F465784
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 578 | 438 | 1156 | 343 |
Family's Representative Sequence
| Representative Sequence | 3300053122|Ga0500608_113852|Ga0500608_113852_105_1133 |
| Length | 335 |
| Sequence | MKHIELGLDTFGDVTSSPAGVPLAHAQVLRNVVDEAVLADTLGIDFIGIGEHHRADFAVSAPEVLLAAAAVRTTRIRLGSAVTVLSSDDPIRVFQRFSTIDALSNGRAEVILGRGSFTESFPLFGYALRDYEKLFEEKLEIFSALISGTAVTWKGTIRPPLIDQQVFPPIEVGVGGSPESVLRAARYNLPLMLAIIGGDPQRFLPYVDLSKRAYEQLKMPMQPIGVHSPGYVAETDEQAREELWPDYKRMRDQIGAERGWPPMEASEFLQEIEHGSLYVGSPETVARKITATAKALGIDRFDLKYSAGALPHEKLMRCIELYGQKVIPMVREMLG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 2 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 3 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 4 | 3300002070 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 | Metagenome | Rhizosphere |
| 5 | 3300002704 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB | Metagenome | Unclassified |
| 6 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 7 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 8 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 9 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 10 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 11 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 12 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 13 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 15 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 16 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 23 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 26 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 27 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 29 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 32 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 33 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 34 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 36 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 37 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 39 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 41 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 42 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 43 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 45 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 46 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 47 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 48 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 49 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 50 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 51 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 52 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 53 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 54 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 55 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 56 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 57 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 58 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 59 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 60 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 61 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 62 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 63 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 65 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 66 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 67 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300006942 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW | Metagenome | Nodule |
| 69 | 3300006943 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW | Metagenome | Nodule |
| 70 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 71 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 91 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 92 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300024227 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 | Metagenome | Rhizosphere |
| 94 | 3300025206 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) | Metagenome | Unclassified |
| 95 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 96 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 97 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 98 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 99 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 100 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 101 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 102 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 103 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 104 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 105 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300027357 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 150 | 3300027361 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 151 | 3300027363 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 152 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 153 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 157 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 158 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 159 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 160 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 161 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 162 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 163 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 164 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 165 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 166 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 167 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 168 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 169 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 170 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 171 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 172 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 173 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 174 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 175 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 176 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 177 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 178 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 179 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 180 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 181 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 182 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 183 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 212 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 213 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 214 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 215 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 216 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 217 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 218 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 219 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 220 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 221 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 222 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 223 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 224 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 225 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 226 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 227 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 228 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 229 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 230 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 231 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 232 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 233 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 234 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 235 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 236 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 237 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 238 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 239 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 240 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 241 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 242 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 243 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 244 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 245 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 246 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 247 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 248 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 249 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 250 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 251 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 252 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 253 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 254 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 255 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 256 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 257 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 258 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 259 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 260 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 261 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 264 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 267 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 268 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 269 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 270 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 271 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 272 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 273 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 274 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 275 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 276 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 277 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 278 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 279 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 280 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 281 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 282 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
| 283 | 2508501128 | Bradyrhizobium sp. ARR65 | Isolate | Nodule |
| 284 | 2510917020 | Caulobacter sp. AP07 | Isolate | Rhizosphere |
| 285 | 2511231028 | Bradyrhizobium sp. YR681 | Isolate | Rhizosphere |
| 286 | 2513237092 | Bradyrhizobium sp. WSM1743 | Isolate | Nodule |
| 287 | 2513237094 | Bradyrhizobium sp. WSM3983 | Isolate | Nodule |
| 288 | 2513237095 | Bradyrhizobium diazoefficiens USDA 122 | Isolate | Nodule |
| 289 | 2513237098 | Bradyrhizobium elkanii WSM2783 | Isolate | Nodule |
| 290 | 2513237102 | Bradyrhizobium japonicum USDA 135 | Isolate | Nodule |
| 291 | 2513237104 | Bradyrhizobium sp. EC3.3 | Isolate | Nodule |
| 292 | 2513237139 | Bradyrhizobium ottawaense USDA 4 | Isolate | Nodule |
| 293 | 2513237161 | Bradyrhizobium sp. WSM2793 | Isolate | Nodule |
| 294 | 2517093001 | Bradyrhizobium japonicum USDA 124 | Isolate | Nodule |
| 295 | 2524023210 | Bradyrhizobium sp. Ai1a-2 | Isolate | Nodule |
| 296 | 2524023228 | Bradyrhizobium sp. Th.b2 | Isolate | Nodule |
| 297 | 2528768022 | Bradyrhizobium japonicum USDA 123 | Isolate | Nodule |
| 298 | 2582581308 | Rhizobium sp. OK494 | Isolate | Rhizosphere |
| 299 | 2582581316 | Agrobacterium rhizogenes OK036 | Isolate | Rhizosphere |
| 300 | 2585427527 | Rhizobium lusitanum YR374 | Isolate | Rhizosphere |
| 301 | 2585427530 | Rhizobium tropici YR635 | Isolate | Rhizosphere |
| 302 | 2602042107 | Bradyrhizobium sp. NFR13 | Isolate | Rhizoplane |
| 303 | 2615840626 | Rhizobium lusitanum P1-7 | Isolate | Nodule |
| 304 | 2615840698 | Rhizobium multihospitium HAMBI 2975 | Isolate | Nodule |
| 305 | 2617270735 | Bradyrhizobium shewense ERR11 | Isolate | Nodule |
| 306 | 2617270741 | Bradyrhizobium yuanmingense CCBAU 10071 | Isolate | Nodule |
| 307 | 2617270742 | Rhizobium miluonense HAMBI 2971 | Isolate | Nodule |
| 308 | 2667528174 | Rhizobium sp. NFR17 | Isolate | Rhizoplane |
| 309 | 2667528175 | Rhizobium tropici NFR14 | Isolate | Rhizoplane |
| 310 | 2671180139 | Chelativorans sp. A52C2 | Isolate | Unclassified |
| 311 | 2775507266 | Rhizobium tropici PRF 81 | Isolate | Nodule |
| 312 | 2791355196 | Bradyrhizobium sp. Y36 | Isolate | Nodule |
| 313 | 2791355197 | Bradyrhizobium sp. C9 | Isolate | Nodule |
| 314 | 2802429603 | Bradyrhizobium ottawaense L2 | Isolate | Nodule |
| 315 | 2816332527 | Bradyrhizobium diazoefficiens Y21 | Isolate | Nodule |
| 316 | 2818991448 | Rhizobium miluonense 1234 | Isolate | Unclassified |
| 317 | 2818991453 | Rhizobium lusitanum 1158 | Isolate | Unclassified |
| 318 | 2824600985 | Bradyrhizobium sp.HAMBI 2135 | Isolate | Unclassified |
| 319 | 2824609381 | Bradyrhizobium sp. HAMBI 2134 | Isolate | Unclassified |
| 320 | 2824617872 | Bradyrhizobium sp. HAMBI 2133 | Isolate | Unclassified |
| 321 | 2824626560 | Bradyrhizobium sp. HAMBI 2149 | Isolate | Unclassified |
| 322 | 2824635225 | Bradyrhizobium sp. HAMBI 2136 | Isolate | Unclassified |
| 323 | 2824644064 | Bradyrhizobium sp. HAMBI 2137 | Isolate | Unclassified |
| 324 | 2824653114 | Bradyrhizobium sp. HAMBI 2142 | Isolate | Unclassified |
| 325 | 2824661429 | Bradyrhizobium sp. HAMBI 2115 | Isolate | Unclassified |
| 326 | 2824671348 | Bradyrhizobium sp. HAMBI 2125 | Isolate | Unclassified |
| 327 | 2824679649 | Bradyrhizobium sp.HAMBI 2116 | Isolate | Unclassified |
| 328 | 2824687955 | Bradyrhizobium sp. HAMBI 2126 | Isolate | Unclassified |
| 329 | 2824696289 | Bradyrhizobium sp. HAMBI 2127 | Isolate | Unclassified |
| 330 | 2824714736 | Bradyrhizobium sp. HAMBI 2151 | Isolate | Unclassified |
| 331 | 2824723954 | Bradyrhizobium sp. HAMBI 2152 | Isolate | Unclassified |
| 332 | 2824732956 | Bradyrhizobium sp. HAMBI 2153 | Isolate | Unclassified |
| 333 | 2824746037 | Bradyrhizobium sp. HAMBI 2299 | Isolate | Unclassified |
| 334 | 2824773399 | Bradyrhizobium sp. HAMBI 2130 | Isolate | Unclassified |
| 335 | 2838029111 | Rhizobium tropici SEMIA 4079 | Isolate | Nodule |
| 336 | 2838122688 | Bradyrhizobium sp. CIR3A | Isolate | Nodule |
| 337 | 2841911363 | Bosea caraganae RCAM04685 | Isolate | Nodule |
| 338 | 2841917233 | Bosea caraganae RCAM04680 | Isolate | Nodule |
| 339 | 2841941048 | Bradyrhizobium sp. SBR1B | Isolate | Nodule |
| 340 | 2841949485 | Bradyrhizobium sp. ERR14 | Isolate | Nodule |
| 341 | 2841957949 | Bradyrhizobium sp. CIR1 | Isolate | Nodule |
| 342 | 2841966195 | Bradyrhizobium sp. CIR18 | Isolate | Nodule |
| 343 | 2841974524 | Bradyrhizobium sp. CIR48 | Isolate | Nodule |
| 344 | 2841983080 | Bradyrhizobium sp. IAR9 | Isolate | Nodule |
| 345 | 2842475841 | Rhizobium tropici SEMIA 4059 | Isolate | Nodule |
| 346 | 2842482326 | Rhizobium lusitanum SEMIA 4060 | Isolate | Nodule |
| 347 | 2842502639 | Rhizobium tropici SEMIA 4063 | Isolate | Nodule |
| 348 | 2847939898 | Bradyrhizobium ottawaense OO99 | Isolate | Unclassified |
| 349 | 2849076700 | Bradyrhizobium symbiodeficiens 85S1MB | Isolate | Nodule |
| 350 | 2852643534 | Leifsonia sp. AK011 | Isolate | Rhizosphere |
| 351 | 2857509624 | Bradyrhizobium sp. R-73088 | Isolate | Unclassified |
| 352 | 2857524615 | Tardiphaga sp. R-73074 | Isolate | Unclassified |
| 353 | 2857733635 | Salinibacterium sp. R-73062 | Isolate | Unclassified |
| 354 | 2873314349 | Sphaerisporangium siamense DSM 45784 | Isolate | Rhizosphere |
| 355 | 2874612657 | Bradyrhizobium forestalis INPA54B | Isolate | Nodule |
| 356 | 2874628541 | Bradyrhizobium betae Opo-243 | Isolate | Unclassified |
| 357 | 2876761206 | Bradyrhizobium centrolobii BR 10245 | Isolate | Nodule |
| 358 | 2879099564 | Bradyrhizobium japonicum UBMA197 | Isolate | Nodule |
| 359 | 2881665667 | Bradyrhizobium vignae LMG 28791 | Isolate | Unclassified |
| 360 | 2885366525 | Bradyrhizobium sp. LVM 105 | Isolate | Unclassified |
| 361 | 2885383462 | Bradyrhizobium sp. Leo170 | Isolate | Unclassified |
| 362 | 2885409591 | Bradyrhizobium sp. NAS80.1 | Isolate | Unclassified |
| 363 | 2888378607 | Bradyrhizobium sp. LCT2 | Isolate | Unclassified |
| 364 | 2888419890 | Bradyrhizobium sp. 1(2017) 63S1MB | Isolate | Unclassified |
| 365 | 2903727486 | Bradyrhizobium guangzhouense CCBAU 53424 | Isolate | Unclassified |
| 366 | 2903768456 | Bradyrhizobium sp. Leo121 | Isolate | Unclassified |
| 367 | 2904690495 | Bradyrhizobium ivorense CI-1B | Isolate | Nodule |
| 368 | 2904699407 | |||
| 369 | 2908739725 | Bradyrhizobium sp. UFLA03-84 | Isolate | Nodule |
| 370 | 2908756301 | Bradyrhizobium ivorense CI-41S | Isolate | Nodule |
| 371 | 2908775508 | Bradyrhizobium sp. SUTN9-2 | Isolate | Unclassified |
| 372 | 2919073203 | Tardiphaga robiniae 1155 | Isolate | Unclassified |
| 373 | 2919408235 | Rhizobium miluonense 3199 | Isolate | Unclassified |
| 374 | 2922368715 | |||
| 375 | 2922393267 | Bradyrhizobium sp. WBAH10 | Isolate | Nodule |
| 376 | 2922425934 | |||
| 377 | 2929615660 | Bradyrhizobium japonicum TXVA | Isolate | Nodule |
| 378 | 2929624759 | Bradyrhizobium japonicum TXEA | Isolate | Nodule |
| 379 | 2932431166 | Cellulosimicrobium sp. 4261 | Isolate | Rhizosphere |
| 380 | 2932794094 | Bradyrhizobium sp. S3.2.6 | Isolate | Nodule |
| 381 | 2932801729 | Bradyrhizobium sp. S3.3.6 | Isolate | Nodule |
| 382 | 2932818245 | Bradyrhizobium sp. S3.9.1 | Isolate | Nodule |
| 383 | 2933577622 | Bradyrhizobium japonicum SEMIA 417 | Isolate | Nodule |
| 384 | 2935608549 | Bradyrhizobium sp. RT6a | Isolate | Nodule |
| 385 | 2935616580 | Bradyrhizobium sp. RT7a | Isolate | Nodule |
| 386 | 2935630451 | Bradyrhizobium sp. I1.14.4 | Isolate | Nodule |
| 387 | 2935638405 | Bradyrhizobium sp. JR19.8 | Isolate | Nodule |
| 388 | 2935665750 | Bradyrhizobium sp. JR7.2 | Isolate | Nodule |
| 389 | 2935675223 | Bradyrhizobium sp. LA2.1 | Isolate | Nodule |
| 390 | 2935684952 | Bradyrhizobium sp. LA3.X | Isolate | Nodule |
| 391 | 2935694250 | Bradyrhizobium sp. LA6.1 | Isolate | Nodule |
| 392 | 2935703347 | Bradyrhizobium sp. LA6.10 | Isolate | Nodule |
| 393 | 2935713505 | Bradyrhizobium sp. LA6.12 | Isolate | Nodule |
| 394 | 2935722832 | Bradyrhizobium sp. LA6.3 | Isolate | Nodule |
| 395 | 2935732158 | Bradyrhizobium sp. LA6.4 | Isolate | Nodule |
| 396 | 2935741537 | Bradyrhizobium sp. LA6.7 | Isolate | Nodule |
| 397 | 2935750917 | Bradyrhizobium sp. LA6.8 | Isolate | Nodule |
| 398 | 2935760218 | Bradyrhizobium sp. LA7.1 | Isolate | Nodule |
| 399 | 2935801545 | Bradyrhizobium sp. RT10b | Isolate | Nodule |
| 400 | 2935819856 | Bradyrhizobium sp. RT3b | Isolate | Nodule |
| 401 | 2935827899 | Bradyrhizobium sp. RT4a | Isolate | Nodule |
| 402 | 2935837841 | Bradyrhizobium sp. RT4b | Isolate | Nodule |
| 403 | 2935847175 | Bradyrhizobium sp. RT5a | Isolate | Nodule |
| 404 | 2935855204 | Bradyrhizobium sp. RT7b | Isolate | Nodule |
| 405 | 2935864058 | Bradyrhizobium sp. RT9a | Isolate | Nodule |
| 406 | 2935873716 | Bradyrhizobium sp. RT9b | Isolate | Nodule |
| 407 | 2935883170 | Bradyrhizobium sp. S3.12.5 | Isolate | Nodule |
| 408 | 2935959822 | Bradyrhizobium sp. F1.4.3 | Isolate | Nodule |
| 409 | 2936002035 | Bradyrhizobium sp. I1.8.5 | Isolate | Nodule |
| 410 | 2940556831 | Bradyrhizobium sp. LA8.1 | Isolate | Nodule |
| 411 | 2941507105 | Bradyrhizobium sp. i1.12.3 | Isolate | Nodule |
| 412 | 2941515067 | Bradyrhizobium sp. i1.14.1 | Isolate | Nodule |
| 413 | 2941523033 | Bradyrhizobium sp. i1.8.4 | Isolate | Nodule |
| 414 | 2941531003 | Bradyrhizobium sp. LB11.1 | Isolate | Nodule |
| 415 | 2941538514 | Bradyrhizobium sp. RT11b | Isolate | Nodule |
| 416 | 3005416602 | Rhizobium sp. P40RR-XXII | Isolate | Rhizosphere |
| 417 | 3005474847 | Bradyrhizobium sp. CCBAU 53421 | Isolate | Nodule |
| 418 | 3005483717 | Bradyrhizobium agreste CNPSo 4010 | Isolate | Unclassified |
| 419 | 3005506211 | Bradyrhizobium diazoefficiens SZCCT0449 | Isolate | Unclassified |
| 420 | 3005587118 | Bradyrhizobium glycinis CNPSo 4016 | Isolate | Unclassified |
| 421 | 3005710791 | Bradyrhizobium genosp. B BDV5040 | Isolate | Unclassified |
| 422 | 3005718088 | Bradyrhizobium sp. CCBAU 53338 | Isolate | Nodule |
| 423 | 8005314921 | Rhizobium sp. P28RR-XV | Isolate | Rhizosphere |
| 424 | 8005484373 | Rhizobium tropici SARCC-755 | Isolate | Nodule |
| 425 | 8005645114 | Rhizobium tropici IGFRI Rhizo-19 | Isolate | Rhizosphere |
| 426 | 8005682033 | Rhizobium dioscoreae S-93 | Isolate | Unclassified |
| 427 | 8006926726 | Bradyrhizobium guangdongense SM32 | Isolate | Unclassified |
| 428 | 8006933436 | Bradyrhizobium septentrionale 7(2017) | Isolate | Unclassified |
| 429 | 8006973647 | Bradyrhizobium septentrionale 162S2 | Isolate | Nodule |
| 430 | 8019576017 | Bradyrhizobium sp. i1.7.7 | Isolate | Nodule |
| 431 | 8019586578 | Bradyrhizobium sp. i1.4.4 | Isolate | Nodule |
| 432 | 8019597564 | Bradyrhizobium sp. i1.3.6 | Isolate | Nodule |
| 433 | 8019608314 | Bradyrhizobium sp. i1.3.1 | Isolate | Nodule |
| 434 | 8019648815 | Bradyrhizobium sp. GM24.11 | Isolate | Nodule |
| 435 | 8055742211 | Bradyrhizobium japonicum 5038 | Isolate | Nodule |
| 436 | 8056681323 | Bradyrhizobium cenepequi CNPSo 4026 | Isolate | Nodule |
| 437 | 8056689827 | Bradyrhizobium semiaridum WSM 1704 | Isolate | Nodule |
| 438 | 8056967851 | Bradyrhizobium zhengyangense WYCCWR 12678 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 73.39 |
| Metatranscriptomes | 0 |
| Isolates | 26.61 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 11.94 |
| Nodule | 17.3 |
| Rhizoplane | 5.71 |
| Rhizosphere | 48.44 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0500608_113852 | 3300053122 | Bacteria | 1236 |
| 2 | JGI24740J21852_10000932 | 3300001979 | Bacteria | 13001 |
| 3 | JGI24743J22301_10001993 | 3300001991 | Bacteria | 2983 |
| 4 | JGI24750J21931_1001566 | 3300002070 | Bacteria | 2812 |
| 5 | JGI25155J39150_1000122 | 3300002704 | Bacteria | 37833 |
| 6 | JGI25156J39149_1000242 | 3300002705 | Bacteria | 37833 |
| 7 | JGI25162J39368_1000545 | 3300002737 | Bacteria | 27820 |
| 8 | JGI25154J39366_1000225 | 3300002738 | Bacteria | 37833 |
| 9 | JGI25157J39369_1000273 | 3300002741 | Bacteria | 37833 |
| 10 | JGI25165J46597_1000411 | 3300003214 | Bacteria | 45055 |
| 11 | JGI25165J46597_1001848 | 3300003214 | Bacteria | 8754 |
| 12 | Ga0070683_100288615 | 3300005329 | Bacteria | 1560 |
| 13 | Ga0070690_100020662 | 3300005330 | Bacteria | 4013 |
| 14 | Ga0070670_100001813 | 3300005331 | Bacteria | 17409 |
| 15 | Ga0070670_100005712 | 3300005331 | Bacteria | 10515 |
| 16 | Ga0070670_100011583 | 3300005331 | Bacteria | 7537 |
| 17 | Ga0070670_100255501 | 3300005331 | Bacteria | 1527 |
| 18 | Ga0070682_100159682 | 3300005337 | Bacteria | 1556 |
| 19 | Ga0068868_100182411 | 3300005338 | Bacteria | 1742 |
| 20 | Ga0070660_100228760 | 3300005339 | Bacteria | 1513 |
| 21 | Ga0070661_100005543 | 3300005344 | Bacteria | 8701 |
| 22 | Ga0070669_100042529 | 3300005353 | Bacteria | 3307 |
| 23 | Ga0070675_100016589 | 3300005354 | Bacteria | 5847 |
| 24 | Ga0070675_100021266 | 3300005354 | Bacteria | 5183 |
| 25 | Ga0070674_100027738 | 3300005356 | Bacteria | 3713 |
| 26 | Ga0070673_100171039 | 3300005364 | Bacteria | 1854 |
| 27 | Ga0070688_100145063 | 3300005365 | Bacteria | 1616 |
| 28 | Ga0070667_100017341 | 3300005367 | Bacteria | 5967 |
| 29 | Ga0070714_100068061 | 3300005435 | Bacteria | 3072 |
| 30 | Ga0070713_100002646 | 3300005436 | Bacteria | 11664 |
| 31 | Ga0070713_100098561 | 3300005436 | Bacteria | 2528 |
| 32 | Ga0070713_100104803 | 3300005436 | Bacteria | 2456 |
| 33 | Ga0070701_10088393 | 3300005438 | Bacteria | 1692 |
| 34 | Ga0070711_100018265 | 3300005439 | Bacteria | 4474 |
| 35 | Ga0070711_100025377 | 3300005439 | Bacteria | 3877 |
| 36 | Ga0070700_100014170 | 3300005441 | Bacteria | 4499 |
| 37 | Ga0070663_100173683 | 3300005455 | Bacteria | 1667 |
| 38 | Ga0070663_100336294 | 3300005455 | Bacteria | 1218 |
| 39 | Ga0070662_100004623 | 3300005457 | Bacteria | 8726 |
| 40 | Ga0070681_10150259 | 3300005458 | Bacteria | 2256 |
| 41 | Ga0070685_10008944 | 3300005466 | Bacteria | 5166 |
| 42 | Ga0070698_100221849 | 3300005471 | Bacteria | 1824 |
| 43 | Ga0070699_100011090 | 3300005518 | Bacteria | 7792 |
| 44 | Ga0070684_100001331 | 3300005535 | Bacteria | 17688 |
| 45 | Ga0070686_100013106 | 3300005544 | Bacteria | 4733 |
| 46 | Ga0070686_100061650 | 3300005544 | Bacteria | 2424 |
| 47 | Ga0070665_100028657 | 3300005548 | Bacteria | 5607 |
| 48 | Ga0070704_100042810 | 3300005549 | Bacteria | 3135 |
| 49 | Ga0070664_100198988 | 3300005564 | Bacteria | 1787 |
| 50 | Ga0070664_100286149 | 3300005564 | Bacteria | 1487 |
| 51 | Ga0068857_100123280 | 3300005577 | Bacteria | 2335 |
| 52 | Ga0068854_100054108 | 3300005578 | Bacteria | 2885 |
| 53 | Ga0068856_100020697 | 3300005614 | Bacteria | 6391 |
| 54 | Ga0068856_100070101 | 3300005614 | Bacteria | 3467 |
| 55 | Ga0070702_100004877 | 3300005615 | Bacteria | 6176 |
| 56 | Ga0068852_100118590 | 3300005616 | Bacteria | 2418 |
| 57 | Ga0068859_100040117 | 3300005617 | Bacteria | 4699 |
| 58 | Ga0068859_100352810 | 3300005617 | Bacteria | 1566 |
| 59 | Ga0068864_100043667 | 3300005618 | Bacteria | 3838 |
| 60 | Ga0068866_10019587 | 3300005718 | Bacteria | 3084 |
| 61 | Ga0068861_100043844 | 3300005719 | Bacteria | 3360 |
| 62 | Ga0068870_10014484 | 3300005840 | Bacteria | 3726 |
| 63 | Ga0068863_100072479 | 3300005841 | Bacteria | 3258 |
| 64 | Ga0068863_100151843 | 3300005841 | Bacteria | 2216 |
| 65 | Ga0068863_100379370 | 3300005841 | Bacteria | 1380 |
| 66 | Ga0068858_100020520 | 3300005842 | Bacteria | 6175 |
| 67 | Ga0068858_100097403 | 3300005842 | Bacteria | 2742 |
| 68 | Ga0068858_100215592 | 3300005842 | Bacteria | 1817 |
| 69 | Ga0068862_100027901 | 3300005844 | Bacteria | 4755 |
| 70 | Ga0081455_10186854 | 3300005937 | Bacteria | 1564 |
| 71 | Ga0081540_1047913 | 3300005983 | Bacteria | 2145 |
| 72 | Ga0075365_10028679 | 3300006038 | Bacteria | 3551 |
| 73 | Ga0075368_10040193 | 3300006042 | Bacteria | 1836 |
| 74 | Ga0075368_10045595 | 3300006042 | Bacteria | 1732 |
| 75 | Ga0075363_100108671 | 3300006048 | Bacteria | 1540 |
| 76 | Ga0075363_100110971 | 3300006048 | Bacteria | 1524 |
| 77 | Ga0075364_10025553 | 3300006051 | Bacteria | 3759 |
| 78 | Ga0075364_10100986 | 3300006051 | Bacteria | 1920 |
| 79 | Ga0070712_100013835 | 3300006175 | Bacteria | 5164 |
| 80 | Ga0075367_10022741 | 3300006178 | Bacteria | 3519 |
| 81 | Ga0075367_10025168 | 3300006178 | Bacteria | 3364 |
| 82 | Ga0075367_10186326 | 3300006178 | Bacteria | 1294 |
| 83 | Ga0075369_10004982 | 3300006186 | Bacteria | 4941 |
| 84 | Ga0075366_10005206 | 3300006195 | Bacteria | 7039 |
| 85 | Ga0075366_10013465 | 3300006195 | Bacteria | 4658 |
| 86 | Ga0097621_100210341 | 3300006237 | Bacteria | 1692 |
| 87 | Ga0075370_10049274 | 3300006353 | Bacteria | 2387 |
| 88 | Ga0075370_10087433 | 3300006353 | Bacteria | 1796 |
| 89 | Ga0075428_100048269 | 3300006844 | Bacteria | 4673 |
| 90 | Ga0075428_100112212 | 3300006844 | Bacteria | 2969 |
| 91 | Ga0068865_100230059 | 3300006881 | Bacteria | 1454 |
| 92 | Ga0097620_100040116 | 3300006931 | Bacteria | 4699 |
| 93 | Ga0097620_100352776 | 3300006931 | Bacteria | 1566 |
| 94 | Ga0099824_1010107 | 3300006942 | Bacteria | 11310 |
| 95 | Ga0099822_1001351 | 3300006943 | Bacteria | 28251 |
| 96 | Ga0105240_10000014 | 3300009093 | Bacteria | 482033 |
| 97 | Ga0105240_10419039 | 3300009093 | Bacteria | 1505 |
| 98 | Ga0105245_10001585 | 3300009098 | Bacteria | 20674 |
| 99 | Ga0105247_10019591 | 3300009101 | Bacteria | 4062 |
| 100 | Ga0114129_10006854 | 3300009147 | Bacteria | 16194 |
| 101 | Ga0105242_10068951 | 3300009176 | Bacteria | 2928 |
| 102 | Ga0105242_10258480 | 3300009176 | Bacteria | 1572 |
| 103 | Ga0105248_10023815 | 3300009177 | Bacteria | 6806 |
| 104 | Ga0105248_10055885 | 3300009177 | Bacteria | 4428 |
| 105 | Ga0105248_10056381 | 3300009177 | Bacteria | 4408 |
| 106 | Ga0105248_10305689 | 3300009177 | Bacteria | 1791 |
| 107 | Ga0105237_10006102 | 3300009545 | Bacteria | 13469 |
| 108 | Ga0105237_10240014 | 3300009545 | Bacteria | 1813 |
| 109 | Ga0105238_10129002 | 3300009551 | Bacteria | 2507 |
| 110 | Ga0105249_10044906 | 3300009553 | Bacteria | 4018 |
| 111 | Ga0105249_10127186 | 3300009553 | Bacteria | 2428 |
| 112 | Ga0105239_10005173 | 3300010375 | Bacteria | 15375 |
| 113 | Ga0105239_10175077 | 3300010375 | Bacteria | 2400 |
| 114 | Ga0105239_10250159 | 3300010375 | Bacteria | 1990 |
| 115 | Ga0105246_10028796 | 3300011119 | Bacteria | 3651 |
| 116 | Ga0105246_10054761 | 3300011119 | Bacteria | 2750 |
| 117 | Ga0105246_10166814 | 3300011119 | Bacteria | 1682 |
| 118 | Ga0157373_10003649 | 3300013100 | Bacteria | 11632 |
| 119 | Ga0157370_10000015 | 3300013104 | Bacteria | 185771 |
| 120 | Ga0157370_10478013 | 3300013104 | Bacteria | 1145 |
| 121 | Ga0157369_10127162 | 3300013105 | Bacteria | 2701 |
| 122 | Ga0157374_10044638 | 3300013296 | Bacteria | 4096 |
| 123 | Ga0157378_10017661 | 3300013297 | Bacteria | 6262 |
| 124 | Ga0157378_10423149 | 3300013297 | Bacteria | 1317 |
| 125 | Ga0157375_10041728 | 3300013308 | Bacteria | 4433 |
| 126 | Ga0163163_10032288 | 3300014325 | Bacteria | 5056 |
| 127 | Ga0163163_10038522 | 3300014325 | Bacteria | 4661 |
| 128 | Ga0163163_10368757 | 3300014325 | Bacteria | 1493 |
| 129 | Ga0157380_10399677 | 3300014326 | Bacteria | 1303 |
| 130 | Ga0157379_10053696 | 3300014968 | Bacteria | 3600 |
| 131 | Ga0182007_10002551 | 3300015262 | Bacteria | 8961 |
| 132 | Ga0182005_1002250 | 3300015265 | Bacteria | 7081 |
| 133 | Ga0163161_10210738 | 3300017792 | Bacteria | 1501 |
| 134 | Ga0228598_1001818 | 3300024227 | Bacteria | 4642 |
| 135 | Ga0209435_100005 | 3300025206 | Bacteria | 573745 |
| 136 | Ga0209437_100058 | 3300025233 | Bacteria | 357279 |
| 137 | Ga0209437_100060 | 3300025233 | Bacteria | 355034 |
| 138 | Ga0209646_1000011 | 3300025246 | Bacteria | 573745 |
| 139 | Ga0209646_1003398 | 3300025246 | Bacteria | 3154 |
| 140 | Ga0209026_1000008 | 3300025250 | Bacteria | 573745 |
| 141 | Ga0209677_100281 | 3300025253 | Bacteria | 33858 |
| 142 | Ga0209677_100897 | 3300025253 | Bacteria | 14582 |
| 143 | Ga0209759_1000004 | 3300025256 | Bacteria | 573745 |
| 144 | Ga0209233_1000137 | 3300025261 | Bacteria | 200314 |
| 145 | Ga0209233_1000149 | 3300025261 | Bacteria | 181183 |
| 146 | Ga0209233_1000160 | 3300025261 | Bacteria | 159035 |
| 147 | Ga0209233_1000921 | 3300025261 | Bacteria | 12845 |
| 148 | Ga0209233_1006615 | 3300025261 | Bacteria | 3721 |
| 149 | Ga0209025_1028152 | 3300025294 | Bacteria | 2764 |
| 150 | Ga0209564_1003706 | 3300025295 | Bacteria | 10045 |
| 151 | Ga0209564_1034651 | 3300025295 | Bacteria | 1477 |
| 152 | Ga0209758_1000903 | 3300025297 | Bacteria | 40307 |
| 153 | Ga0209257_1017217 | 3300025304 | Bacteria | 2862 |
| 154 | Ga0207710_10013137 | 3300025900 | Bacteria | 3488 |
| 155 | Ga0207710_10089764 | 3300025900 | Bacteria | 1437 |
| 156 | Ga0207688_10001843 | 3300025901 | Bacteria | 11323 |
| 157 | Ga0207645_10010034 | 3300025907 | Bacteria | 6520 |
| 158 | Ga0207643_10020992 | 3300025908 | Bacteria | 3586 |
| 159 | Ga0207707_10000615 | 3300025912 | Bacteria | 35495 |
| 160 | Ga0207707_10000914 | 3300025912 | Bacteria | 28757 |
| 161 | Ga0207707_10058416 | 3300025912 | Bacteria | 3357 |
| 162 | Ga0207707_10113341 | 3300025912 | Bacteria | 2370 |
| 163 | Ga0207695_10000037 | 3300025913 | Bacteria | 476303 |
| 164 | Ga0207695_10085465 | 3300025913 | Bacteria | 3183 |
| 165 | Ga0207671_10089475 | 3300025914 | Bacteria | 2317 |
| 166 | Ga0207693_10063204 | 3300025915 | Bacteria | 2900 |
| 167 | Ga0207663_10017960 | 3300025916 | Bacteria | 3951 |
| 168 | Ga0207663_10109954 | 3300025916 | Bacteria | 1869 |
| 169 | Ga0207660_10000729 | 3300025917 | Bacteria | 21878 |
| 170 | Ga0207660_10021828 | 3300025917 | Bacteria | 4308 |
| 171 | Ga0207662_10013946 | 3300025918 | Bacteria | 4499 |
| 172 | Ga0207649_10165906 | 3300025920 | Bacteria | 1534 |
| 173 | Ga0207652_10003555 | 3300025921 | Bacteria | 12865 |
| 174 | Ga0207694_10293614 | 3300025924 | Bacteria | 1337 |
| 175 | Ga0207650_10000666 | 3300025925 | Bacteria | 26991 |
| 176 | Ga0207650_10007474 | 3300025925 | Bacteria | 7446 |
| 177 | Ga0207650_10044083 | 3300025925 | Bacteria | 3277 |
| 178 | Ga0207650_10113179 | 3300025925 | Bacteria | 2103 |
| 179 | Ga0207659_10303962 | 3300025926 | Bacteria | 1311 |
| 180 | Ga0207687_10011012 | 3300025927 | Bacteria | 5910 |
| 181 | Ga0207687_10031401 | 3300025927 | Bacteria | 3589 |
| 182 | Ga0207700_10001630 | 3300025928 | Bacteria | 12742 |
| 183 | Ga0207700_10025188 | 3300025928 | Bacteria | 4128 |
| 184 | Ga0207700_10272140 | 3300025928 | Bacteria | 1454 |
| 185 | Ga0207644_10003067 | 3300025931 | Bacteria | 10760 |
| 186 | Ga0207690_10209417 | 3300025932 | Bacteria | 1485 |
| 187 | Ga0207706_10010880 | 3300025933 | Bacteria | 8301 |
| 188 | Ga0207706_10023923 | 3300025933 | Bacteria | 5480 |
| 189 | Ga0207706_10115488 | 3300025933 | Bacteria | 2361 |
| 190 | Ga0207686_10091486 | 3300025934 | Bacteria | 2010 |
| 191 | Ga0207709_10028709 | 3300025935 | Bacteria | 3219 |
| 192 | Ga0207670_10276802 | 3300025936 | Bacteria | 1306 |
| 193 | Ga0207669_10107544 | 3300025937 | Bacteria | 1860 |
| 194 | Ga0207704_10018073 | 3300025938 | Bacteria | 3672 |
| 195 | Ga0207691_10013141 | 3300025940 | Bacteria | 7926 |
| 196 | Ga0207691_10310534 | 3300025940 | Bacteria | 1353 |
| 197 | Ga0207711_10113049 | 3300025941 | Bacteria | 2417 |
| 198 | Ga0207711_10389189 | 3300025941 | Bacteria | 1294 |
| 199 | Ga0207689_10089558 | 3300025942 | Bacteria | 2527 |
| 200 | Ga0207679_10232251 | 3300025945 | Bacteria | 1558 |
| 201 | Ga0207679_10264484 | 3300025945 | Bacteria | 1468 |
| 202 | Ga0207679_10292331 | 3300025945 | Bacteria | 1401 |
| 203 | Ga0207667_10061384 | 3300025949 | Bacteria | 3932 |
| 204 | Ga0207651_10039396 | 3300025960 | Bacteria | 3116 |
| 205 | Ga0207640_10000905 | 3300025981 | Bacteria | 16651 |
| 206 | Ga0207640_10073439 | 3300025981 | Bacteria | 2311 |
| 207 | Ga0207640_10134092 | 3300025981 | Bacteria | 1795 |
| 208 | Ga0207677_10018924 | 3300026023 | Bacteria | 4146 |
| 209 | Ga0207677_10054518 | 3300026023 | Bacteria | 2729 |
| 210 | Ga0207677_10059995 | 3300026023 | Bacteria | 2627 |
| 211 | Ga0207703_10046212 | 3300026035 | Bacteria | 3506 |
| 212 | Ga0207703_10080930 | 3300026035 | Bacteria | 2706 |
| 213 | Ga0207703_10405162 | 3300026035 | Bacteria | 1266 |
| 214 | Ga0207678_10055479 | 3300026067 | Bacteria | 3413 |
| 215 | Ga0207678_10163673 | 3300026067 | Bacteria | 1900 |
| 216 | Ga0207708_10018464 | 3300026075 | Bacteria | 5253 |
| 217 | Ga0207702_10026046 | 3300026078 | Bacteria | 4855 |
| 218 | Ga0207702_10049286 | 3300026078 | Bacteria | 3554 |
| 219 | Ga0207641_10061894 | 3300026088 | Bacteria | 3192 |
| 220 | Ga0207648_10063764 | 3300026089 | Bacteria | 3211 |
| 221 | Ga0207676_10113283 | 3300026095 | Bacteria | 2273 |
| 222 | Ga0207674_10080434 | 3300026116 | Bacteria | 3262 |
| 223 | Ga0207675_100018937 | 3300026118 | Bacteria | 6426 |
| 224 | Ga0207698_10084958 | 3300026142 | Bacteria | 2568 |
| 225 | Ga0209589_1000006 | 3300027357 | Bacteria | 436292 |
| 226 | Ga0209489_100007 | 3300027361 | Bacteria | 436292 |
| 227 | Ga0209700_100008 | 3300027363 | Bacteria | 436292 |
| 228 | Ga0207428_10031975 | 3300027907 | Bacteria | 4334 |
| 229 | Ga0268266_10063441 | 3300028379 | Bacteria | 3189 |
| 230 | Ga0268266_10066508 | 3300028379 | Bacteria | 3118 |
| 231 | Ga0268265_10058079 | 3300028380 | Bacteria | 2952 |
| 232 | Ga0268264_10180739 | 3300028381 | Bacteria | 1915 |
| 233 | Ga0265332_10031519 | 3300031238 | Bacteria | 2312 |
| 234 | Ga0307508_10030322 | 3300031616 | Bacteria | 4888 |
| 235 | Ga0307516_10004419 | 3300031730 | Bacteria | 17372 |
| 236 | Ga0307516_10079474 | 3300031730 | Bacteria | 3124 |
| 237 | Ga0373934_0039398 | 3300035086 | Bacteria | 1863 |
| 238 | Ga0373923_0089810 | 3300035111 | Bacteria | 1342 |
| 239 | Ga0373936_0027514 | 3300035113 | Bacteria | 2230 |
| 240 | Ga0373954_0018867 | 3300035118 | Bacteria | 3108 |
| 241 | Ga0373955_0011982 | 3300035172 | Bacteria | 4155 |
| 242 | Ga0373924_0008070 | 3300035410 | Bacteria | 3813 |
| 243 | Ga0373927_0030720 | 3300035695 | Bacteria | 3504 |
| 244 | Ga0373933_0032113 | 3300035724 | Bacteria | 3050 |
| 245 | Ga0373947_0035079 | 3300035725 | Bacteria | 2969 |
| 246 | Ga0373937_0158396 | 3300036401 | Bacteria | 2122 |
| 247 | Ga0395900_0035738 | 3300037418 | Bacteria | 5119 |
| 248 | Ga0395900_0281146 | 3300037418 | Bacteria | 1656 |
| 249 | Ga0395898_0006673 | 3300037466 | Bacteria | 12309 |
| 250 | Ga0395898_0017739 | 3300037466 | Bacteria | 7264 |
| 251 | Ga0436364_1000946 | 3300037853 | Bacteria | 1243 |
| 252 | Ga0395901_0074428 | 3300038443 | Bacteria | 3543 |
| 253 | Ga0436365_0254253 | 3300039437 | Bacteria | 1388 |
| 254 | Ga0436365_0944082 | 3300039437 | Bacteria | 5399 |
| 255 | Ga0436365_1685274 | 3300039437 | Bacteria | 3141 |
| 256 | Ga0439446_0008791 | 3300042156 | Bacteria | 2691 |
| 257 | Ga0439434_0010453 | 3300042435 | Bacteria | 2735 |
| 258 | Ga0466963_0020974 | 3300044694 | Bacteria | 4116 |
| 259 | Ga0466971_0052257 | 3300044719 | Bacteria | 1840 |
| 260 | Ga0466970_0007088 | 3300044765 | Bacteria | 5608 |
| 261 | Ga0466957_0011840 | 3300044842 | Bacteria | 5043 |
| 262 | Ga0466957_0135823 | 3300044842 | Bacteria | 1580 |
| 263 | Ga0466959_0086098 | 3300045049 | Bacteria | 2261 |
| 264 | Ga0466958_0011895 | 3300045836 | Bacteria | 4914 |
| 265 | Ga0466958_0176837 | 3300045836 | Bacteria | 1353 |
| 266 | Ga0466967_0026825 | 3300045976 | Bacteria | 4780 |
| 267 | Ga0495629_0214430 | 3300046459 | Bacteria | 1329 |
| 268 | Ga0495651_0056932 | 3300046462 | Bacteria | 3002 |
| 269 | Ga0495653_0197954 | 3300046463 | Bacteria | 1366 |
| 270 | Ga0495580_0034230 | 3300046472 | Bacteria | 3658 |
| 271 | Ga0495582_0023546 | 3300046473 | Bacteria | 3369 |
| 272 | Ga0495639_0019067 | 3300046475 | Bacteria | 2993 |
| 273 | Ga0495662_0066304 | 3300046476 | Bacteria | 1746 |
| 274 | Ga0495610_0016114 | 3300046512 | Plasmid | 4319 |
| 275 | Ga0495616_0081133 | 3300046513 | Bacteria | 1552 |
| 276 | Ga0495631_0000068 | 3300046518 | Bacteria | 64881 |
| 277 | Ga0495643_0060766 | 3300046522 | Bacteria | 2005 |
| 278 | Ga0495652_0116909 | 3300046529 | Bacteria | 2134 |
| 279 | Ga0495665_0016217 | 3300046531 | Bacteria | 4014 |
| 280 | Ga0495665_0049860 | 3300046531 | Bacteria | 2220 |
| 281 | Ga0495640_0013301 | 3300046533 | Bacteria | 6256 |
| 282 | Ga0495622_0062100 | 3300046557 | Bacteria | 1730 |
| 283 | Ga0495656_0018966 | 3300046615 | Bacteria | 2649 |
| 284 | Ga0495625_0001719 | 3300046660 | Bacteria | 25443 |
| 285 | Ga0495625_0004709 | 3300046660 | Bacteria | 12776 |
| 286 | Ga0495647_0021731 | 3300046681 | Bacteria | 2313 |
| 287 | Ga0495670_0000994 | 3300046691 | Bacteria | 13780 |
| 288 | Ga0495589_0055749 | 3300046794 | Bacteria | 1947 |
| 289 | Ga0495604_0113418 | 3300047317 | Bacteria | 1973 |
| 290 | Ga0495674_0228385 | 3300047319 | Bacteria | 1537 |
| 291 | Ga0495672_0120165 | 3300047320 | Bacteria | 1398 |
| 292 | Ga0495676_0195296 | 3300047321 | Bacteria | 1409 |
| 293 | Ga0495680_0168640 | 3300047322 | Bacteria | 1586 |
| 294 | Ga0495687_076514 | 3300047443 | Bacteria | 1324 |
| 295 | Ga0495684_0004856 | 3300047471 | Bacteria | 10490 |
| 296 | Ga0495593_0021527 | 3300047673 | Bacteria | 3600 |
| 297 | Ga0495593_0104381 | 3300047673 | Bacteria | 1451 |
| 298 | Ga0496100_0014089 | 3300048903 | Bacteria | 4634 |
| 299 | Ga0496100_0075522 | 3300048903 | Bacteria | 2260 |
| 300 | Ga0496101_0017549 | 3300048904 | Bacteria | 4854 |
| 301 | Ga0496101_0053356 | 3300048904 | Bacteria | 2917 |
| 302 | Ga0496101_0243996 | 3300048904 | Bacteria | 1398 |
| 303 | Ga0496102_0010591 | 3300048905 | Bacteria | 7942 |
| 304 | Ga0496102_0070159 | 3300048905 | Bacteria | 3217 |
| 305 | Ga0496102_0113768 | 3300048905 | Bacteria | 2525 |
| 306 | Ga0496103_0003532 | 3300048906 | Bacteria | 9552 |
| 307 | Ga0496103_0009028 | 3300048906 | Bacteria | 5904 |
| 308 | Ga0496103_0025666 | 3300048906 | Bacteria | 3563 |
| 309 | Ga0496104_0001496 | 3300048907 | Bacteria | 20148 |
| 310 | Ga0496104_0009501 | 3300048907 | Bacteria | 8655 |
| 311 | Ga0496105_0008375 | 3300048908 | Bacteria | 8034 |
| 312 | Ga0496106_0002833 | 3300048909 | Bacteria | 12865 |
| 313 | Ga0496106_0014798 | 3300048909 | Bacteria | 5768 |
| 314 | Ga0496106_0241839 | 3300048909 | Bacteria | 1442 |
| 315 | Ga0496107_0003151 | 3300048910 | Bacteria | 10962 |
| 316 | Ga0496107_0007961 | 3300048910 | Bacteria | 7315 |
| 317 | Ga0496108_0001611 | 3300048911 | Bacteria | 17883 |
| 318 | Ga0496108_0051188 | 3300048911 | Bacteria | 3459 |
| 319 | Ga0496109_0000704 | 3300048912 | Bacteria | 27798 |
| 320 | Ga0496109_0055581 | 3300048912 | Bacteria | 3611 |
| 321 | Ga0496111_0013603 | 3300048914 | Bacteria | 5542 |
| 322 | Ga0496112_0005181 | 3300048915 | Bacteria | 11210 |
| 323 | Ga0496112_0082885 | 3300048915 | Bacteria | 3171 |
| 324 | Ga0496113_0000675 | 3300048916 | Bacteria | 17346 |
| 325 | Ga0496115_0002859 | 3300048918 | Bacteria | 12429 |
| 326 | Ga0496115_0077047 | 3300048918 | Bacteria | 2711 |
| 327 | Ga0496115_0385624 | 3300048918 | Bacteria | 1139 |
| 328 | Ga0496116_0004200 | 3300048919 | Bacteria | 13851 |
| 329 | Ga0496116_0098433 | 3300048919 | Bacteria | 1755 |
| 330 | Ga0496117_0004154 | 3300048920 | Bacteria | 16186 |
| 331 | Ga0496117_0036871 | 3300048920 | Bacteria | 3651 |
| 332 | Ga0496117_0044962 | 3300048920 | Bacteria | 3194 |
| 333 | Ga0496117_0053187 | 3300048920 | Bacteria | 2847 |
| 334 | Ga0496118_0002863 | 3300048921 | Bacteria | 22510 |
| 335 | Ga0496118_0007010 | 3300048921 | Bacteria | 12138 |
| 336 | Ga0496118_0069301 | 3300048921 | Bacteria | 2555 |
| 337 | Ga0496118_0081279 | 3300048921 | Bacteria | 2276 |
| 338 | Ga0496119_0010275 | 3300048922 | Bacteria | 7890 |
| 339 | Ga0496119_0116342 | 3300048922 | Bacteria | 1476 |
| 340 | Ga0496119_0122029 | 3300048922 | Bacteria | 1431 |
| 341 | Ga0496121_0003295 | 3300048924 | Bacteria | 23190 |
| 342 | Ga0496121_0010917 | 3300048924 | Bacteria | 10149 |
| 343 | Ga0496121_0012634 | 3300048924 | Bacteria | 9173 |
| 344 | Ga0496121_0047909 | 3300048924 | Bacteria | 3641 |
| 345 | Ga0496121_0052069 | 3300048924 | Bacteria | 3442 |
| 346 | Ga0496121_0187333 | 3300048924 | Bacteria | 1487 |
| 347 | Ga0496122_0061949 | 3300048925 | Bacteria | 2741 |
| 348 | Ga0496122_0065408 | 3300048925 | Bacteria | 2636 |
| 349 | Ga0496123_0005436 | 3300048926 | Bacteria | 12826 |
| 350 | Ga0496123_0006650 | 3300048926 | Bacteria | 11147 |
| 351 | Ga0496123_0100221 | 3300048926 | Bacteria | 1688 |
| 352 | Ga0496124_0042585 | 3300048927 | Bacteria | 3909 |
| 353 | Ga0496124_0057558 | 3300048927 | Bacteria | 3274 |
| 354 | Ga0496124_0127789 | 3300048927 | Bacteria | 2023 |
| 355 | Ga0496125_0075582 | 3300048928 | Bacteria | 2606 |
| 356 | Ga0496125_0125491 | 3300048928 | Bacteria | 1820 |
| 357 | Ga0496125_0168553 | 3300048928 | Bacteria | 1475 |
| 358 | Ga0496126_0009480 | 3300048929 | Bacteria | 10331 |
| 359 | Ga0496126_0010298 | 3300048929 | Bacteria | 9818 |
| 360 | Ga0496126_0249191 | 3300048929 | Bacteria | 1481 |
| 361 | Ga0496126_0259809 | 3300048929 | Bacteria | 1444 |
| 362 | Ga0501031_0000035 | 3300049568 | Bacteria | 73884 |
| 363 | Ga0501032_0000022 | 3300049569 | Bacteria | 146790 |
| 364 | Ga0501033_0000037 | 3300049570 | Bacteria | 146582 |
| 365 | Ga0501034_0000634 | 3300049571 | Bacteria | 54577 |
| 366 | Ga0501036_0000013 | 3300049572 | Bacteria | 155326 |
| 367 | Ga0501037_0000016 | 3300049573 | Bacteria | 161027 |
| 368 | Ga0501038_0000015 | 3300049574 | Bacteria | 161983 |
| 369 | Ga0501039_0000013 | 3300049575 | Bacteria | 234418 |
| 370 | Ga0501043_0000299 | 3300049579 | Bacteria | 44816 |
| 371 | Ga0501046_0104776 | 3300049580 | Bacteria | 2167 |
| 372 | Ga0501047_0005024 | 3300049581 | Bacteria | 12416 |
| 373 | Ga0501070_0015723 | 3300049586 | Bacteria | 6364 |
| 374 | Ga0501075_0342255 | 3300049591 | Bacteria | 1140 |
| 375 | Ga0501035_0000046 | 3300049822 | Bacteria | 146599 |
| 376 | Ga0501044_0000038 | 3300049823 | Bacteria | 161027 |
| 377 | Ga0501045_0326963 | 3300049824 | Bacteria | 1141 |
| 378 | nmdc:mga03n38_85937_c1 | 3300050490 | Bacteria | 1488 |
| 379 | nmdc:mga00v17_156351_c1 | 3300050491 | Bacteria | 1466 |
| 380 | nmdc:mga0yw44_125541_c1 | 3300050492 | Bacteria | 1657 |
| 381 | nmdc:mga0yw44_150920_c1 | 3300050492 | Bacteria | 1516 |
| 382 | nmdc:mga0yw44_2599_c1 | 3300050492 | Bacteria | 7756 |
| 383 | nmdc:mga0yw44_66020_c1 | 3300050492 | Bacteria | 2232 |
| 384 | nmdc:mga0yw44_82152_c1 | 3300050492 | Bacteria | 2021 |
| 385 | nmdc:mga0k408_146847_c1 | 3300050493 | Bacteria | 1404 |
| 386 | nmdc:mga0k408_30033_c1 | 3300050493 | Bacteria | 3097 |
| 387 | nmdc:mga06z11_13060_c1 | 3300050494 | Bacteria | 3633 |
| 388 | nmdc:mga06z11_49715_c1 | 3300050494 | Bacteria | 2140 |
| 389 | nmdc:mga07m45_65239_c1 | 3300050496 | Bacteria | 2067 |
| 390 | nmdc:mga05p37_1928_c1 | 3300050507 | Bacteria | 24149 |
| 391 | nmdc:mga08y16_125898_c1 | 3300050511 | Bacteria | 2665 |
| 392 | nmdc:mga0n895_16793_c1 | 3300050512 | Bacteria | 6726 |
| 393 | nmdc:mga0sz30_17271_c1 | 3300050516 | Bacteria | 2370 |
| 394 | Ga0495601_0019513 | 3300053077 | Bacteria | 4135 |
| 395 | Ga0495601_0124072 | 3300053077 | Bacteria | 1679 |
| 396 | Ga0495601_0132429 | 3300053077 | Bacteria | 1624 |
| 397 | Ga0495612_0017447 | 3300053078 | Bacteria | 2875 |
| 398 | Ga0500610_0016027 | 3300053079 | Bacteria | 3563 |
| 399 | Ga0495595_0006786 | 3300053084 | Bacteria | 4672 |
| 400 | Ga0495619_0086616 | 3300053085 | Bacteria | 2117 |
| 401 | Ga0500651_0151790 | 3300053093 | Bacteria | 1391 |
| 402 | Ga0500566_0001073 | 3300053094 | Bacteria | 15835 |
| 403 | Ga0500650_0060878 | 3300053098 | Bacteria | 1762 |
| 404 | Ga0500556_0000002 | 3300053104 | Bacteria | 773626 |
| 405 | Ga0500569_017580 | 3300053109 | Bacteria | 1831 |
| 406 | Ga0500572_000102 | 3300053111 | Bacteria | 27944 |
| 407 | Ga0500594_0009542 | 3300053118 | Bacteria | 2237 |
| 408 | Ga0500594_0013147 | 3300053118 | Bacteria | 1963 |
| 409 | Ga0500642_0000026 | 3300053130 | Bacteria | 127731 |
| 410 | Ga0500652_000060 | 3300053131 | Bacteria | 48953 |
| 411 | Ga0500568_0000922 | 3300053139 | Bacteria | 20296 |
| 412 | Ga0500573_0076066 | 3300053140 | Bacteria | 1911 |
| 413 | Ga0500573_0141552 | 3300053140 | Bacteria | 1324 |
| 414 | Ga0500577_0043485 | 3300053142 | Bacteria | 1651 |
| 415 | Ga0500622_0000994 | 3300053156 | Bacteria | 23922 |
| 416 | Ga0500634_0132381 | 3300053161 | Bacteria | 1195 |
| 417 | Ga0500639_005225 | 3300053163 | Bacteria | 6634 |
| 418 | Ga0500636_0004153 | 3300053177 | Bacteria | 8194 |
| 419 | Ga0500636_0016322 | 3300053177 | Bacteria | 4379 |
| 420 | Ga0500636_0047349 | 3300053177 | Bacteria | 2533 |
| 421 | Ga0500636_0105515 | 3300053177 | Bacteria | 1597 |
| 422 | Ga0500596_000960 | 3300053735 | Bacteria | 5741 |
| 423 | 2509153218 | 2508501128 | Bacteria | 8613869 |
| 424 | 2511120884 | 2510917020 | Bacteria | 5657507 |
| 425 | 2511397976 | 2511231028 | Bacteria | 8046582 |
| 426 | 2513628751 | 2513237092 | Bacteria | 8341956 |
| 427 | 2513642741 | 2513237094 | Bacteria | 8789602 |
| 428 | 2513653142 | 2513237095 | Bacteria | 8976980 |
| 429 | 2513675655 | 2513237098 | Bacteria | 9902361 |
| 430 | 2513706790 | 2513237102 | Bacteria | 7703324 |
| 431 | 2513720868 | 2513237104 | Bacteria | 10034502 |
| 432 | 2513875949 | 2513237139 | Bacteria | 8737671 |
| 433 | 2514011391 | 2513237161 | Bacteria | 8871253 |
| 434 | 2517103432 | 2517093001 | Bacteria | 9002274 |
| 435 | 2524465086 | 2524023210 | Bacteria | 9029266 |
| 436 | 2524533762 | 2524023228 | Bacteria | 10118060 |
| 437 | 2528852571 | 2528768022 | Bacteria | 10457665 |
| 438 | 2585279390 | 2582581308 | Bacteria | 7413247 |
| 439 | 2585331120 | 2582581316 | Bacteria | 7774528 |
| 440 | 2585531126 | 2585427527 | Bacteria | 7273426 |
| 441 | 2585552952 | 2585427530 | Bacteria | 7383882 |
| 442 | 2603861350 | 2602042107 | Bacteria | 6226103 |
| 443 | 2616306963 | 2615840626 | Bacteria | 7921970 |
| 444 | 2616554573 | 2615840698 | Bacteria | 7319877 |
| 445 | 2617349388 | 2617270735 | Bacteria | 9163226 |
| 446 | 2617378097 | 2617270741 | Bacteria | 8201522 |
| 447 | 2617384924 | 2617270742 | Bacteria | 6808054 |
| 448 | 2671111822 | 2667528174 | Bacteria | 6435400 |
| 449 | 2671123700 | 2667528175 | Bacteria | 7532676 |
| 450 | 2671694021 | 2671180139 | Bacteria | 4196045 |
| 451 | 2778173326 | 2775507266 | Bacteria | 7392367 |
| 452 | 2793060162 | 2791355196 | Bacteria | 7323613 |
| 453 | 2793066387 | 2791355197 | Bacteria | 8420563 |
| 454 | 2805917519 | 2802429603 | Bacteria | 8777136 |
| 455 | 2818242369 | 2816332527 | Bacteria | 8933356 |
| 456 | 2819609967 | 2818991448 | Bacteria | 6772224 |
| 457 | 2819640078 | 2818991453 | Bacteria | 7181617 |
| 458 | 2824602035 | 2824600985 | Bacteria | 8488197 |
| 459 | 2824610023 | 2824609381 | Bacteria | 8672835 |
| 460 | 2824620180 | 2824617872 | Bacteria | 8814715 |
| 461 | 2824627609 | 2824626560 | Bacteria | 8813858 |
| 462 | 2824639419 | 2824635225 | Bacteria | 8785348 |
| 463 | 2824646527 | 2824644064 | Bacteria | 8743947 |
| 464 | 2824654879 | 2824653114 | Bacteria | 8493680 |
| 465 | 2824662218 | 2824661429 | Bacteria | 9877870 |
| 466 | 2824677123 | 2824671348 | Bacteria | 8369588 |
| 467 | 2824682461 | 2824679649 | Bacteria | 8248951 |
| 468 | 2824693887 | 2824687955 | Bacteria | 8360029 |
| 469 | 2824697018 | 2824696289 | Bacteria | 8335049 |
| 470 | 2824722459 | 2824714736 | Bacteria | 8717648 |
| 471 | 2824726985 | 2824723954 | Bacteria | 8758240 |
| 472 | 2824733632 | 2824732956 | Bacteria | 7810675 |
| 473 | 2824747360 | 2824746037 | Bacteria | 7911610 |
| 474 | 2824774124 | 2824773399 | Bacteria | 8360218 |
| 475 | 2838033278 | 2838029111 | Bacteria | 6603031 |
| 476 | 2838127706 | 2838122688 | Bacteria | 8803140 |
| 477 | 2841914617 | 2841911363 | Bacteria | 6173697 |
| 478 | 2841920218 | 2841917233 | Bacteria | 6173500 |
| 479 | 2841941346 | 2841941048 | Bacteria | 8688029 |
| 480 | 2841952646 | 2841949485 | Bacteria | 8680857 |
| 481 | 2841959677 | 2841957949 | Bacteria | 8652217 |
| 482 | 2841967481 | 2841966195 | Bacteria | 8673214 |
| 483 | 2841979122 | 2841974524 | Bacteria | 8931498 |
| 484 | 2841986665 | 2841983080 | Bacteria | 8395090 |
| 485 | 2842480057 | 2842475841 | Bacteria | 6603183 |
| 486 | 2842483752 | 2842482326 | Bacteria | 7212537 |
| 487 | 2842505158 | 2842502639 | Bacteria | 6604161 |
| 488 | 2847945303 | 2847939898 | Bacteria | 8606328 |
| 489 | 2849080514 | 2849076700 | Bacteria | 7039503 |
| 490 | 2852644694 | 2852643534 | Bacteria | 3013378 |
| 491 | 2857510139 | 2857509624 | Bacteria | 7472071 |
| 492 | 2857530121 | 2857524615 | Bacteria | 6615449 |
| 493 | 2857734193 | 2857733635 | Bacteria | 3532004 |
| 494 | 2873314615 | 2873314349 | Bacteria | 8512634 |
| 495 | 2874618391 | 2874612657 | Bacteria | 8252029 |
| 496 | 2874632626 | 2874628541 | Bacteria | 8630250 |
| 497 | 2876766518 | 2876761206 | Bacteria | 10111113 |
| 498 | 2879109222 | 2879099564 | Bacteria | 10442239 |
| 499 | 2881670392 | 2881665667 | Bacteria | 8175609 |
| 500 | 2885372738 | 2885366525 | Bacteria | 8326213 |
| 501 | 2885385004 | 2885383462 | Bacteria | 9473874 |
| 502 | 2885409749 | 2885409591 | Bacteria | 9235467 |
| 503 | 2888382709 | 2888378607 | Bacteria | 9652610 |
| 504 | 2888423216 | 2888419890 | Bacteria | 7857137 |
| 505 | 2903729756 | 2903727486 | Bacteria | 8281579 |
| 506 | 2903770183 | 2903768456 | Bacteria | 9749579 |
| 507 | 2904699055 | 2904690495 | Bacteria | 9412302 |
| 508 | 2904700895 | |||
| 509 | 2908741372 | 2908739725 | Bacteria | 8628932 |
| 510 | 2908763419 | 2908756301 | Bacteria | 8864324 |
| 511 | 2908778864 | 2908775508 | Bacteria | 8092255 |
| 512 | 2919076876 | 2919073203 | Bacteria | 6531949 |
| 513 | 2919410322 | 2919408235 | Bacteria | 6149349 |
| 514 | 2922375289 | |||
| 515 | 2922395143 | 2922393267 | Bacteria | 8285685 |
| 516 | 2922431776 | |||
| 517 | 2929615966 | 2929615660 | Bacteria | 9193770 |
| 518 | 2929630579 | 2929624759 | Bacteria | 9339455 |
| 519 | 2932433949 | 2932431166 | Bacteria | 4215299 |
| 520 | 2932800982 | 2932794094 | Bacteria | 7915132 |
| 521 | 2932804636 | 2932801729 | Bacteria | 7987968 |
| 522 | 2932819623 | 2932818245 | Bacteria | 9955613 |
| 523 | 2933578748 | 2933577622 | Bacteria | 9116884 |
| 524 | 2935611285 | 2935608549 | Bacteria | 8203142 |
| 525 | 2935618804 | 2935616580 | Bacteria | 9032984 |
| 526 | 2935636859 | 2935630451 | Bacteria | 8169952 |
| 527 | 2935647435 | 2935638405 | Bacteria | 10015038 |
| 528 | 2935672894 | 2935665750 | Bacteria | 9571747 |
| 529 | 2935676814 | 2935675223 | Bacteria | 9928132 |
| 530 | 2935687775 | 2935684952 | Bacteria | 9590419 |
| 531 | 2935695590 | 2935694250 | Bacteria | 9291695 |
| 532 | 2935708142 | 2935703347 | Bacteria | 10242284 |
| 533 | 2935714794 | 2935713505 | Bacteria | 9608509 |
| 534 | 2935726641 | 2935722832 | Bacteria | 9608746 |
| 535 | 2935739410 | 2935732158 | Bacteria | 9706831 |
| 536 | 2935748448 | 2935741537 | Bacteria | 9707219 |
| 537 | 2935754969 | 2935750917 | Bacteria | 9590372 |
| 538 | 2935761049 | 2935760218 | Bacteria | 9817913 |
| 539 | 2935809821 | 2935801545 | Bacteria | 9301974 |
| 540 | 2935820762 | 2935819856 | Bacteria | 8261050 |
| 541 | 2935836803 | 2935827899 | Bacteria | 10038562 |
| 542 | 2935839420 | 2935837841 | Bacteria | 9454360 |
| 543 | 2935850978 | 2935847175 | Bacteria | 8228321 |
| 544 | 2935857169 | 2935855204 | Bacteria | 9035059 |
| 545 | 2935864710 | 2935864058 | Bacteria | 9784707 |
| 546 | 2935876488 | 2935873716 | Bacteria | 9632195 |
| 547 | 2935885133 | 2935883170 | Bacteria | 7964738 |
| 548 | 2935963521 | 2935959822 | Bacteria | 7869783 |
| 549 | 2936009378 | 2936002035 | Bacteria | 9362176 |
| 550 | 2940559654 | 2940556831 | Bacteria | 9590747 |
| 551 | 2941513496 | 2941507105 | Bacteria | 8166816 |
| 552 | 2941521459 | 2941515067 | Bacteria | 8166720 |
| 553 | 2941529221 | 2941523033 | Bacteria | 8169134 |
| 554 | 2941536184 | 2941531003 | Bacteria | 7653939 |
| 555 | 2941540109 | 2941538514 | Bacteria | 9402094 |
| 556 | 3005418857 | 3005416602 | Bacteria | 7064308 |
| 557 | 3005481594 | 3005474847 | Bacteria | 9259049 |
| 558 | 3005488094 | 3005483717 | Bacteria | 7877331 |
| 559 | 3005512783 | 3005506211 | Bacteria | 6943378 |
| 560 | 3005590548 | 3005587118 | Bacteria | 7794411 |
| 561 | 3005713685 | 3005710791 | Bacteria | 7622528 |
| 562 | 3005721071 | 3005718088 | Bacteria | 8283608 |
| 563 | 8005318251 | 8005314921 | Bacteria | 7072929 |
| 564 | 8005488868 | 8005484373 | Bacteria | 6297373 |
| 565 | 8005645757 | 8005645114 | Bacteria | 6950293 |
| 566 | 8005682562 | 8005682033 | Bacteria | 6726518 |
| 567 | 8006927047 | 8006926726 | Bacteria | 6749210 |
| 568 | 8006939145 | 8006933436 | Bacteria | 10410654 |
| 569 | 8006978803 | 8006973647 | Bacteria | 10679141 |
| 570 | 8019581148 | 8019576017 | Bacteria | 10049540 |
| 571 | 8019588800 | 8019586578 | Bacteria | 10212056 |
| 572 | 8019602457 | 8019597564 | Bacteria | 10041141 |
| 573 | 8019616102 | 8019608314 | Bacteria | 10042931 |
| 574 | 8019656692 | 8019648815 | Bacteria | 10014479 |
| 575 | 8055747613 | 8055742211 | Bacteria | 9226248 |
| 576 | 8056684182 | 8056681323 | Bacteria | 8472857 |
| 577 | 8056690520 | 8056689827 | Bacteria | 6712655 |
| 578 | 8056972256 | 8056967851 | Bacteria | 9038162 |
| 579 | Ga0500608_113852 | |||
| 580 | JGI24740J21852_10000932 | |||
| 581 | JGI24743J22301_10001993 | |||
| 582 | JGI24750J21931_1001566 | |||
| 583 | JGI25155J39150_1000122 | |||
| 584 | JGI25156J39149_1000242 | |||
| 585 | JGI25162J39368_1000545 | |||
| 586 | JGI25154J39366_1000225 | |||
| 587 | JGI25157J39369_1000273 | |||
| 588 | JGI25165J46597_1000411 | |||
| 589 | JGI25165J46597_1001848 | |||
| 590 | Ga0070683_100288615 | |||
| 591 | Ga0070690_100020662 | |||
| 592 | Ga0070670_100001813 | |||
| 593 | Ga0070670_100005712 | |||
| 594 | Ga0070670_100011583 | |||
| 595 | Ga0070670_100255501 | |||
| 596 | Ga0070682_100159682 | |||
| 597 | Ga0068868_100182411 | |||
| 598 | Ga0070660_100228760 | |||
| 599 | Ga0070661_100005543 | |||
| 600 | Ga0070669_100042529 | |||
| 601 | Ga0070675_100016589 | |||
| 602 | Ga0070675_100021266 | |||
| 603 | Ga0070674_100027738 | |||
| 604 | Ga0070673_100171039 | |||
| 605 | Ga0070688_100145063 | |||
| 606 | Ga0070667_100017341 | |||
| 607 | Ga0070714_100068061 | |||
| 608 | Ga0070713_100002646 | |||
| 609 | Ga0070713_100098561 | |||
| 610 | Ga0070713_100104803 | |||
| 611 | Ga0070701_10088393 | |||
| 612 | Ga0070711_100018265 | |||
| 613 | Ga0070711_100025377 | |||
| 614 | Ga0070700_100014170 | |||
| 615 | Ga0070663_100173683 | |||
| 616 | Ga0070663_100336294 | |||
| 617 | Ga0070662_100004623 | |||
| 618 | Ga0070681_10150259 | |||
| 619 | Ga0070685_10008944 | |||
| 620 | Ga0070698_100221849 | |||
| 621 | Ga0070699_100011090 | |||
| 622 | Ga0070684_100001331 | |||
| 623 | Ga0070686_100013106 | |||
| 624 | Ga0070686_100061650 | |||
| 625 | Ga0070665_100028657 | |||
| 626 | Ga0070704_100042810 | |||
| 627 | Ga0070664_100198988 | |||
| 628 | Ga0070664_100286149 | |||
| 629 | Ga0068857_100123280 | |||
| 630 | Ga0068854_100054108 | |||
| 631 | Ga0068856_100020697 | |||
| 632 | Ga0068856_100070101 | |||
| 633 | Ga0070702_100004877 | |||
| 634 | Ga0068852_100118590 | |||
| 635 | Ga0068859_100040117 | |||
| 636 | Ga0068859_100352810 | |||
| 637 | Ga0068864_100043667 | |||
| 638 | Ga0068866_10019587 | |||
| 639 | Ga0068861_100043844 | |||
| 640 | Ga0068870_10014484 | |||
| 641 | Ga0068863_100072479 | |||
| 642 | Ga0068863_100151843 | |||
| 643 | Ga0068863_100379370 | |||
| 644 | Ga0068858_100020520 | |||
| 645 | Ga0068858_100097403 | |||
| 646 | Ga0068858_100215592 | |||
| 647 | Ga0068862_100027901 | |||
| 648 | Ga0081455_10186854 | |||
| 649 | Ga0081540_1047913 | |||
| 650 | Ga0075365_10028679 | |||
| 651 | Ga0075368_10040193 | |||
| 652 | Ga0075368_10045595 | |||
| 653 | Ga0075363_100108671 | |||
| 654 | Ga0075363_100110971 | |||
| 655 | Ga0075364_10025553 | |||
| 656 | Ga0075364_10100986 | |||
| 657 | Ga0070712_100013835 | |||
| 658 | Ga0075367_10022741 | |||
| 659 | Ga0075367_10025168 | |||
| 660 | Ga0075367_10186326 | |||
| 661 | Ga0075369_10004982 | |||
| 662 | Ga0075366_10005206 | |||
| 663 | Ga0075366_10013465 | |||
| 664 | Ga0097621_100210341 | |||
| 665 | Ga0075370_10049274 | |||
| 666 | Ga0075370_10087433 | |||
| 667 | Ga0075428_100048269 | |||
| 668 | Ga0075428_100112212 | |||
| 669 | Ga0068865_100230059 | |||
| 670 | Ga0097620_100040116 | |||
| 671 | Ga0097620_100352776 | |||
| 672 | Ga0099824_1010107 | |||
| 673 | Ga0099822_1001351 | |||
| 674 | Ga0105240_10000014 | |||
| 675 | Ga0105240_10419039 | |||
| 676 | Ga0105245_10001585 | |||
| 677 | Ga0105247_10019591 | |||
| 678 | Ga0114129_10006854 | |||
| 679 | Ga0105242_10068951 | |||
| 680 | Ga0105242_10258480 | |||
| 681 | Ga0105248_10023815 | |||
| 682 | Ga0105248_10055885 | |||
| 683 | Ga0105248_10056381 | |||
| 684 | Ga0105248_10305689 | |||
| 685 | Ga0105237_10006102 | |||
| 686 | Ga0105237_10240014 | |||
| 687 | Ga0105238_10129002 | |||
| 688 | Ga0105249_10044906 | |||
| 689 | Ga0105249_10127186 | |||
| 690 | Ga0105239_10005173 | |||
| 691 | Ga0105239_10175077 | |||
| 692 | Ga0105239_10250159 | |||
| 693 | Ga0105246_10028796 | |||
| 694 | Ga0105246_10054761 | |||
| 695 | Ga0105246_10166814 | |||
| 696 | Ga0157373_10003649 | |||
| 697 | Ga0157370_10000015 | |||
| 698 | Ga0157370_10478013 | |||
| 699 | Ga0157369_10127162 | |||
| 700 | Ga0157374_10044638 | |||
| 701 | Ga0157378_10017661 | |||
| 702 | Ga0157378_10423149 | |||
| 703 | Ga0157375_10041728 | |||
| 704 | Ga0163163_10032288 | |||
| 705 | Ga0163163_10038522 | |||
| 706 | Ga0163163_10368757 | |||
| 707 | Ga0157380_10399677 | |||
| 708 | Ga0157379_10053696 | |||
| 709 | Ga0182007_10002551 | |||
| 710 | Ga0182005_1002250 | |||
| 711 | Ga0163161_10210738 | |||
| 712 | Ga0228598_1001818 | |||
| 713 | Ga0209435_100005 | |||
| 714 | Ga0209437_100058 | |||
| 715 | Ga0209437_100060 | |||
| 716 | Ga0209646_1000011 | |||
| 717 | Ga0209646_1003398 | |||
| 718 | Ga0209026_1000008 | |||
| 719 | Ga0209677_100281 | |||
| 720 | Ga0209677_100897 | |||
| 721 | Ga0209759_1000004 | |||
| 722 | Ga0209233_1000137 | |||
| 723 | Ga0209233_1000149 | |||
| 724 | Ga0209233_1000160 | |||
| 725 | Ga0209233_1000921 | |||
| 726 | Ga0209233_1006615 | |||
| 727 | Ga0209025_1028152 | |||
| 728 | Ga0209564_1003706 | |||
| 729 | Ga0209564_1034651 | |||
| 730 | Ga0209758_1000903 | |||
| 731 | Ga0209257_1017217 | |||
| 732 | Ga0207710_10013137 | |||
| 733 | Ga0207710_10089764 | |||
| 734 | Ga0207688_10001843 | |||
| 735 | Ga0207645_10010034 | |||
| 736 | Ga0207643_10020992 | |||
| 737 | Ga0207707_10000615 | |||
| 738 | Ga0207707_10000914 | |||
| 739 | Ga0207707_10058416 | |||
| 740 | Ga0207707_10113341 | |||
| 741 | Ga0207695_10000037 | |||
| 742 | Ga0207695_10085465 | |||
| 743 | Ga0207671_10089475 | |||
| 744 | Ga0207693_10063204 | |||
| 745 | Ga0207663_10017960 | |||
| 746 | Ga0207663_10109954 | |||
| 747 | Ga0207660_10000729 | |||
| 748 | Ga0207660_10021828 | |||
| 749 | Ga0207662_10013946 | |||
| 750 | Ga0207649_10165906 | |||
| 751 | Ga0207652_10003555 | |||
| 752 | Ga0207694_10293614 | |||
| 753 | Ga0207650_10000666 | |||
| 754 | Ga0207650_10007474 | |||
| 755 | Ga0207650_10044083 | |||
| 756 | Ga0207650_10113179 | |||
| 757 | Ga0207659_10303962 | |||
| 758 | Ga0207687_10011012 | |||
| 759 | Ga0207687_10031401 | |||
| 760 | Ga0207700_10001630 | |||
| 761 | Ga0207700_10025188 | |||
| 762 | Ga0207700_10272140 | |||
| 763 | Ga0207644_10003067 | |||
| 764 | Ga0207690_10209417 | |||
| 765 | Ga0207706_10010880 | |||
| 766 | Ga0207706_10023923 | |||
| 767 | Ga0207706_10115488 | |||
| 768 | Ga0207686_10091486 | |||
| 769 | Ga0207709_10028709 | |||
| 770 | Ga0207670_10276802 | |||
| 771 | Ga0207669_10107544 | |||
| 772 | Ga0207704_10018073 | |||
| 773 | Ga0207691_10013141 | |||
| 774 | Ga0207691_10310534 | |||
| 775 | Ga0207711_10113049 | |||
| 776 | Ga0207711_10389189 | |||
| 777 | Ga0207689_10089558 | |||
| 778 | Ga0207679_10232251 | |||
| 779 | Ga0207679_10264484 | |||
| 780 | Ga0207679_10292331 | |||
| 781 | Ga0207667_10061384 | |||
| 782 | Ga0207651_10039396 | |||
| 783 | Ga0207640_10000905 | |||
| 784 | Ga0207640_10073439 | |||
| 785 | Ga0207640_10134092 | |||
| 786 | Ga0207677_10018924 | |||
| 787 | Ga0207677_10054518 | |||
| 788 | Ga0207677_10059995 | |||
| 789 | Ga0207703_10046212 | |||
| 790 | Ga0207703_10080930 | |||
| 791 | Ga0207703_10405162 | |||
| 792 | Ga0207678_10055479 | |||
| 793 | Ga0207678_10163673 | |||
| 794 | Ga0207708_10018464 | |||
| 795 | Ga0207702_10026046 | |||
| 796 | Ga0207702_10049286 | |||
| 797 | Ga0207641_10061894 | |||
| 798 | Ga0207648_10063764 | |||
| 799 | Ga0207676_10113283 | |||
| 800 | Ga0207674_10080434 | |||
| 801 | Ga0207675_100018937 | |||
| 802 | Ga0207698_10084958 | |||
| 803 | Ga0209589_1000006 | |||
| 804 | Ga0209489_100007 | |||
| 805 | Ga0209700_100008 | |||
| 806 | Ga0207428_10031975 | |||
| 807 | Ga0268266_10063441 | |||
| 808 | Ga0268266_10066508 | |||
| 809 | Ga0268265_10058079 | |||
| 810 | Ga0268264_10180739 | |||
| 811 | Ga0265332_10031519 | |||
| 812 | Ga0307508_10030322 | |||
| 813 | Ga0307516_10004419 | |||
| 814 | Ga0307516_10079474 | |||
| 815 | Ga0373934_0039398 | |||
| 816 | Ga0373923_0089810 | |||
| 817 | Ga0373936_0027514 | |||
| 818 | Ga0373954_0018867 | |||
| 819 | Ga0373955_0011982 | |||
| 820 | Ga0373924_0008070 | |||
| 821 | Ga0373927_0030720 | |||
| 822 | Ga0373933_0032113 | |||
| 823 | Ga0373947_0035079 | |||
| 824 | Ga0373937_0158396 | |||
| 825 | Ga0395900_0035738 | |||
| 826 | Ga0395900_0281146 | |||
| 827 | Ga0395898_0006673 | |||
| 828 | Ga0395898_0017739 | |||
| 829 | Ga0436364_1000946 | |||
| 830 | Ga0395901_0074428 | |||
| 831 | Ga0436365_0254253 | |||
| 832 | Ga0436365_0944082 | |||
| 833 | Ga0436365_1685274 | |||
| 834 | Ga0439446_0008791 | |||
| 835 | Ga0439434_0010453 | |||
| 836 | Ga0466963_0020974 | |||
| 837 | Ga0466971_0052257 | |||
| 838 | Ga0466970_0007088 | |||
| 839 | Ga0466957_0011840 | |||
| 840 | Ga0466957_0135823 | |||
| 841 | Ga0466959_0086098 | |||
| 842 | Ga0466958_0011895 | |||
| 843 | Ga0466958_0176837 | |||
| 844 | Ga0466967_0026825 | |||
| 845 | Ga0495629_0214430 | |||
| 846 | Ga0495651_0056932 | |||
| 847 | Ga0495653_0197954 | |||
| 848 | Ga0495580_0034230 | |||
| 849 | Ga0495582_0023546 | |||
| 850 | Ga0495639_0019067 | |||
| 851 | Ga0495662_0066304 | |||
| 852 | Ga0495610_0016114 | |||
| 853 | Ga0495616_0081133 | |||
| 854 | Ga0495631_0000068 | |||
| 855 | Ga0495643_0060766 | |||
| 856 | Ga0495652_0116909 | |||
| 857 | Ga0495665_0016217 | |||
| 858 | Ga0495665_0049860 | |||
| 859 | Ga0495640_0013301 | |||
| 860 | Ga0495622_0062100 | |||
| 861 | Ga0495656_0018966 | |||
| 862 | Ga0495625_0001719 | |||
| 863 | Ga0495625_0004709 | |||
| 864 | Ga0495647_0021731 | |||
| 865 | Ga0495670_0000994 | |||
| 866 | Ga0495589_0055749 | |||
| 867 | Ga0495604_0113418 | |||
| 868 | Ga0495674_0228385 | |||
| 869 | Ga0495672_0120165 | |||
| 870 | Ga0495676_0195296 | |||
| 871 | Ga0495680_0168640 | |||
| 872 | Ga0495687_076514 | |||
| 873 | Ga0495684_0004856 | |||
| 874 | Ga0495593_0021527 | |||
| 875 | Ga0495593_0104381 | |||
| 876 | Ga0496100_0014089 | |||
| 877 | Ga0496100_0075522 | |||
| 878 | Ga0496101_0017549 | |||
| 879 | Ga0496101_0053356 | |||
| 880 | Ga0496101_0243996 | |||
| 881 | Ga0496102_0010591 | |||
| 882 | Ga0496102_0070159 | |||
| 883 | Ga0496102_0113768 | |||
| 884 | Ga0496103_0003532 | |||
| 885 | Ga0496103_0009028 | |||
| 886 | Ga0496103_0025666 | |||
| 887 | Ga0496104_0001496 | |||
| 888 | Ga0496104_0009501 | |||
| 889 | Ga0496105_0008375 | |||
| 890 | Ga0496106_0002833 | |||
| 891 | Ga0496106_0014798 | |||
| 892 | Ga0496106_0241839 | |||
| 893 | Ga0496107_0003151 | |||
| 894 | Ga0496107_0007961 | |||
| 895 | Ga0496108_0001611 | |||
| 896 | Ga0496108_0051188 | |||
| 897 | Ga0496109_0000704 | |||
| 898 | Ga0496109_0055581 | |||
| 899 | Ga0496111_0013603 | |||
| 900 | Ga0496112_0005181 | |||
| 901 | Ga0496112_0082885 | |||
| 902 | Ga0496113_0000675 | |||
| 903 | Ga0496115_0002859 | |||
| 904 | Ga0496115_0077047 | |||
| 905 | Ga0496115_0385624 | |||
| 906 | Ga0496116_0004200 | |||
| 907 | Ga0496116_0098433 | |||
| 908 | Ga0496117_0004154 | |||
| 909 | Ga0496117_0036871 | |||
| 910 | Ga0496117_0044962 | |||
| 911 | Ga0496117_0053187 | |||
| 912 | Ga0496118_0002863 | |||
| 913 | Ga0496118_0007010 | |||
| 914 | Ga0496118_0069301 | |||
| 915 | Ga0496118_0081279 | |||
| 916 | Ga0496119_0010275 | |||
| 917 | Ga0496119_0116342 | |||
| 918 | Ga0496119_0122029 | |||
| 919 | Ga0496121_0003295 | |||
| 920 | Ga0496121_0010917 | |||
| 921 | Ga0496121_0012634 | |||
| 922 | Ga0496121_0047909 | |||
| 923 | Ga0496121_0052069 | |||
| 924 | Ga0496121_0187333 | |||
| 925 | Ga0496122_0061949 | |||
| 926 | Ga0496122_0065408 | |||
| 927 | Ga0496123_0005436 | |||
| 928 | Ga0496123_0006650 | |||
| 929 | Ga0496123_0100221 | |||
| 930 | Ga0496124_0042585 | |||
| 931 | Ga0496124_0057558 | |||
| 932 | Ga0496124_0127789 | |||
| 933 | Ga0496125_0075582 | |||
| 934 | Ga0496125_0125491 | |||
| 935 | Ga0496125_0168553 | |||
| 936 | Ga0496126_0009480 | |||
| 937 | Ga0496126_0010298 | |||
| 938 | Ga0496126_0249191 | |||
| 939 | Ga0496126_0259809 | |||
| 940 | Ga0501031_0000035 | |||
| 941 | Ga0501032_0000022 | |||
| 942 | Ga0501033_0000037 | |||
| 943 | Ga0501034_0000634 | |||
| 944 | Ga0501036_0000013 | |||
| 945 | Ga0501037_0000016 | |||
| 946 | Ga0501038_0000015 | |||
| 947 | Ga0501039_0000013 | |||
| 948 | Ga0501043_0000299 | |||
| 949 | Ga0501046_0104776 | |||
| 950 | Ga0501047_0005024 | |||
| 951 | Ga0501070_0015723 | |||
| 952 | Ga0501075_0342255 | |||
| 953 | Ga0501035_0000046 | |||
| 954 | Ga0501044_0000038 | |||
| 955 | Ga0501045_0326963 | |||
| 956 | nmdc:mga03n38_85937_c1 | |||
| 957 | nmdc:mga00v17_156351_c1 | |||
| 958 | nmdc:mga0yw44_125541_c1 | |||
| 959 | nmdc:mga0yw44_150920_c1 | |||
| 960 | nmdc:mga0yw44_2599_c1 | |||
| 961 | nmdc:mga0yw44_66020_c1 | |||
| 962 | nmdc:mga0yw44_82152_c1 | |||
| 963 | nmdc:mga0k408_146847_c1 | |||
| 964 | nmdc:mga0k408_30033_c1 | |||
| 965 | nmdc:mga06z11_13060_c1 | |||
| 966 | nmdc:mga06z11_49715_c1 | |||
| 967 | nmdc:mga07m45_65239_c1 | |||
| 968 | nmdc:mga05p37_1928_c1 | |||
| 969 | nmdc:mga08y16_125898_c1 | |||
| 970 | nmdc:mga0n895_16793_c1 | |||
| 971 | nmdc:mga0sz30_17271_c1 | |||
| 972 | Ga0495601_0019513 | |||
| 973 | Ga0495601_0124072 | |||
| 974 | Ga0495601_0132429 | |||
| 975 | Ga0495612_0017447 | |||
| 976 | Ga0500610_0016027 | |||
| 977 | Ga0495595_0006786 | |||
| 978 | Ga0495619_0086616 | |||
| 979 | Ga0500651_0151790 | |||
| 980 | Ga0500566_0001073 | |||
| 981 | Ga0500650_0060878 | |||
| 982 | Ga0500556_0000002 | |||
| 983 | Ga0500569_017580 | |||
| 984 | Ga0500572_000102 | |||
| 985 | Ga0500594_0009542 | |||
| 986 | Ga0500594_0013147 | |||
| 987 | Ga0500642_0000026 | |||
| 988 | Ga0500652_000060 | |||
| 989 | Ga0500568_0000922 | |||
| 990 | Ga0500573_0076066 | |||
| 991 | Ga0500573_0141552 | |||
| 992 | Ga0500577_0043485 | |||
| 993 | Ga0500622_0000994 | |||
| 994 | Ga0500634_0132381 | |||
| 995 | Ga0500639_005225 | |||
| 996 | Ga0500636_0004153 | |||
| 997 | Ga0500636_0016322 | |||
| 998 | Ga0500636_0047349 | |||
| 999 | Ga0500636_0105515 | |||
| 1000 | Ga0500596_000960 | |||
| 1001 | 2509153218 | |||
| 1002 | 2511120884 | |||
| 1003 | 2511397976 | |||
| 1004 | 2513628751 | |||
| 1005 | 2513642741 | |||
| 1006 | 2513653142 | |||
| 1007 | 2513675655 | |||
| 1008 | 2513706790 | |||
| 1009 | 2513720868 | |||
| 1010 | 2513875949 | |||
| 1011 | 2514011391 | |||
| 1012 | 2517103432 | |||
| 1013 | 2524465086 | |||
| 1014 | 2524533762 | |||
| 1015 | 2528852571 | |||
| 1016 | 2585279390 | |||
| 1017 | 2585331120 | |||
| 1018 | 2585531126 | |||
| 1019 | 2585552952 | |||
| 1020 | 2603861350 | |||
| 1021 | 2616306963 | |||
| 1022 | 2616554573 | |||
| 1023 | 2617349388 | |||
| 1024 | 2617378097 | |||
| 1025 | 2617384924 | |||
| 1026 | 2671111822 | |||
| 1027 | 2671123700 | |||
| 1028 | 2671694021 | |||
| 1029 | 2778173326 | |||
| 1030 | 2793060162 | |||
| 1031 | 2793066387 | |||
| 1032 | 2805917519 | |||
| 1033 | 2818242369 | |||
| 1034 | 2819609967 | |||
| 1035 | 2819640078 | |||
| 1036 | 2824602035 | |||
| 1037 | 2824610023 | |||
| 1038 | 2824620180 | |||
| 1039 | 2824627609 | |||
| 1040 | 2824639419 | |||
| 1041 | 2824646527 | |||
| 1042 | 2824654879 | |||
| 1043 | 2824662218 | |||
| 1044 | 2824677123 | |||
| 1045 | 2824682461 | |||
| 1046 | 2824693887 | |||
| 1047 | 2824697018 | |||
| 1048 | 2824722459 | |||
| 1049 | 2824726985 | |||
| 1050 | 2824733632 | |||
| 1051 | 2824747360 | |||
| 1052 | 2824774124 | |||
| 1053 | 2838033278 | |||
| 1054 | 2838127706 | |||
| 1055 | 2841914617 | |||
| 1056 | 2841920218 | |||
| 1057 | 2841941346 | |||
| 1058 | 2841952646 | |||
| 1059 | 2841959677 | |||
| 1060 | 2841967481 | |||
| 1061 | 2841979122 | |||
| 1062 | 2841986665 | |||
| 1063 | 2842480057 | |||
| 1064 | 2842483752 | |||
| 1065 | 2842505158 | |||
| 1066 | 2847945303 | |||
| 1067 | 2849080514 | |||
| 1068 | 2852644694 | |||
| 1069 | 2857510139 | |||
| 1070 | 2857530121 | |||
| 1071 | 2857734193 | |||
| 1072 | 2873314615 | |||
| 1073 | 2874618391 | |||
| 1074 | 2874632626 | |||
| 1075 | 2876766518 | |||
| 1076 | 2879109222 | |||
| 1077 | 2881670392 | |||
| 1078 | 2885372738 | |||
| 1079 | 2885385004 | |||
| 1080 | 2885409749 | |||
| 1081 | 2888382709 | |||
| 1082 | 2888423216 | |||
| 1083 | 2903729756 | |||
| 1084 | 2903770183 | |||
| 1085 | 2904699055 | |||
| 1086 | 2904700895 | |||
| 1087 | 2908741372 | |||
| 1088 | 2908763419 | |||
| 1089 | 2908778864 | |||
| 1090 | 2919076876 | |||
| 1091 | 2919410322 | |||
| 1092 | 2922375289 | |||
| 1093 | 2922395143 | |||
| 1094 | 2922431776 | |||
| 1095 | 2929615966 | |||
| 1096 | 2929630579 | |||
| 1097 | 2932433949 | |||
| 1098 | 2932800982 | |||
| 1099 | 2932804636 | |||
| 1100 | 2932819623 | |||
| 1101 | 2933578748 | |||
| 1102 | 2935611285 | |||
| 1103 | 2935618804 | |||
| 1104 | 2935636859 | |||
| 1105 | 2935647435 | |||
| 1106 | 2935672894 | |||
| 1107 | 2935676814 | |||
| 1108 | 2935687775 | |||
| 1109 | 2935695590 | |||
| 1110 | 2935708142 | |||
| 1111 | 2935714794 | |||
| 1112 | 2935726641 | |||
| 1113 | 2935739410 | |||
| 1114 | 2935748448 | |||
| 1115 | 2935754969 | |||
| 1116 | 2935761049 | |||
| 1117 | 2935809821 | |||
| 1118 | 2935820762 | |||
| 1119 | 2935836803 | |||
| 1120 | 2935839420 | |||
| 1121 | 2935850978 | |||
| 1122 | 2935857169 | |||
| 1123 | 2935864710 | |||
| 1124 | 2935876488 | |||
| 1125 | 2935885133 | |||
| 1126 | 2935963521 | |||
| 1127 | 2936009378 | |||
| 1128 | 2940559654 | |||
| 1129 | 2941513496 | |||
| 1130 | 2941521459 | |||
| 1131 | 2941529221 | |||
| 1132 | 2941536184 | |||
| 1133 | 2941540109 | |||
| 1134 | 3005418857 | |||
| 1135 | 3005481594 | |||
| 1136 | 3005488094 | |||
| 1137 | 3005512783 | |||
| 1138 | 3005590548 | |||
| 1139 | 3005713685 | |||
| 1140 | 3005721071 | |||
| 1141 | 8005318251 | |||
| 1142 | 8005488868 | |||
| 1143 | 8005645757 | |||
| 1144 | 8005682562 | |||
| 1145 | 8006927047 | |||
| 1146 | 8006939145 | |||
| 1147 | 8006978803 | |||
| 1148 | 8019581148 | |||
| 1149 | 8019588800 | |||
| 1150 | 8019602457 | |||
| 1151 | 8019616102 | |||
| 1152 | 8019656692 | |||
| 1153 | 8055747613 | |||
| 1154 | 8056684182 | |||
| 1155 | 8056690520 | |||
| 1156 | 8056972256 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2i7g-assembly1.cif.gz_A | crystal structure of monooxygenase from agrobacterium tumefaciens | 0.9541 | 7 | 343 |
| 2i7g-assembly1.cif.gz_A | crystal structure of monooxygenase from agrobacterium tumefaciens | 0.9325 | 7 | 343 |
| 7bip-assembly1.cif.gz_B | crystal structure of monooxygenase rslo1 from streptomyces bottropensis | 0.8719 | 7 | 337 |
| 1luc-assembly1.cif.gz_A | bacterial luciferase | 0.8646 | 7 | 337 |
| 7bip-assembly1.cif.gz_B | crystal structure of monooxygenase rslo1 from streptomyces bottropensis | 0.8596 | 7 | 337 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q2G136_3_353_3.20.20.30 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Luciferase-like domain | 0.943 | 3 | 345 | 3.20.20.30 |
| 2i7gA00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Luciferase-like domain | 0.9413 | 7 | 343 | 3.20.20.30 |
| af_Q2G136_3_353_3.20.20.30 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Luciferase-like domain | 0.935 | 3 | 345 | 3.20.20.30 |
| 2i7gA00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Luciferase-like domain | 0.9331 | 7 | 343 | 3.20.20.30 |
| af_I6X7W8_4_352_3.20.20.30 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Luciferase-like domain | 0.8474 | 6 | 337 | 3.20.20.30 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A0H2KSM3-F1-model_v4 | Luciferase | 0.9896 | 1 | 344 |
GO:0004497
GO:0005829 GO:0016705 |
| AF-A0A4P6N0C1-F1-model_v4 | LLM class flavin-dependent oxidoreductase | 0.9882 | 5 | 344 |
GO:0004497
GO:0005829 GO:0016705 |
| AF-A0A4Q3IUY5-F1-model_v4 | deleted | 0.9879 | 6 | 299 |
|
| AF-A0A558H8F2-F1-model_v4 | LLM class flavin-dependent oxidoreductase | 0.9855 | 3 | 344 |
GO:0004497
GO:0005829 GO:0016705 |
| AF-A0A6G0F4X8-F1-model_v4 | LLM class flavin-dependent oxidoreductase | 0.9851 | 3 | 345 |
GO:0004497
GO:0005829 GO:0016705 |