004362|Ga0395899_0004362_6843_7445
Length 200
Sequence MAASTSLSRVILYDAARCPYCARARIVLAEKGLGYETLEIDLSDRPAWLYAKNPSGTVPVLEEDGGFVLPESLVIMEYLEERFPEPPLCPADPAERALGRLWLDRFDVRLGADYYALRRGEQSQLDDRLRELDAALEAQPFLSGREYGLADIGYVPWILRARSNLGVDLEPYPALSAWLERLSERPAIAAELELTAALGR

Samples

Sample ID Description Type Environment
1 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
4 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
9 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
10 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
11 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
12 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
13 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
14 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
15 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
16 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
17 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
18 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
19 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
20 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
21 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
22 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
23 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
24 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
25 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
26 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
27 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
28 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
29 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
30 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
31 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
32 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
33 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
34 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
35 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
36 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
37 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
38 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
39 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
40 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
41 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
42 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
43 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
44 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
45 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
46 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
47 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
48 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
49 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
50 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
51 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
52 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
53 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
54 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
55 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
56 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
57 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
58 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
59 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
60 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
61 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
62 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
63 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
64 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
65 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
66 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
67 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
68 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
69 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
70 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
71 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
72 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
73 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
74 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
75 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
76 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
77 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
78 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
79 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
80 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
81 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
82 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
83 3300012497 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 Metagenome Rhizosphere
84 3300012515 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610 Metagenome Rhizosphere
85 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
86 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
87 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
88 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
89 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
90 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
91 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
92 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
93 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
94 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
95 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
96 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
97 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
141 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
142 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
145 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
146 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
147 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
148 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
149 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
150 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
151 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
152 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
153 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
154 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
155 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
156 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
157 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
158 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
159 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
160 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
161 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
162 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
163 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
164 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
165 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
166 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
167 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
168 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
169 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
170 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
171 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
172 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
173 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
174 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
175 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
176 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
177 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
178 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
179 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
180 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
181 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
182 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
183 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
184 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
185 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
186 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
187 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
188 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
189 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
190 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
191 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
192 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
193 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
194 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
195 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
196 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
197 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
198 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
199 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
200 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
201 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
202 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
203 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
204 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
205 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
206 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
207 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
208 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
209 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
210 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
211 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
212 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
213 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
214 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
215 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
216 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
217 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
218 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
219 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
220 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
221 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
222 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
223 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
224 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
225 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
226 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
227 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
228 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
229 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
230 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
231 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
232 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
233 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
234 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
235 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
236 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
237 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
238 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
239 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
240 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
241 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
242 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
243 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
244 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
245 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
246 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
247 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
248 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
249 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
250 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
251 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.48
Metatranscriptomes 0.52
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.34
Nodule 0
Rhizoplane 14.8
Rhizosphere 84.17
Stem 0
Stem Tuber 0
Unclassified 10.84

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0395899_0004362 3300037312 Bacteria 11031
2 Ga0070683_100003779 3300005329 Bacteria 12360
3 Ga0070683_100300949 3300005329 Bacteria 1526
4 Ga0070690_100047125 3300005330 Bacteria 2741
5 Ga0070666_10416143 3300005335 Unclassified 968
6 Ga0070680_100351856 3300005336 Bacteria 1253
7 Ga0070682_100131664 3300005337 Bacteria 1693
8 Ga0070682_100756310 3300005337 Bacteria 785
9 Ga0068868_100032365 3300005338 Bacteria 4022
10 Ga0068868_100065268 3300005338 Bacteria 2891
11 Ga0068868_100146843 3300005338 Bacteria 1940
12 Ga0068868_100148858 3300005338 Bacteria 1927
13 Ga0070660_100105894 3300005339 Bacteria 2233
14 Ga0070660_100661609 3300005339 Bacteria 875
15 Ga0070687_100191612 3300005343 Bacteria 1232
16 Ga0070661_100926391 3300005344 Bacteria 720
17 Ga0070692_10034038 3300005345 Bacteria 2571
18 Ga0070692_10099968 3300005345 Bacteria 1589
19 Ga0070668_100015350 3300005347 Bacteria 5724
20 Ga0070668_100171123 3300005347 Bacteria 1769
21 Ga0070669_100256929 3300005353 Bacteria 1393
22 Ga0070671_100007150 3300005355 Bacteria 8920
23 Ga0070671_100239328 3300005355 Bacteria 1541
24 Ga0070674_100125748 3300005356 Bacteria 1904
25 Ga0070674_100607084 3300005356 Bacteria 925
26 Ga0070659_100662251 3300005366 Bacteria 901
27 Ga0070659_100837590 3300005366 Bacteria 801
28 Ga0070659_101217969 3300005366 Unclassified 666
29 Ga0070703_10002997 3300005406 Bacteria 4822
30 Ga0070703_10013734 3300005406 Bacteria 2302
31 Ga0070703_10090437 3300005406 Bacteria 1060
32 Ga0070709_10042356 3300005434 Unclassified 2811
33 Ga0070709_10057175 3300005434 Unclassified 2469
34 Ga0070714_100052839 3300005435 Bacteria 3466
35 Ga0070714_100531180 3300005435 Unclassified 1124
36 Ga0070713_100102226 3300005436 Bacteria 2485
37 Ga0070713_100174118 3300005436 Bacteria 1929
38 Ga0070713_100444922 3300005436 Bacteria 1216
39 Ga0070710_10001892 3300005437 Bacteria 9901
40 Ga0070710_10085960 3300005437 Bacteria 1846
41 Ga0070710_10271734 3300005437 Bacteria 1097
42 Ga0070701_10028430 3300005438 Bacteria 2748
43 Ga0070711_100051002 3300005439 Unclassified 2840
44 Ga0070711_100236523 3300005439 Bacteria 1426
45 Ga0070711_100641512 3300005439 Bacteria 890
46 Ga0070705_100001888 3300005440 Bacteria 10778
47 Ga0070705_100016540 3300005440 Bacteria 3833
48 Ga0070705_100163688 3300005440 Bacteria 1490
49 Ga0070700_100089754 3300005441 Bacteria 2003
50 Ga0070694_100016921 3300005444 Bacteria 4598
51 Ga0070694_100074760 3300005444 Bacteria 2342
52 Ga0070694_100937769 3300005444 Bacteria 716
53 Ga0070708_100012092 3300005445 Bacteria 7036
54 Ga0070708_100060348 3300005445 Bacteria 3384
55 Ga0070708_100215940 3300005445 Bacteria 1798
56 Ga0070708_100536309 3300005445 Bacteria 1104
57 Ga0070663_100141368 3300005455 Bacteria 1838
58 Ga0070678_100029492 3300005456 Bacteria 3757
59 Ga0070678_100042303 3300005456 Bacteria 3237
60 Ga0070678_100108129 3300005456 Bacteria 2170
61 Ga0070678_100195716 3300005456 Bacteria 1665
62 Ga0070662_100049105 3300005457 Bacteria 3042
63 Ga0070662_100070926 3300005457 Bacteria 2568
64 Ga0070681_10063348 3300005458 Bacteria 3669
65 Ga0070685_10044421 3300005466 Bacteria 2543
66 Ga0070706_100027143 3300005467 Bacteria 5268
67 Ga0070706_100182823 3300005467 Unclassified 1958
68 Ga0070706_100344486 3300005467 Unclassified 1389
69 Ga0070707_100174503 3300005468 Bacteria 2095
70 Ga0070707_100220358 3300005468 Unclassified 1848
71 Ga0070707_100225556 3300005468 Bacteria 1824
72 Ga0070707_100369868 3300005468 Bacteria 1393
73 Ga0070698_100021727 3300005471 Bacteria 6718
74 Ga0070698_100103396 3300005471 Bacteria 2819
75 Ga0070698_100318642 3300005471 Bacteria 1485
76 Ga0070699_100019148 3300005518 Bacteria 5888
77 Ga0070699_100087247 3300005518 Bacteria 2724
78 Ga0070679_100085076 3300005530 Bacteria 3150
79 Ga0070679_100282850 3300005530 Bacteria 1611
80 Ga0070679_100687776 3300005530 Bacteria 966
81 Ga0070679_100880482 3300005530 Unclassified 839
82 Ga0070684_100056281 3300005535 Bacteria 3432
83 Ga0070684_100183304 3300005535 Bacteria 1904
84 Ga0070697_100046278 3300005536 Bacteria 3526
85 Ga0070697_100456375 3300005536 Bacteria 1114
86 Ga0070686_100022434 3300005544 Bacteria 3760
87 Ga0070686_100188774 3300005544 Bacteria 1470
88 Ga0070695_100044837 3300005545 Bacteria 2817
89 Ga0070695_100111399 3300005545 Bacteria 1858
90 Ga0070696_100012039 3300005546 Bacteria 5795
91 Ga0070696_100111949 3300005546 Bacteria 1966
92 Ga0070696_100127222 3300005546 Bacteria 1850
93 Ga0070696_100460099 3300005546 Bacteria 1005
94 Ga0070693_100003024 3300005547 Bacteria 7797
95 Ga0070704_100024132 3300005549 Bacteria 3986
96 Ga0070704_100057040 3300005549 Unclassified 2775
97 Ga0070704_100095024 3300005549 Bacteria 2231
98 Ga0070704_100110322 3300005549 Bacteria 2092
99 Ga0070704_100665796 3300005549 Bacteria 920
100 Ga0068855_100017035 3300005563 Bacteria 8742
101 Ga0068855_100120380 3300005563 Bacteria 3004
102 Ga0068855_100344880 3300005563 Bacteria 1641
103 Ga0068855_100620135 3300005563 Bacteria 1165
104 Ga0068857_100931392 3300005577 Bacteria 834
105 Ga0068854_100044581 3300005578 Bacteria 3149
106 Ga0068856_100043929 3300005614 Bacteria 4396
107 Ga0068856_100109671 3300005614 Bacteria 2756
108 Ga0068856_100115342 3300005614 Bacteria 2686
109 Ga0068856_100378854 3300005614 Bacteria 1434
110 Ga0068852_100616123 3300005616 Bacteria 1091
111 Ga0068861_100054858 3300005719 Bacteria 3037
112 Ga0068861_100075367 3300005719 Bacteria 2626
113 Ga0068860_100195632 3300005843 Bacteria 1958
114 Ga0068862_101649440 3300005844 Bacteria 649
115 Ga0081455_10221975 3300005937 Bacteria 1400
116 Ga0081540_1000810 3300005983 Bacteria 28677
117 Ga0070717_10068649 3300006028 Bacteria 2951
118 Ga0070717_10158917 3300006028 Bacteria 1960
119 Ga0075432_10003889 3300006058 Bacteria 5087
120 Ga0075432_10014787 3300006058 Bacteria 2658
121 Ga0070715_10009445 3300006163 Bacteria 3438
122 Ga0070716_100024578 3300006173 Bacteria 3207
123 Ga0070716_100347565 3300006173 Bacteria 1048
124 Ga0070716_100348943 3300006173 Bacteria 1047
125 Ga0070716_100354972 3300006173 Bacteria 1039
126 Ga0070716_100566313 3300006173 Unclassified 849
127 Ga0070712_100008328 3300006175 Bacteria 6519
128 Ga0070712_100008932 3300006175 Bacteria 6311
129 Ga0070712_100024234 3300006175 Unclassified 4018
130 Ga0075367_10085838 3300006178 Bacteria 1910
131 Ga0097621_100029944 3300006237 Bacteria 4303
132 Ga0068871_100397032 3300006358 Bacteria 1227
133 Ga0075428_100216793 3300006844 Bacteria 2067
134 Ga0075428_100995538 3300006844 Bacteria 887
135 Ga0075431_100023638 3300006847 Bacteria 6290
136 Ga0075431_100048235 3300006847 Bacteria 4392
137 Ga0075431_100075812 3300006847 Bacteria 3471
138 Ga0075431_100867889 3300006847 Bacteria 873
139 Ga0075433_10001200 3300006852 Bacteria 18866
140 Ga0075433_10023147 3300006852 Bacteria 5225
141 Ga0075433_10071828 3300006852 Bacteria 3042
142 Ga0075433_10102448 3300006852 Bacteria 2535
143 Ga0075433_10434483 3300006852 Bacteria 1157
144 Ga0075434_100090395 3300006871 Bacteria 3063
145 Ga0075434_100151322 3300006871 Bacteria 2341
146 Ga0075434_100192269 3300006871 Bacteria 2061
147 Ga0075434_101011922 3300006871 Bacteria 845
148 Ga0075429_100211210 3300006880 Bacteria 1701
149 Ga0075436_100004195 3300006914 Bacteria 9888
150 Ga0075436_100019129 3300006914 Bacteria 4692
151 Ga0075436_100022849 3300006914 Unclassified 4296
152 Ga0075436_100126408 3300006914 Bacteria 1791
153 Ga0075436_100145396 3300006914 Bacteria 1667
154 Ga0075436_100299342 3300006914 Bacteria 1153
155 Ga0075435_100010351 3300007076 Bacteria 6819
156 Ga0075435_100013894 3300007076 Bacteria 6005
157 Ga0075435_100017555 3300007076 Bacteria 5420
158 Ga0075435_100063630 3300007076 Bacteria 2996
159 Ga0075435_100077994 3300007076 Bacteria 2716
160 Ga0075435_100172393 3300007076 Bacteria 1826
161 Ga0075435_100254090 3300007076 Bacteria 1496
162 Ga0075435_100599244 3300007076 Bacteria 955
163 Ga0105250_10281125 3300009092 Bacteria 716
164 Ga0105240_10155233 3300009093 Unclassified 2723
165 Ga0105240_10976018 3300009093 Bacteria 907
166 Ga0111539_10153442 3300009094 Bacteria 2695
167 Ga0111539_10758358 3300009094 Bacteria 1129
168 Ga0105245_10002778 3300009098 Bacteria 15736
169 Ga0105245_10031439 3300009098 Bacteria 4698
170 Ga0105245_10102363 3300009098 Bacteria 2652
171 Ga0105245_10264842 3300009098 Bacteria 1674
172 Ga0105245_10264945 3300009098 Bacteria 1674
173 Ga0105247_10172632 3300009101 Bacteria 1438
174 Ga0114129_10029361 3300009147 Bacteria 7790
175 Ga0114129_10043325 3300009147 Bacteria 6331
176 Ga0114129_10053266 3300009147 Bacteria 5675
177 Ga0114129_10149266 3300009147 Bacteria 3199
178 Ga0114129_10537886 3300009147 Bacteria 1521
179 Ga0105243_10053194 3300009148 Bacteria 3211
180 Ga0105243_10089530 3300009148 Bacteria 2530
181 Ga0105243_10499268 3300009148 Bacteria 1152
182 Ga0105241_10019954 3300009174 Bacteria 4947
183 Ga0105242_10070719 3300009176 Bacteria 2894
184 Ga0105242_10183327 3300009176 Bacteria 1848
185 Ga0105237_10321409 3300009545 Bacteria 1551
186 Ga0105249_10058386 3300009553 Bacteria 3536
187 Ga0105249_10236525 3300009553 Bacteria 1804
188 Ga0105239_10021736 3300010375 Bacteria 7072
189 Ga0105239_10062857 3300010375 Bacteria 4075
190 Ga0105239_10065234 3300010375 Bacteria 3998
191 Ga0105246_10200807 3300011119 Bacteria 1550
192 Ga0157319_1006442 3300012497 Unclassified 842
193 Ga0157338_1000810 3300012515 Bacteria 2029
194 Ga0157373_10308947 3300013100 Bacteria 1123
195 Ga0157374_10133661 3300013296 Bacteria 2403
196 Ga0157374_11104231 3300013296 Bacteria 814
197 Ga0157378_10602634 3300013297 Bacteria 1110
198 Ga0157378_11245624 3300013297 Bacteria 784
199 Ga0163162_10396882 3300013306 Bacteria 1512
200 Ga0157372_10046631 3300013307 Bacteria 4812
201 Ga0157372_10997766 3300013307 Bacteria 970
202 Ga0157375_10031296 3300013308 Bacteria 5027
203 Ga0157375_10103617 3300013308 Bacteria 2933
204 Ga0157375_10185383 3300013308 Bacteria 2234
205 Ga0157375_11255056 3300013308 Bacteria 870
206 Ga0163163_10664652 3300014325 Unclassified 1105
207 Ga0157379_10134796 3300014968 Bacteria 2224
208 Ga0163161_10121658 3300017792 Bacteria 1962
209 Ga0163161_10722219 3300017792 Bacteria 831
210 Ga0206356_11391349 3300020070 Bacteria 941
211 Ga0206354_10317343 3300020081 Bacteria 927
212 Ga0206353_10769134 3300020082 Bacteria 1147
213 Ga0207653_10001167 3300025885 Bacteria 8587
214 Ga0207692_10056898 3300025898 Bacteria 2008
215 Ga0207692_10119336 3300025898 Bacteria 1474
216 Ga0207642_10025089 3300025899 Bacteria 2406
217 Ga0207710_10178811 3300025900 Bacteria 1040
218 Ga0207688_10178852 3300025901 Bacteria 1264
219 Ga0207685_10114081 3300025905 Bacteria 1176
220 Ga0207699_10054958 3300025906 Bacteria 2367
221 Ga0207699_10056537 3300025906 Bacteria 2339
222 Ga0207699_10115276 3300025906 Unclassified 1729
223 Ga0207699_10127969 3300025906 Bacteria 1652
224 Ga0207699_10127978 3300025906 Unclassified 1652
225 Ga0207645_10232302 3300025907 Bacteria 1217
226 Ga0207684_10033580 3300025910 Bacteria 4363
227 Ga0207684_10384784 3300025910 Bacteria 1206
228 Ga0207654_10029536 3300025911 Bacteria 3003
229 Ga0207654_10089017 3300025911 Bacteria 1877
230 Ga0207695_10258811 3300025913 Unclassified 1638
231 Ga0207671_10103492 3300025914 Bacteria 2159
232 Ga0207693_10004302 3300025915 Bacteria 12057
233 Ga0207693_10008936 3300025915 Bacteria 8177
234 Ga0207693_10012976 3300025915 Bacteria 6723
235 Ga0207693_10240021 3300025915 Bacteria 1423
236 Ga0207663_10024258 3300025916 Bacteria 3492
237 Ga0207662_10149415 3300025918 Bacteria 1485
238 Ga0207662_10164372 3300025918 Bacteria 1420
239 Ga0207657_10088372 3300025919 Bacteria 2590
240 Ga0207657_10127298 3300025919 Bacteria 2091
241 Ga0207652_10109632 3300025921 Bacteria 2447
242 Ga0207652_10466286 3300025921 Bacteria 1138
243 Ga0207652_10481059 3300025921 Bacteria 1118
244 Ga0207646_10281345 3300025922 Bacteria 1503
245 Ga0207687_10022634 3300025927 Bacteria 4184
246 Ga0207687_10040931 3300025927 Bacteria 3179
247 Ga0207687_10183686 3300025927 Bacteria 1622
248 Ga0207687_10604021 3300025927 Bacteria 925
249 Ga0207700_10076490 3300025928 Bacteria 2597
250 Ga0207700_10128668 3300025928 Bacteria 2064
251 Ga0207700_10278411 3300025928 Unclassified 1438
252 Ga0207664_10421825 3300025929 Bacteria 1188
253 Ga0207644_10111852 3300025931 Bacteria 2066
254 Ga0207644_10170025 3300025931 Bacteria 1701
255 Ga0207706_10001221 3300025933 Bacteria 25963
256 Ga0207706_10003559 3300025933 Bacteria 14877
257 Ga0207706_10028537 3300025933 Bacteria 4983
258 Ga0207686_10105471 3300025934 Bacteria 1890
259 Ga0207686_10306349 3300025934 Bacteria 1181
260 Ga0207709_10037046 3300025935 Unclassified 2896
261 Ga0207709_10048241 3300025935 Bacteria 2594
262 Ga0207669_10053796 3300025937 Bacteria 2428
263 Ga0207669_10184905 3300025937 Bacteria 1498
264 Ga0207704_10079810 3300025938 Bacteria 2110
265 Ga0207665_10000307 3300025939 Bacteria 33940
266 Ga0207665_10000521 3300025939 Bacteria 26018
267 Ga0207665_10002728 3300025939 Bacteria 11847
268 Ga0207665_10266292 3300025939 Bacteria 1271
269 Ga0207665_10364757 3300025939 Bacteria 1093
270 Ga0207661_10002339 3300025944 Bacteria 13055
271 Ga0207661_10445974 3300025944 Bacteria 1178
272 Ga0207679_11029789 3300025945 Bacteria 755
273 Ga0207667_10097604 3300025949 Bacteria 3032
274 Ga0207667_10121421 3300025949 Bacteria 2692
275 Ga0207667_10552022 3300025949 Bacteria 1165
276 Ga0207712_10150376 3300025961 Bacteria 1798
277 Ga0207640_10011583 3300025981 Bacteria 4998
278 Ga0207640_10063828 3300025981 Bacteria 2449
279 Ga0207658_10179596 3300025986 Bacteria 1751
280 Ga0207639_10123550 3300026041 Bacteria 2131
281 Ga0207678_10022584 3300026067 Bacteria 5510
282 Ga0207678_10519896 3300026067 Bacteria 1039
283 Ga0207708_10042991 3300026075 Bacteria 3443
284 Ga0207702_10003927 3300026078 Bacteria 13383
285 Ga0207702_10207184 3300026078 Bacteria 1821
286 Ga0207702_10481760 3300026078 Unclassified 1207
287 Ga0207641_10772037 3300026088 Bacteria 950
288 Ga0207648_10002219 3300026089 Bacteria 21056
289 Ga0207676_10458662 3300026095 Bacteria 1203
290 Ga0207675_100001149 3300026118 Bacteria 26254
291 Ga0207675_100078966 3300026118 Bacteria 3084
292 Ga0207675_100292860 3300026118 Bacteria 1584
293 Ga0207683_10001390 3300026121 Bacteria 21825
294 Ga0207683_10006151 3300026121 Bacteria 10286
295 Ga0207683_10087635 3300026121 Bacteria 2769
296 Ga0209966_1063036 3300027695 Bacteria 803
297 Ga0207428_10010540 3300027907 Bacteria 8251
298 Ga0207428_10020810 3300027907 Bacteria 5564
299 Ga0207428_10477083 3300027907 Bacteria 908
300 Ga0268265_10444195 3300028380 Bacteria 1210
301 Ga0268264_10041157 3300028381 Bacteria 3820
302 Ga0307406_10345731 3300031901 Bacteria 1160
303 Ga0307409_100087287 3300031995 Bacteria 2542
304 Ga0307416_100050250 3300032002 Bacteria 3323
305 Ga0307416_100393332 3300032002 Bacteria 1421
306 Ga0307415_100209700 3300032126 Bacteria 1553
307 Ga0373930_0031274 3300034816 Unclassified 1096
308 Ga0373948_0008247 3300034817 Bacteria 1770
309 Ga0373950_0008994 3300034818 Bacteria 1583
310 Ga0373958_0005999 3300034819 Bacteria 1873
311 Ga0373938_0001562 3300034957 Bacteria 3678
312 Ga0373926_0054226 3300035083 Unclassified 1452
313 Ga0373926_0081797 3300035083 Unclassified 1195
314 Ga0373928_0077796 3300035084 Unclassified 831
315 Ga0373940_0003840 3300035088 Bacteria 3115
316 Ga0373949_0019807 3300035090 Bacteria 1535
317 Ga0373951_0001533 3300035091 Bacteria 6043
318 Ga0373951_0048978 3300035091 Bacteria 1036
319 Ga0373932_0009196 3300035112 Bacteria 2372
320 Ga0373939_0000461 3300035114 Bacteria 10288
321 Ga0373939_0082294 3300035114 Bacteria 1071
322 Ga0373941_0007787 3300035115 Bacteria 2635
323 Ga0373960_0012115 3300035121 Bacteria 2138
324 Ga0373960_0028113 3300035121 Bacteria 1549
325 Ga0373943_0001021 3300035170 Bacteria 12425
326 Ga0373946_0379547 3300035171 Bacteria 711
327 Ga0373942_0062582 3300035207 Unclassified 1069
328 Ga0373961_0003394 3300035241 Unclassified 3948
329 Ga0373961_0043276 3300035241 Bacteria 1309
330 Ga0373962_0017398 3300035242 Bacteria 1863
331 Ga0373962_0194441 3300035242 Bacteria 684
332 Ga0373931_0017033 3300035691 Bacteria 3586
333 Ga0373935_0976586 3300035692 Bacteria 629
334 Ga0373947_0003634 3300035725 Bacteria 9097
335 Ga0373925_0005450 3300037068 Bacteria 9476
336 Ga0373925_0412328 3300037068 Unclassified 1103
337 Ga0395899_0004249 3300037312 Bacteria 11217
338 Ga0395899_0004495 3300037312 Bacteria 10870
339 Ga0395899_0006240 3300037312 Bacteria 9234
340 Ga0395899_0017795 3300037312 Bacteria 5411
341 Ga0395899_0027274 3300037312 Bacteria 4307
342 Ga0395899_0031787 3300037312 Bacteria 3966
343 Ga0395899_0270247 3300037312 Bacteria 1160
344 Ga0395899_0332324 3300037312 Bacteria 1021
345 Ga0395899_0387493 3300037312 Bacteria 927
346 Ga0395899_0598332 3300037312 Bacteria 703
347 Ga0395900_0002765 3300037418 Bacteria 19170
348 Ga0395900_0004350 3300037418 Bacteria 15029
349 Ga0395900_0004424 3300037418 Bacteria 14903
350 Ga0395900_0008694 3300037418 Bacteria 10432
351 Ga0395900_0014038 3300037418 Bacteria 8179
352 Ga0395900_0016723 3300037418 Bacteria 7482
353 Ga0395900_0019843 3300037418 Bacteria 6852
354 Ga0395900_0024405 3300037418 Bacteria 6191
355 Ga0395900_0045120 3300037418 Bacteria 4540
356 Ga0395900_0063530 3300037418 Bacteria 3795
357 Ga0395900_0181439 3300037418 Bacteria 2139
358 Ga0395900_0195647 3300037418 Bacteria 2049
359 Ga0395900_0587196 3300037418 Bacteria 1055
360 Ga0395900_0874212 3300037418 Unclassified 823
361 Ga0395900_1038193 3300037418 Unclassified 739
362 Ga0395898_0001749 3300037466 Bacteria 28586
363 Ga0395898_0002407 3300037466 Bacteria 22199
364 Ga0395898_0004246 3300037466 Bacteria 15712
365 Ga0395898_0013133 3300037466 Bacteria 8537
366 Ga0395898_0017258 3300037466 Bacteria 7372
367 Ga0395898_0034060 3300037466 Bacteria 5079
368 Ga0395898_0041096 3300037466 Bacteria 4569
369 Ga0395898_0059081 3300037466 Bacteria 3732
370 Ga0395898_0120081 3300037466 Bacteria 2518
371 Ga0395898_0236649 3300037466 Bacteria 1741
372 Ga0395898_0464944 3300037466 Bacteria 1204
373 Ga0395898_0676794 3300037466 Unclassified 974
374 Ga0395898_0724962 3300037466 Bacteria 936
375 Ga0395898_0744433 3300037466 Unclassified 921
376 Ga0395905_0002435 3300037471 Bacteria 20625
377 Ga0395905_0025454 3300037471 Bacteria 5580
378 Ga0395905_0026890 3300037471 Bacteria 5426
379 Ga0395905_0030670 3300037471 Bacteria 5064
380 Ga0395905_0040399 3300037471 Bacteria 4376
381 Ga0395905_0045236 3300037471 Bacteria 4128
382 Ga0395905_0056703 3300037471 Bacteria 3664
383 Ga0395905_0166020 3300037471 Bacteria 2074
384 Ga0395905_0325404 3300037471 Bacteria 1427
385 Ga0395905_0414850 3300037471 Bacteria 1242
386 Ga0395901_0000731 3300038443 Bacteria 37223
387 Ga0395901_0000894 3300038443 Bacteria 32754
388 Ga0395901_0005799 3300038443 Bacteria 12512
389 Ga0395901_0008200 3300038443 Bacteria 10555
390 Ga0395901_0009713 3300038443 Bacteria 9757
391 Ga0395901_0012894 3300038443 Bacteria 8476
392 Ga0395901_0078607 3300038443 Unclassified 3444
393 Ga0395901_0095259 3300038443 Bacteria 3119
394 Ga0395901_0105716 3300038443 Unclassified 2954
395 Ga0395901_0285582 3300038443 Bacteria 1713
396 Ga0395901_0458205 3300038443 Unclassified 1303
397 Ga0395901_0478326 3300038443 Bacteria 1271
398 Ga0395901_0490207 3300038443 Bacteria 1252
399 Ga0395901_0747873 3300038443 Bacteria 971
400 Ga0395901_0748624 3300038443 Bacteria 970
401 Ga0451789_1225116 3300041443 Unclassified 2381
402 Ga0451791_0247881 3300041451 Unclassified 634
403 Ga0451793_1663085 3300041452 Bacteria 931
404 Ga0451807_1469250 3300041486 Unclassified 1054
405 Ga0451845_0281746 3300041501 Bacteria 935
406 Ga0451843_1138294 3300041509 Unclassified 835
407 Ga0451855_1961103 3300041511 Bacteria 2033
408 Ga0451853_0826326 3300041512 Unclassified 2952
409 Ga0466965_0152309 3300044683 Unclassified 1209
410 Ga0466963_0002929 3300044694 Bacteria 9648
411 Ga0466964_0058635 3300044706 Unclassified 1596
412 Ga0466964_0290949 3300044706 Bacteria 820
413 Ga0466964_0588133 3300044706 Unclassified 609
414 Ga0466971_0429904 3300044719 Bacteria 646
415 Ga0466968_0054145 3300044735 Bacteria 1720
416 Ga0466960_0521373 3300044901 Bacteria 698
417 Ga0451576_0012434 3300045051 Bacteria 9560
418 Ga0451576_0877292 3300045051 Bacteria 942
419 Ga0466967_0025707 3300045976 Bacteria 4858
420 Ga0466967_0030392 3300045976 Bacteria 4533
421 Ga0466967_0436919 3300045976 Unclassified 1277
422 Ga0466967_0532866 3300045976 Bacteria 1155
423 Ga0466967_0763651 3300045976 Bacteria 959
424 Ga0495627_094510 3300046453 Bacteria 858
425 Ga0495603_0000243 3300046455 Bacteria 28326
426 Ga0495641_0000872 3300046461 Bacteria 25940
427 Ga0495582_0004385 3300046473 Bacteria 7936
428 Ga0495582_0099587 3300046473 Bacteria 1627
429 Ga0495639_0143176 3300046475 Unclassified 1150
430 Ga0495594_0001652 3300046499 Bacteria 11596
431 Ga0495596_0191596 3300046500 Bacteria 795
432 Ga0495628_0173206 3300046516 Bacteria 1636
433 Ga0495630_0182635 3300046517 Bacteria 1600
434 Ga0495663_0077456 3300046525 Unclassified 1066
435 Ga0495663_0098632 3300046525 Bacteria 960
436 Ga0495666_0040238 3300046526 Unclassified 2267
437 Ga0495642_0050955 3300046528 Unclassified 1703
438 Ga0495642_0284773 3300046528 Bacteria 724
439 Ga0495622_0038288 3300046557 Bacteria 2233
440 Ga0495668_0090693 3300046616 Bacteria 1675
441 Ga0495668_0346180 3300046616 Bacteria 816
442 Ga0495611_0121176 3300046648 Bacteria 1220
443 Ga0495588_0000529 3300046674 Bacteria 18424
444 Ga0495657_0296524 3300046675 Bacteria 965
445 Ga0495647_0046201 3300046681 Bacteria 1676
446 Ga0495658_0218382 3300046683 Bacteria 1193
447 Ga0495676_0000737 3300047321 Bacteria 27247
448 Ga0495676_0209781 3300047321 Bacteria 1348
449 Ga0495685_029487 3300047447 Bacteria 1887
450 Ga0496100_0010932 3300048903 Bacteria 5150
451 Ga0496100_0167867 3300048903 Bacteria 1578
452 Ga0496100_0417172 3300048903 Bacteria 1024
453 Ga0496101_0028355 3300048904 Bacteria 3907
454 Ga0496101_0033642 3300048904 Bacteria 3616
455 Ga0496101_0120892 3300048904 Unclassified 1980
456 Ga0496101_0167210 3300048904 Bacteria 1689
457 Ga0496101_0247003 3300048904 Bacteria 1390
458 Ga0496101_0280327 3300048904 Bacteria 1302
459 Ga0496102_0014674 3300048905 Bacteria 6811
460 Ga0496102_0141575 3300048905 Bacteria 2255
461 Ga0496102_0162808 3300048905 Bacteria 2099
462 Ga0496102_0336551 3300048905 Bacteria 1421
463 Ga0496103_0046821 3300048906 Bacteria 2670
464 Ga0496103_0054967 3300048906 Bacteria 2468
465 Ga0496103_0252934 3300048906 Bacteria 1134
466 Ga0496103_0568036 3300048906 Bacteria 723
467 Ga0496104_0004450 3300048907 Bacteria 12206
468 Ga0496104_0004977 3300048907 Bacteria 11604
469 Ga0496104_0016814 3300048907 Bacteria 6648
470 Ga0496104_0025488 3300048907 Bacteria 5451
471 Ga0496104_0177608 3300048907 Bacteria 2039
472 Ga0496104_0187768 3300048907 Bacteria 1977
473 Ga0496104_0476071 3300048907 Bacteria 1160
474 Ga0496105_0000999 3300048908 Bacteria 19540
475 Ga0496105_0005292 3300048908 Bacteria 9781
476 Ga0496105_0008233 3300048908 Bacteria 8106
477 Ga0496105_0042423 3300048908 Bacteria 3750
478 Ga0496105_0125199 3300048908 Bacteria 2118
479 Ga0496106_0023276 3300048909 Bacteria 4601
480 Ga0496106_0077135 3300048909 Bacteria 2555
481 Ga0496106_0236325 3300048909 Unclassified 1460
482 Ga0496106_0374235 3300048909 Bacteria 1145
483 Ga0496107_0040596 3300048910 Bacteria 3340
484 Ga0496107_0051965 3300048910 Bacteria 2956
485 Ga0496107_0145167 3300048910 Bacteria 1754
486 Ga0496107_0307163 3300048910 Bacteria 1181
487 Ga0496107_0382247 3300048910 Bacteria 1047
488 Ga0496107_0629187 3300048910 Bacteria 792
489 Ga0496107_0690357 3300048910 Bacteria 751
490 Ga0496108_0017669 3300048911 Bacteria 5836
491 Ga0496108_0045384 3300048911 Bacteria 3671
492 Ga0496108_0048405 3300048911 Bacteria 3554
493 Ga0496108_0086636 3300048911 Bacteria 2659
494 Ga0496108_0434525 3300048911 Bacteria 1146
495 Ga0496109_0006730 3300048912 Bacteria 9678
496 Ga0496109_0088203 3300048912 Bacteria 2866
497 Ga0496109_0105306 3300048912 Bacteria 2619
498 Ga0496109_0182270 3300048912 Bacteria 1973
499 Ga0496109_0193795 3300048912 Bacteria 1909
500 Ga0496109_0467823 3300048912 Bacteria 1191
501 Ga0496110_0013334 3300048913 Bacteria 6791
502 Ga0496110_0023061 3300048913 Bacteria 5293
503 Ga0496110_0049826 3300048913 Bacteria 3676
504 Ga0496110_0098265 3300048913 Bacteria 2623
505 Ga0496110_0254501 3300048913 Bacteria 1598
506 Ga0496111_0005707 3300048914 Bacteria 8021
507 Ga0496111_0017285 3300048914 Bacteria 4985
508 Ga0496111_0038138 3300048914 Bacteria 3441
509 Ga0496111_0119260 3300048914 Bacteria 1948
510 Ga0496111_0134639 3300048914 Bacteria 1830
511 Ga0496112_0003043 3300048915 Bacteria 13720
512 Ga0496112_0019947 3300048915 Bacteria 6344
513 Ga0496112_0021125 3300048915 Bacteria 6185
514 Ga0496112_0142675 3300048915 Bacteria 2364
515 Ga0496112_0448147 3300048915 Bacteria 1228
516 Ga0496112_0656208 3300048915 Bacteria 979
517 Ga0496112_1147601 3300048915 Unclassified 694
518 Ga0496113_0011961 3300048916 Bacteria 5817
519 Ga0496113_0012797 3300048916 Bacteria 5654
520 Ga0496113_0070391 3300048916 Bacteria 2659
521 Ga0496113_0139972 3300048916 Bacteria 1903
522 Ga0496113_0142545 3300048916 Unclassified 1886
523 Ga0496113_0301233 3300048916 Bacteria 1283
524 Ga0496114_0002354 3300048917 Bacteria 14389
525 Ga0496114_0060650 3300048917 Bacteria 3162
526 Ga0496114_0199744 3300048917 Unclassified 1751
527 Ga0496114_0603741 3300048917 Bacteria 967
528 Ga0496115_0008765 3300048918 Bacteria 7497
529 Ga0496115_0087994 3300048918 Bacteria 2535
530 Ga0496115_0384331 3300048918 Bacteria 1141
531 Ga0496115_0482777 3300048918 Bacteria 998
532 Ga0501034_0155224 3300049571 Unclassified 2263
533 Ga0501043_0979240 3300049579 Bacteria 603
534 Ga0501067_0050933 3300049583 Unclassified 2295
535 Ga0501068_0692769 3300049584 Bacteria 666
536 Ga0501070_0052238 3300049586 Bacteria 3392
537 Ga0501071_0173175 3300049587 Bacteria 1616
538 Ga0501072_0046361 3300049588 Bacteria 3421
539 Ga0501074_0014579 3300049590 Bacteria 5718
540 Ga0501075_0220522 3300049591 Unclassified 1447
541 Ga0501076_0617018 3300049592 Bacteria 895
542 Ga0501079_0880520 3300049741 Bacteria 705
543 Ga0501080_0011263 3300049742 Bacteria 8186
544 Ga0501080_0530311 3300049742 Bacteria 1050
545 Ga0501081_0214312 3300049743 Bacteria 1399
546 Ga0501083_0463851 3300049744 Bacteria 824
547 nmdc:mga03n38_465332_c1 3300050490 Bacteria 705
548 nmdc:mga05p37_212655_c1 3300050507 Bacteria 2337
549 nmdc:mga05p37_24784_c1 3300050507 Bacteria 7292
550 nmdc:mga05p37_252475_c1 3300050507 Unclassified 2115
551 nmdc:mga05p37_561849_c1 3300050507 Bacteria 1296
552 nmdc:mga05p37_62533_c1 3300050507 Bacteria 4581
553 nmdc:mga09592_473075_c1 3300050508 Bacteria 1080
554 nmdc:mga06r32_115489_c1 3300050510 Bacteria 2644
555 nmdc:mga08y16_123632_c1 3300050511 Bacteria 2693
556 nmdc:mga08y16_133966_c1 3300050511 Bacteria 2575
557 nmdc:mga08y16_1606617_c1 3300050511 Bacteria 608
558 nmdc:mga08y16_512431_c1 3300050511 Bacteria 1218
559 nmdc:mga0n895_11107_c1 3300050512 Bacteria 8015
560 nmdc:mga0n895_1182095_c1 3300050512 Bacteria 739
561 nmdc:mga0n895_121542_c1 3300050512 Bacteria 2633
562 nmdc:mga0n895_189599_c1 3300050512 Bacteria 2087
563 nmdc:mga0n895_194434_c1 3300050512 Unclassified 2060
564 nmdc:mga0n895_86413_c1 3300050512 Bacteria 3133
565 nmdc:mga0rr50_12461_c1 3300050513 Bacteria 5500
566 nmdc:mga0rr50_15462_c1 3300050513 Bacteria 5039
567 nmdc:mga0rr50_227903_c1 3300050513 Bacteria 1541
568 nmdc:mga0rr50_383135_c1 3300050513 Bacteria 1186
569 nmdc:mga0rr50_450992_c1 3300050513 Bacteria 1090
570 nmdc:mga0rr50_73753_c1 3300050513 Bacteria 2610
571 nmdc:mga0rr50_9961_c1 3300050513 Bacteria 6008
572 nmdc:mga08x19_17012_c1 3300050514 Unclassified 4444
573 nmdc:mga08x19_17418_c1 3300050514 Bacteria 4395
574 nmdc:mga08x19_31908_c1 3300050514 Unclassified 3318
575 nmdc:mga08x19_675199_c1 3300050514 Bacteria 733
576 nmdc:mga0a205_132808_c1 3300050515 Unclassified 2390
577 nmdc:mga0a205_210357_c1 3300050515 Bacteria 1834
578 nmdc:mga0a205_300008_c1 3300050515 Bacteria 1480
579 nmdc:mga0a205_41107_c2 3300050515 Bacteria 2857
580 nmdc:mga0a205_507767_c1 3300050515 Bacteria 1062
581 Ga0501084_0327854 3300054114 Bacteria 1293
582 Ga0395899_0004362
583 Ga0070683_100003779
584 Ga0070683_100300949
585 Ga0070690_100047125
586 Ga0070666_10416143
587 Ga0070680_100351856
588 Ga0070682_100131664
589 Ga0070682_100756310
590 Ga0068868_100032365
591 Ga0068868_100065268
592 Ga0068868_100146843
593 Ga0068868_100148858
594 Ga0070660_100105894
595 Ga0070660_100661609
596 Ga0070687_100191612
597 Ga0070661_100926391
598 Ga0070692_10034038
599 Ga0070692_10099968
600 Ga0070668_100015350
601 Ga0070668_100171123
602 Ga0070669_100256929
603 Ga0070671_100007150
604 Ga0070671_100239328
605 Ga0070674_100125748
606 Ga0070674_100607084
607 Ga0070659_100662251
608 Ga0070659_100837590
609 Ga0070659_101217969
610 Ga0070703_10002997
611 Ga0070703_10013734
612 Ga0070703_10090437
613 Ga0070709_10042356
614 Ga0070709_10057175
615 Ga0070714_100052839
616 Ga0070714_100531180
617 Ga0070713_100102226
618 Ga0070713_100174118
619 Ga0070713_100444922
620 Ga0070710_10001892
621 Ga0070710_10085960
622 Ga0070710_10271734
623 Ga0070701_10028430
624 Ga0070711_100051002
625 Ga0070711_100236523
626 Ga0070711_100641512
627 Ga0070705_100001888
628 Ga0070705_100016540
629 Ga0070705_100163688
630 Ga0070700_100089754
631 Ga0070694_100016921
632 Ga0070694_100074760
633 Ga0070694_100937769
634 Ga0070708_100012092
635 Ga0070708_100060348
636 Ga0070708_100215940
637 Ga0070708_100536309
638 Ga0070663_100141368
639 Ga0070678_100029492
640 Ga0070678_100042303
641 Ga0070678_100108129
642 Ga0070678_100195716
643 Ga0070662_100049105
644 Ga0070662_100070926
645 Ga0070681_10063348
646 Ga0070685_10044421
647 Ga0070706_100027143
648 Ga0070706_100182823
649 Ga0070706_100344486
650 Ga0070707_100174503
651 Ga0070707_100220358
652 Ga0070707_100225556
653 Ga0070707_100369868
654 Ga0070698_100021727
655 Ga0070698_100103396
656 Ga0070698_100318642
657 Ga0070699_100019148
658 Ga0070699_100087247
659 Ga0070679_100085076
660 Ga0070679_100282850
661 Ga0070679_100687776
662 Ga0070679_100880482
663 Ga0070684_100056281
664 Ga0070684_100183304
665 Ga0070697_100046278
666 Ga0070697_100456375
667 Ga0070686_100022434
668 Ga0070686_100188774
669 Ga0070695_100044837
670 Ga0070695_100111399
671 Ga0070696_100012039
672 Ga0070696_100111949
673 Ga0070696_100127222
674 Ga0070696_100460099
675 Ga0070693_100003024
676 Ga0070704_100024132
677 Ga0070704_100057040
678 Ga0070704_100095024
679 Ga0070704_100110322
680 Ga0070704_100665796
681 Ga0068855_100017035
682 Ga0068855_100120380
683 Ga0068855_100344880
684 Ga0068855_100620135
685 Ga0068857_100931392
686 Ga0068854_100044581
687 Ga0068856_100043929
688 Ga0068856_100109671
689 Ga0068856_100115342
690 Ga0068856_100378854
691 Ga0068852_100616123
692 Ga0068861_100054858
693 Ga0068861_100075367
694 Ga0068860_100195632
695 Ga0068862_101649440
696 Ga0081455_10221975
697 Ga0081540_1000810
698 Ga0070717_10068649
699 Ga0070717_10158917
700 Ga0075432_10003889
701 Ga0075432_10014787
702 Ga0070715_10009445
703 Ga0070716_100024578
704 Ga0070716_100347565
705 Ga0070716_100348943
706 Ga0070716_100354972
707 Ga0070716_100566313
708 Ga0070712_100008328
709 Ga0070712_100008932
710 Ga0070712_100024234
711 Ga0075367_10085838
712 Ga0097621_100029944
713 Ga0068871_100397032
714 Ga0075428_100216793
715 Ga0075428_100995538
716 Ga0075431_100023638
717 Ga0075431_100048235
718 Ga0075431_100075812
719 Ga0075431_100867889
720 Ga0075433_10001200
721 Ga0075433_10023147
722 Ga0075433_10071828
723 Ga0075433_10102448
724 Ga0075433_10434483
725 Ga0075434_100090395
726 Ga0075434_100151322
727 Ga0075434_100192269
728 Ga0075434_101011922
729 Ga0075429_100211210
730 Ga0075436_100004195
731 Ga0075436_100019129
732 Ga0075436_100022849
733 Ga0075436_100126408
734 Ga0075436_100145396
735 Ga0075436_100299342
736 Ga0075435_100010351
737 Ga0075435_100013894
738 Ga0075435_100017555
739 Ga0075435_100063630
740 Ga0075435_100077994
741 Ga0075435_100172393
742 Ga0075435_100254090
743 Ga0075435_100599244
744 Ga0105250_10281125
745 Ga0105240_10155233
746 Ga0105240_10976018
747 Ga0111539_10153442
748 Ga0111539_10758358
749 Ga0105245_10002778
750 Ga0105245_10031439
751 Ga0105245_10102363
752 Ga0105245_10264842
753 Ga0105245_10264945
754 Ga0105247_10172632
755 Ga0114129_10029361
756 Ga0114129_10043325
757 Ga0114129_10053266
758 Ga0114129_10149266
759 Ga0114129_10537886
760 Ga0105243_10053194
761 Ga0105243_10089530
762 Ga0105243_10499268
763 Ga0105241_10019954
764 Ga0105242_10070719
765 Ga0105242_10183327
766 Ga0105237_10321409
767 Ga0105249_10058386
768 Ga0105249_10236525
769 Ga0105239_10021736
770 Ga0105239_10062857
771 Ga0105239_10065234
772 Ga0105246_10200807
773 Ga0157319_1006442
774 Ga0157338_1000810
775 Ga0157373_10308947
776 Ga0157374_10133661
777 Ga0157374_11104231
778 Ga0157378_10602634
779 Ga0157378_11245624
780 Ga0163162_10396882
781 Ga0157372_10046631
782 Ga0157372_10997766
783 Ga0157375_10031296
784 Ga0157375_10103617
785 Ga0157375_10185383
786 Ga0157375_11255056
787 Ga0163163_10664652
788 Ga0157379_10134796
789 Ga0163161_10121658
790 Ga0163161_10722219
791 Ga0206356_11391349
792 Ga0206354_10317343
793 Ga0206353_10769134
794 Ga0207653_10001167
795 Ga0207692_10056898
796 Ga0207692_10119336
797 Ga0207642_10025089
798 Ga0207710_10178811
799 Ga0207688_10178852
800 Ga0207685_10114081
801 Ga0207699_10054958
802 Ga0207699_10056537
803 Ga0207699_10115276
804 Ga0207699_10127969
805 Ga0207699_10127978
806 Ga0207645_10232302
807 Ga0207684_10033580
808 Ga0207684_10384784
809 Ga0207654_10029536
810 Ga0207654_10089017
811 Ga0207695_10258811
812 Ga0207671_10103492
813 Ga0207693_10004302
814 Ga0207693_10008936
815 Ga0207693_10012976
816 Ga0207693_10240021
817 Ga0207663_10024258
818 Ga0207662_10149415
819 Ga0207662_10164372
820 Ga0207657_10088372
821 Ga0207657_10127298
822 Ga0207652_10109632
823 Ga0207652_10466286
824 Ga0207652_10481059
825 Ga0207646_10281345
826 Ga0207687_10022634
827 Ga0207687_10040931
828 Ga0207687_10183686
829 Ga0207687_10604021
830 Ga0207700_10076490
831 Ga0207700_10128668
832 Ga0207700_10278411
833 Ga0207664_10421825
834 Ga0207644_10111852
835 Ga0207644_10170025
836 Ga0207706_10001221
837 Ga0207706_10003559
838 Ga0207706_10028537
839 Ga0207686_10105471
840 Ga0207686_10306349
841 Ga0207709_10037046
842 Ga0207709_10048241
843 Ga0207669_10053796
844 Ga0207669_10184905
845 Ga0207704_10079810
846 Ga0207665_10000307
847 Ga0207665_10000521
848 Ga0207665_10002728
849 Ga0207665_10266292
850 Ga0207665_10364757
851 Ga0207661_10002339
852 Ga0207661_10445974
853 Ga0207679_11029789
854 Ga0207667_10097604
855 Ga0207667_10121421
856 Ga0207667_10552022
857 Ga0207712_10150376
858 Ga0207640_10011583
859 Ga0207640_10063828
860 Ga0207658_10179596
861 Ga0207639_10123550
862 Ga0207678_10022584
863 Ga0207678_10519896
864 Ga0207708_10042991
865 Ga0207702_10003927
866 Ga0207702_10207184
867 Ga0207702_10481760
868 Ga0207641_10772037
869 Ga0207648_10002219
870 Ga0207676_10458662
871 Ga0207675_100001149
872 Ga0207675_100078966
873 Ga0207675_100292860
874 Ga0207683_10001390
875 Ga0207683_10006151
876 Ga0207683_10087635
877 Ga0209966_1063036
878 Ga0207428_10010540
879 Ga0207428_10020810
880 Ga0207428_10477083
881 Ga0268265_10444195
882 Ga0268264_10041157
883 Ga0307406_10345731
884 Ga0307409_100087287
885 Ga0307416_100050250
886 Ga0307416_100393332
887 Ga0307415_100209700
888 Ga0373930_0031274
889 Ga0373948_0008247
890 Ga0373950_0008994
891 Ga0373958_0005999
892 Ga0373938_0001562
893 Ga0373926_0054226
894 Ga0373926_0081797
895 Ga0373928_0077796
896 Ga0373940_0003840
897 Ga0373949_0019807
898 Ga0373951_0001533
899 Ga0373951_0048978
900 Ga0373932_0009196
901 Ga0373939_0000461
902 Ga0373939_0082294
903 Ga0373941_0007787
904 Ga0373960_0012115
905 Ga0373960_0028113
906 Ga0373943_0001021
907 Ga0373946_0379547
908 Ga0373942_0062582
909 Ga0373961_0003394
910 Ga0373961_0043276
911 Ga0373962_0017398
912 Ga0373962_0194441
913 Ga0373931_0017033
914 Ga0373935_0976586
915 Ga0373947_0003634
916 Ga0373925_0005450
917 Ga0373925_0412328
918 Ga0395899_0004249
919 Ga0395899_0004495
920 Ga0395899_0006240
921 Ga0395899_0017795
922 Ga0395899_0027274
923 Ga0395899_0031787
924 Ga0395899_0270247
925 Ga0395899_0332324
926 Ga0395899_0387493
927 Ga0395899_0598332
928 Ga0395900_0002765
929 Ga0395900_0004350
930 Ga0395900_0004424
931 Ga0395900_0008694
932 Ga0395900_0014038
933 Ga0395900_0016723
934 Ga0395900_0019843
935 Ga0395900_0024405
936 Ga0395900_0045120
937 Ga0395900_0063530
938 Ga0395900_0181439
939 Ga0395900_0195647
940 Ga0395900_0587196
941 Ga0395900_0874212
942 Ga0395900_1038193
943 Ga0395898_0001749
944 Ga0395898_0002407
945 Ga0395898_0004246
946 Ga0395898_0013133
947 Ga0395898_0017258
948 Ga0395898_0034060
949 Ga0395898_0041096
950 Ga0395898_0059081
951 Ga0395898_0120081
952 Ga0395898_0236649
953 Ga0395898_0464944
954 Ga0395898_0676794
955 Ga0395898_0724962
956 Ga0395898_0744433
957 Ga0395905_0002435
958 Ga0395905_0025454
959 Ga0395905_0026890
960 Ga0395905_0030670
961 Ga0395905_0040399
962 Ga0395905_0045236
963 Ga0395905_0056703
964 Ga0395905_0166020
965 Ga0395905_0325404
966 Ga0395905_0414850
967 Ga0395901_0000731
968 Ga0395901_0000894
969 Ga0395901_0005799
970 Ga0395901_0008200
971 Ga0395901_0009713
972 Ga0395901_0012894
973 Ga0395901_0078607
974 Ga0395901_0095259
975 Ga0395901_0105716
976 Ga0395901_0285582
977 Ga0395901_0458205
978 Ga0395901_0478326
979 Ga0395901_0490207
980 Ga0395901_0747873
981 Ga0395901_0748624
982 Ga0451789_1225116
983 Ga0451791_0247881
984 Ga0451793_1663085
985 Ga0451807_1469250
986 Ga0451845_0281746
987 Ga0451843_1138294
988 Ga0451855_1961103
989 Ga0451853_0826326
990 Ga0466965_0152309
991 Ga0466963_0002929
992 Ga0466964_0058635
993 Ga0466964_0290949
994 Ga0466964_0588133
995 Ga0466971_0429904
996 Ga0466968_0054145
997 Ga0466960_0521373
998 Ga0451576_0012434
999 Ga0451576_0877292
1000 Ga0466967_0025707
1001 Ga0466967_0030392
1002 Ga0466967_0436919
1003 Ga0466967_0532866
1004 Ga0466967_0763651
1005 Ga0495627_094510
1006 Ga0495603_0000243
1007 Ga0495641_0000872
1008 Ga0495582_0004385
1009 Ga0495582_0099587
1010 Ga0495639_0143176
1011 Ga0495594_0001652
1012 Ga0495596_0191596
1013 Ga0495628_0173206
1014 Ga0495630_0182635
1015 Ga0495663_0077456
1016 Ga0495663_0098632
1017 Ga0495666_0040238
1018 Ga0495642_0050955
1019 Ga0495642_0284773
1020 Ga0495622_0038288
1021 Ga0495668_0090693
1022 Ga0495668_0346180
1023 Ga0495611_0121176
1024 Ga0495588_0000529
1025 Ga0495657_0296524
1026 Ga0495647_0046201
1027 Ga0495658_0218382
1028 Ga0495676_0000737
1029 Ga0495676_0209781
1030 Ga0495685_029487
1031 Ga0496100_0010932
1032 Ga0496100_0167867
1033 Ga0496100_0417172
1034 Ga0496101_0028355
1035 Ga0496101_0033642
1036 Ga0496101_0120892
1037 Ga0496101_0167210
1038 Ga0496101_0247003
1039 Ga0496101_0280327
1040 Ga0496102_0014674
1041 Ga0496102_0141575
1042 Ga0496102_0162808
1043 Ga0496102_0336551
1044 Ga0496103_0046821
1045 Ga0496103_0054967
1046 Ga0496103_0252934
1047 Ga0496103_0568036
1048 Ga0496104_0004450
1049 Ga0496104_0004977
1050 Ga0496104_0016814
1051 Ga0496104_0025488
1052 Ga0496104_0177608
1053 Ga0496104_0187768
1054 Ga0496104_0476071
1055 Ga0496105_0000999
1056 Ga0496105_0005292
1057 Ga0496105_0008233
1058 Ga0496105_0042423
1059 Ga0496105_0125199
1060 Ga0496106_0023276
1061 Ga0496106_0077135
1062 Ga0496106_0236325
1063 Ga0496106_0374235
1064 Ga0496107_0040596
1065 Ga0496107_0051965
1066 Ga0496107_0145167
1067 Ga0496107_0307163
1068 Ga0496107_0382247
1069 Ga0496107_0629187
1070 Ga0496107_0690357
1071 Ga0496108_0017669
1072 Ga0496108_0045384
1073 Ga0496108_0048405
1074 Ga0496108_0086636
1075 Ga0496108_0434525
1076 Ga0496109_0006730
1077 Ga0496109_0088203
1078 Ga0496109_0105306
1079 Ga0496109_0182270
1080 Ga0496109_0193795
1081 Ga0496109_0467823
1082 Ga0496110_0013334
1083 Ga0496110_0023061
1084 Ga0496110_0049826
1085 Ga0496110_0098265
1086 Ga0496110_0254501
1087 Ga0496111_0005707
1088 Ga0496111_0017285
1089 Ga0496111_0038138
1090 Ga0496111_0119260
1091 Ga0496111_0134639
1092 Ga0496112_0003043
1093 Ga0496112_0019947
1094 Ga0496112_0021125
1095 Ga0496112_0142675
1096 Ga0496112_0448147
1097 Ga0496112_0656208
1098 Ga0496112_1147601
1099 Ga0496113_0011961
1100 Ga0496113_0012797
1101 Ga0496113_0070391
1102 Ga0496113_0139972
1103 Ga0496113_0142545
1104 Ga0496113_0301233
1105 Ga0496114_0002354
1106 Ga0496114_0060650
1107 Ga0496114_0199744
1108 Ga0496114_0603741
1109 Ga0496115_0008765
1110 Ga0496115_0087994
1111 Ga0496115_0384331
1112 Ga0496115_0482777
1113 Ga0501034_0155224
1114 Ga0501043_0979240
1115 Ga0501067_0050933
1116 Ga0501068_0692769
1117 Ga0501070_0052238
1118 Ga0501071_0173175
1119 Ga0501072_0046361
1120 Ga0501074_0014579
1121 Ga0501075_0220522
1122 Ga0501076_0617018
1123 Ga0501079_0880520
1124 Ga0501080_0011263
1125 Ga0501080_0530311
1126 Ga0501081_0214312
1127 Ga0501083_0463851
1128 nmdc:mga03n38_465332_c1
1129 nmdc:mga05p37_212655_c1
1130 nmdc:mga05p37_24784_c1
1131 nmdc:mga05p37_252475_c1
1132 nmdc:mga05p37_561849_c1
1133 nmdc:mga05p37_62533_c1
1134 nmdc:mga09592_473075_c1
1135 nmdc:mga06r32_115489_c1
1136 nmdc:mga08y16_123632_c1
1137 nmdc:mga08y16_133966_c1
1138 nmdc:mga08y16_1606617_c1
1139 nmdc:mga08y16_512431_c1
1140 nmdc:mga0n895_11107_c1
1141 nmdc:mga0n895_1182095_c1
1142 nmdc:mga0n895_121542_c1
1143 nmdc:mga0n895_189599_c1
1144 nmdc:mga0n895_194434_c1
1145 nmdc:mga0n895_86413_c1
1146 nmdc:mga0rr50_12461_c1
1147 nmdc:mga0rr50_15462_c1
1148 nmdc:mga0rr50_227903_c1
1149 nmdc:mga0rr50_383135_c1
1150 nmdc:mga0rr50_450992_c1
1151 nmdc:mga0rr50_73753_c1
1152 nmdc:mga0rr50_9961_c1
1153 nmdc:mga08x19_17012_c1
1154 nmdc:mga08x19_17418_c1
1155 nmdc:mga08x19_31908_c1
1156 nmdc:mga08x19_675199_c1
1157 nmdc:mga0a205_132808_c1
1158 nmdc:mga0a205_210357_c1
1159 nmdc:mga0a205_300008_c1
1160 nmdc:mga0a205_41107_c2
1161 nmdc:mga0a205_507767_c1
1162 Ga0501084_0327854

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13417

GST_N_3

Glutathione S-transferase, N-terminal domain

12

87

0.97

PF13409

GST_N_2

Glutathione S-transferase, N-terminal domain

17

82

0.95

PF02798

GST_N

Glutathione S-transferase, N-terminal domain

8

81

0.94

PF00043

GST_C

Glutathione S-transferase, C-terminal domain

103

186

0.92

PF00462

Glutaredoxin

Glutaredoxin

10

68

0.91

PF13410

GST_C_2

Glutathione S-transferase, C-terminal domain

102

181

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
3f6d-assembly1.cif.gz_B crystal structure of a genetically modified delta class gst (adgstd4-4) from anopheles dirus, f123a, in complex with s-hexyl glutathione 0.9294 3 191
3g7i-assembly1.cif.gz_B crystal structure of a delta class gst (adgstd4-4) from anopheles dirus, with glutathione complexed in one subunit 0.9271 3 191
3vln-assembly1.cif.gz_A-2 human glutathione transferase o1-1 c32s mutant in complex with ascorbic acid 0.9241 2 185
5zfg-assembly1.cif.gz_B crystal structure of a diazinon-metabolizing glutathione s-transferase in the silkworm, bombyx mori 0.924 1 190
5zfg-assembly1.cif.gz_A crystal structure of a diazinon-metabolizing glutathione s-transferase in the silkworm, bombyx mori 0.9233 1 190
ID Description Score Start End Superfamily
af_O45352_10_98_3.80.10.10 Alpha Beta;Alpha-Beta Horseshoe;Leucine-rich repeat, LRR (right-handed beta-alpha superhelix);Ribonuclease Inhibitor 0.9743 2 70 3.80.10.10
af_Q9H4Y5_21_96_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9685 2 72 3.40.30.10
af_B6U5S1_5_83_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9671 1 81 3.40.30.10
af_Q9VSL3_17_104_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9596 1 79 3.40.30.10
3lykA01 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9595 3 79 3.40.30.10
ID Description Score Start End GO Terms
AF-A0A7M2Z108-F1-model_v4 Glutathione S-transferase 0.995 1 190 GO:0005737
GO:0016740
AF-A0A538I439-F1-model_v4 GNAT family N-acetyltransferase 0.9948 1 191 GO:0005737
GO:0016747
AF-A0A1Q7UEQ8-F1-model_v4 Glutathione S-transferase family protein 0.9913 50 191 GO:0005737
AF-A0A538I439-F1-model_v4 GNAT family N-acetyltransferase 0.9897 1 191 GO:0005737
GO:0016747
AF-A0A7M2Z108-F1-model_v4 Glutathione S-transferase 0.9847 1 190 GO:0005737
GO:0016740

Map