F465784

General Info

Members Datasets Scaffolds Average Seq Length
578 438 1156 343

Family's Representative Sequence

Representative Sequence 3300053122|Ga0500608_113852|Ga0500608_113852_105_1133
Length 335
Sequence MKHIELGLDTFGDVTSSPAGVPLAHAQVLRNVVDEAVLADTLGIDFIGIGEHHRADFAVSAPEVLLAAAAVRTTRIRLGSAVTVLSSDDPIRVFQRFSTIDALSNGRAEVILGRGSFTESFPLFGYALRDYEKLFEEKLEIFSALISGTAVTWKGTIRPPLIDQQVFPPIEVGVGGSPESVLRAARYNLPLMLAIIGGDPQRFLPYVDLSKRAYEQLKMPMQPIGVHSPGYVAETDEQAREELWPDYKRMRDQIGAERGWPPMEASEFLQEIEHGSLYVGSPETVARKITATAKALGIDRFDLKYSAGALPHEKLMRCIELYGQKVIPMVREMLG

Samples

Sample ID Description Type Environment
1 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
4 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
5 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
6 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
7 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
8 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
9 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
10 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
11 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
12 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
13 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
14 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
15 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
16 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
17 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
18 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
19 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
20 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
21 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
22 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
23 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
24 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
25 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
26 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
27 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
28 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
29 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
30 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
31 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
32 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
33 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
34 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
35 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
36 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
37 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
38 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
39 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
40 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
41 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
42 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
43 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
44 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
45 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
46 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
47 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
48 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
49 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
50 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
51 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
52 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
53 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
54 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
55 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
56 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
57 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
58 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
59 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
60 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
61 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
62 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
63 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
64 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
65 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
66 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
67 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
68 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
69 3300006943 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW Metagenome Nodule
70 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
71 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
72 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
73 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
74 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
75 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
76 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
77 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
78 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
79 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
80 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
81 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
82 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
83 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
84 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
85 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
86 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
87 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
88 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
89 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
90 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
91 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
92 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
93 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
94 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
95 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
96 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
97 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
98 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
99 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
100 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
101 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
102 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
103 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
104 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
105 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
150 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
151 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
152 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
153 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
157 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
158 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
159 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
160 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
161 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
162 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
163 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
164 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
165 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
166 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
167 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
168 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
169 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
170 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
171 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
172 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
173 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
174 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
175 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
176 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
177 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
178 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
179 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
180 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
181 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
182 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
183 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
184 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
185 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
186 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
187 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
188 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
189 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
190 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
191 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
192 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
193 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
194 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
195 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
196 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
197 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
198 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
199 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
200 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
201 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
202 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
203 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
204 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
205 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
206 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
207 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
208 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
209 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
210 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
211 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
212 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
213 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
214 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
215 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
216 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
217 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
218 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
219 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
220 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
221 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
222 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
223 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
224 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
225 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
226 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
227 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
228 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
229 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
230 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
231 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
232 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
233 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
234 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
235 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
236 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
237 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
238 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
239 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
240 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
241 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
242 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
243 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
244 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
245 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
246 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
247 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
248 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
249 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
250 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
251 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
252 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
253 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
254 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
255 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
256 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
257 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
258 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
259 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
260 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
261 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
262 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
263 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
264 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
265 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
266 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
267 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
268 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
269 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
270 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
271 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
272 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
273 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
274 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
275 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
276 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
277 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
278 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
279 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
280 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
281 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
282 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
283 2508501128 Bradyrhizobium sp. ARR65 Isolate Nodule
284 2510917020 Caulobacter sp. AP07 Isolate Rhizosphere
285 2511231028 Bradyrhizobium sp. YR681 Isolate Rhizosphere
286 2513237092 Bradyrhizobium sp. WSM1743 Isolate Nodule
287 2513237094 Bradyrhizobium sp. WSM3983 Isolate Nodule
288 2513237095 Bradyrhizobium diazoefficiens USDA 122 Isolate Nodule
289 2513237098 Bradyrhizobium elkanii WSM2783 Isolate Nodule
290 2513237102 Bradyrhizobium japonicum USDA 135 Isolate Nodule
291 2513237104 Bradyrhizobium sp. EC3.3 Isolate Nodule
292 2513237139 Bradyrhizobium ottawaense USDA 4 Isolate Nodule
293 2513237161 Bradyrhizobium sp. WSM2793 Isolate Nodule
294 2517093001 Bradyrhizobium japonicum USDA 124 Isolate Nodule
295 2524023210 Bradyrhizobium sp. Ai1a-2 Isolate Nodule
296 2524023228 Bradyrhizobium sp. Th.b2 Isolate Nodule
297 2528768022 Bradyrhizobium japonicum USDA 123 Isolate Nodule
298 2582581308 Rhizobium sp. OK494 Isolate Rhizosphere
299 2582581316 Agrobacterium rhizogenes OK036 Isolate Rhizosphere
300 2585427527 Rhizobium lusitanum YR374 Isolate Rhizosphere
301 2585427530 Rhizobium tropici YR635 Isolate Rhizosphere
302 2602042107 Bradyrhizobium sp. NFR13 Isolate Rhizoplane
303 2615840626 Rhizobium lusitanum P1-7 Isolate Nodule
304 2615840698 Rhizobium multihospitium HAMBI 2975 Isolate Nodule
305 2617270735 Bradyrhizobium shewense ERR11 Isolate Nodule
306 2617270741 Bradyrhizobium yuanmingense CCBAU 10071 Isolate Nodule
307 2617270742 Rhizobium miluonense HAMBI 2971 Isolate Nodule
308 2667528174 Rhizobium sp. NFR17 Isolate Rhizoplane
309 2667528175 Rhizobium tropici NFR14 Isolate Rhizoplane
310 2671180139 Chelativorans sp. A52C2 Isolate Unclassified
311 2775507266 Rhizobium tropici PRF 81 Isolate Nodule
312 2791355196 Bradyrhizobium sp. Y36 Isolate Nodule
313 2791355197 Bradyrhizobium sp. C9 Isolate Nodule
314 2802429603 Bradyrhizobium ottawaense L2 Isolate Nodule
315 2816332527 Bradyrhizobium diazoefficiens Y21 Isolate Nodule
316 2818991448 Rhizobium miluonense 1234 Isolate Unclassified
317 2818991453 Rhizobium lusitanum 1158 Isolate Unclassified
318 2824600985 Bradyrhizobium sp.HAMBI 2135 Isolate Unclassified
319 2824609381 Bradyrhizobium sp. HAMBI 2134 Isolate Unclassified
320 2824617872 Bradyrhizobium sp. HAMBI 2133 Isolate Unclassified
321 2824626560 Bradyrhizobium sp. HAMBI 2149 Isolate Unclassified
322 2824635225 Bradyrhizobium sp. HAMBI 2136 Isolate Unclassified
323 2824644064 Bradyrhizobium sp. HAMBI 2137 Isolate Unclassified
324 2824653114 Bradyrhizobium sp. HAMBI 2142 Isolate Unclassified
325 2824661429 Bradyrhizobium sp. HAMBI 2115 Isolate Unclassified
326 2824671348 Bradyrhizobium sp. HAMBI 2125 Isolate Unclassified
327 2824679649 Bradyrhizobium sp.HAMBI 2116 Isolate Unclassified
328 2824687955 Bradyrhizobium sp. HAMBI 2126 Isolate Unclassified
329 2824696289 Bradyrhizobium sp. HAMBI 2127 Isolate Unclassified
330 2824714736 Bradyrhizobium sp. HAMBI 2151 Isolate Unclassified
331 2824723954 Bradyrhizobium sp. HAMBI 2152 Isolate Unclassified
332 2824732956 Bradyrhizobium sp. HAMBI 2153 Isolate Unclassified
333 2824746037 Bradyrhizobium sp. HAMBI 2299 Isolate Unclassified
334 2824773399 Bradyrhizobium sp. HAMBI 2130 Isolate Unclassified
335 2838029111 Rhizobium tropici SEMIA 4079 Isolate Nodule
336 2838122688 Bradyrhizobium sp. CIR3A Isolate Nodule
337 2841911363 Bosea caraganae RCAM04685 Isolate Nodule
338 2841917233 Bosea caraganae RCAM04680 Isolate Nodule
339 2841941048 Bradyrhizobium sp. SBR1B Isolate Nodule
340 2841949485 Bradyrhizobium sp. ERR14 Isolate Nodule
341 2841957949 Bradyrhizobium sp. CIR1 Isolate Nodule
342 2841966195 Bradyrhizobium sp. CIR18 Isolate Nodule
343 2841974524 Bradyrhizobium sp. CIR48 Isolate Nodule
344 2841983080 Bradyrhizobium sp. IAR9 Isolate Nodule
345 2842475841 Rhizobium tropici SEMIA 4059 Isolate Nodule
346 2842482326 Rhizobium lusitanum SEMIA 4060 Isolate Nodule
347 2842502639 Rhizobium tropici SEMIA 4063 Isolate Nodule
348 2847939898 Bradyrhizobium ottawaense OO99 Isolate Unclassified
349 2849076700 Bradyrhizobium symbiodeficiens 85S1MB Isolate Nodule
350 2852643534 Leifsonia sp. AK011 Isolate Rhizosphere
351 2857509624 Bradyrhizobium sp. R-73088 Isolate Unclassified
352 2857524615 Tardiphaga sp. R-73074 Isolate Unclassified
353 2857733635 Salinibacterium sp. R-73062 Isolate Unclassified
354 2873314349 Sphaerisporangium siamense DSM 45784 Isolate Rhizosphere
355 2874612657 Bradyrhizobium forestalis INPA54B Isolate Nodule
356 2874628541 Bradyrhizobium betae Opo-243 Isolate Unclassified
357 2876761206 Bradyrhizobium centrolobii BR 10245 Isolate Nodule
358 2879099564 Bradyrhizobium japonicum UBMA197 Isolate Nodule
359 2881665667 Bradyrhizobium vignae LMG 28791 Isolate Unclassified
360 2885366525 Bradyrhizobium sp. LVM 105 Isolate Unclassified
361 2885383462 Bradyrhizobium sp. Leo170 Isolate Unclassified
362 2885409591 Bradyrhizobium sp. NAS80.1 Isolate Unclassified
363 2888378607 Bradyrhizobium sp. LCT2 Isolate Unclassified
364 2888419890 Bradyrhizobium sp. 1(2017) 63S1MB Isolate Unclassified
365 2903727486 Bradyrhizobium guangzhouense CCBAU 53424 Isolate Unclassified
366 2903768456 Bradyrhizobium sp. Leo121 Isolate Unclassified
367 2904690495 Bradyrhizobium ivorense CI-1B Isolate Nodule
368 2904699407
369 2908739725 Bradyrhizobium sp. UFLA03-84 Isolate Nodule
370 2908756301 Bradyrhizobium ivorense CI-41S Isolate Nodule
371 2908775508 Bradyrhizobium sp. SUTN9-2 Isolate Unclassified
372 2919073203 Tardiphaga robiniae 1155 Isolate Unclassified
373 2919408235 Rhizobium miluonense 3199 Isolate Unclassified
374 2922368715
375 2922393267 Bradyrhizobium sp. WBAH10 Isolate Nodule
376 2922425934
377 2929615660 Bradyrhizobium japonicum TXVA Isolate Nodule
378 2929624759 Bradyrhizobium japonicum TXEA Isolate Nodule
379 2932431166 Cellulosimicrobium sp. 4261 Isolate Rhizosphere
380 2932794094 Bradyrhizobium sp. S3.2.6 Isolate Nodule
381 2932801729 Bradyrhizobium sp. S3.3.6 Isolate Nodule
382 2932818245 Bradyrhizobium sp. S3.9.1 Isolate Nodule
383 2933577622 Bradyrhizobium japonicum SEMIA 417 Isolate Nodule
384 2935608549 Bradyrhizobium sp. RT6a Isolate Nodule
385 2935616580 Bradyrhizobium sp. RT7a Isolate Nodule
386 2935630451 Bradyrhizobium sp. I1.14.4 Isolate Nodule
387 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
388 2935665750 Bradyrhizobium sp. JR7.2 Isolate Nodule
389 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
390 2935684952 Bradyrhizobium sp. LA3.X Isolate Nodule
391 2935694250 Bradyrhizobium sp. LA6.1 Isolate Nodule
392 2935703347 Bradyrhizobium sp. LA6.10 Isolate Nodule
393 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
394 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
395 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
396 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
397 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
398 2935760218 Bradyrhizobium sp. LA7.1 Isolate Nodule
399 2935801545 Bradyrhizobium sp. RT10b Isolate Nodule
400 2935819856 Bradyrhizobium sp. RT3b Isolate Nodule
401 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
402 2935837841 Bradyrhizobium sp. RT4b Isolate Nodule
403 2935847175 Bradyrhizobium sp. RT5a Isolate Nodule
404 2935855204 Bradyrhizobium sp. RT7b Isolate Nodule
405 2935864058 Bradyrhizobium sp. RT9a Isolate Nodule
406 2935873716 Bradyrhizobium sp. RT9b Isolate Nodule
407 2935883170 Bradyrhizobium sp. S3.12.5 Isolate Nodule
408 2935959822 Bradyrhizobium sp. F1.4.3 Isolate Nodule
409 2936002035 Bradyrhizobium sp. I1.8.5 Isolate Nodule
410 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule
411 2941507105 Bradyrhizobium sp. i1.12.3 Isolate Nodule
412 2941515067 Bradyrhizobium sp. i1.14.1 Isolate Nodule
413 2941523033 Bradyrhizobium sp. i1.8.4 Isolate Nodule
414 2941531003 Bradyrhizobium sp. LB11.1 Isolate Nodule
415 2941538514 Bradyrhizobium sp. RT11b Isolate Nodule
416 3005416602 Rhizobium sp. P40RR-XXII Isolate Rhizosphere
417 3005474847 Bradyrhizobium sp. CCBAU 53421 Isolate Nodule
418 3005483717 Bradyrhizobium agreste CNPSo 4010 Isolate Unclassified
419 3005506211 Bradyrhizobium diazoefficiens SZCCT0449 Isolate Unclassified
420 3005587118 Bradyrhizobium glycinis CNPSo 4016 Isolate Unclassified
421 3005710791 Bradyrhizobium genosp. B BDV5040 Isolate Unclassified
422 3005718088 Bradyrhizobium sp. CCBAU 53338 Isolate Nodule
423 8005314921 Rhizobium sp. P28RR-XV Isolate Rhizosphere
424 8005484373 Rhizobium tropici SARCC-755 Isolate Nodule
425 8005645114 Rhizobium tropici IGFRI Rhizo-19 Isolate Rhizosphere
426 8005682033 Rhizobium dioscoreae S-93 Isolate Unclassified
427 8006926726 Bradyrhizobium guangdongense SM32 Isolate Unclassified
428 8006933436 Bradyrhizobium septentrionale 7(2017) Isolate Unclassified
429 8006973647 Bradyrhizobium septentrionale 162S2 Isolate Nodule
430 8019576017 Bradyrhizobium sp. i1.7.7 Isolate Nodule
431 8019586578 Bradyrhizobium sp. i1.4.4 Isolate Nodule
432 8019597564 Bradyrhizobium sp. i1.3.6 Isolate Nodule
433 8019608314 Bradyrhizobium sp. i1.3.1 Isolate Nodule
434 8019648815 Bradyrhizobium sp. GM24.11 Isolate Nodule
435 8055742211 Bradyrhizobium japonicum 5038 Isolate Nodule
436 8056681323 Bradyrhizobium cenepequi CNPSo 4026 Isolate Nodule
437 8056689827 Bradyrhizobium semiaridum WSM 1704 Isolate Nodule
438 8056967851 Bradyrhizobium zhengyangense WYCCWR 12678 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 73.39
Metatranscriptomes 0
Isolates 26.61

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 11.94
Nodule 17.3
Rhizoplane 5.71
Rhizosphere 48.44
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0500608_113852 3300053122 Bacteria 1236
2 JGI24740J21852_10000932 3300001979 Bacteria 13001
3 JGI24743J22301_10001993 3300001991 Bacteria 2983
4 JGI24750J21931_1001566 3300002070 Bacteria 2812
5 JGI25155J39150_1000122 3300002704 Bacteria 37833
6 JGI25156J39149_1000242 3300002705 Bacteria 37833
7 JGI25162J39368_1000545 3300002737 Bacteria 27820
8 JGI25154J39366_1000225 3300002738 Bacteria 37833
9 JGI25157J39369_1000273 3300002741 Bacteria 37833
10 JGI25165J46597_1000411 3300003214 Bacteria 45055
11 JGI25165J46597_1001848 3300003214 Bacteria 8754
12 Ga0070683_100288615 3300005329 Bacteria 1560
13 Ga0070690_100020662 3300005330 Bacteria 4013
14 Ga0070670_100001813 3300005331 Bacteria 17409
15 Ga0070670_100005712 3300005331 Bacteria 10515
16 Ga0070670_100011583 3300005331 Bacteria 7537
17 Ga0070670_100255501 3300005331 Bacteria 1527
18 Ga0070682_100159682 3300005337 Bacteria 1556
19 Ga0068868_100182411 3300005338 Bacteria 1742
20 Ga0070660_100228760 3300005339 Bacteria 1513
21 Ga0070661_100005543 3300005344 Bacteria 8701
22 Ga0070669_100042529 3300005353 Bacteria 3307
23 Ga0070675_100016589 3300005354 Bacteria 5847
24 Ga0070675_100021266 3300005354 Bacteria 5183
25 Ga0070674_100027738 3300005356 Bacteria 3713
26 Ga0070673_100171039 3300005364 Bacteria 1854
27 Ga0070688_100145063 3300005365 Bacteria 1616
28 Ga0070667_100017341 3300005367 Bacteria 5967
29 Ga0070714_100068061 3300005435 Bacteria 3072
30 Ga0070713_100002646 3300005436 Bacteria 11664
31 Ga0070713_100098561 3300005436 Bacteria 2528
32 Ga0070713_100104803 3300005436 Bacteria 2456
33 Ga0070701_10088393 3300005438 Bacteria 1692
34 Ga0070711_100018265 3300005439 Bacteria 4474
35 Ga0070711_100025377 3300005439 Bacteria 3877
36 Ga0070700_100014170 3300005441 Bacteria 4499
37 Ga0070663_100173683 3300005455 Bacteria 1667
38 Ga0070663_100336294 3300005455 Bacteria 1218
39 Ga0070662_100004623 3300005457 Bacteria 8726
40 Ga0070681_10150259 3300005458 Bacteria 2256
41 Ga0070685_10008944 3300005466 Bacteria 5166
42 Ga0070698_100221849 3300005471 Bacteria 1824
43 Ga0070699_100011090 3300005518 Bacteria 7792
44 Ga0070684_100001331 3300005535 Bacteria 17688
45 Ga0070686_100013106 3300005544 Bacteria 4733
46 Ga0070686_100061650 3300005544 Bacteria 2424
47 Ga0070665_100028657 3300005548 Bacteria 5607
48 Ga0070704_100042810 3300005549 Bacteria 3135
49 Ga0070664_100198988 3300005564 Bacteria 1787
50 Ga0070664_100286149 3300005564 Bacteria 1487
51 Ga0068857_100123280 3300005577 Bacteria 2335
52 Ga0068854_100054108 3300005578 Bacteria 2885
53 Ga0068856_100020697 3300005614 Bacteria 6391
54 Ga0068856_100070101 3300005614 Bacteria 3467
55 Ga0070702_100004877 3300005615 Bacteria 6176
56 Ga0068852_100118590 3300005616 Bacteria 2418
57 Ga0068859_100040117 3300005617 Bacteria 4699
58 Ga0068859_100352810 3300005617 Bacteria 1566
59 Ga0068864_100043667 3300005618 Bacteria 3838
60 Ga0068866_10019587 3300005718 Bacteria 3084
61 Ga0068861_100043844 3300005719 Bacteria 3360
62 Ga0068870_10014484 3300005840 Bacteria 3726
63 Ga0068863_100072479 3300005841 Bacteria 3258
64 Ga0068863_100151843 3300005841 Bacteria 2216
65 Ga0068863_100379370 3300005841 Bacteria 1380
66 Ga0068858_100020520 3300005842 Bacteria 6175
67 Ga0068858_100097403 3300005842 Bacteria 2742
68 Ga0068858_100215592 3300005842 Bacteria 1817
69 Ga0068862_100027901 3300005844 Bacteria 4755
70 Ga0081455_10186854 3300005937 Bacteria 1564
71 Ga0081540_1047913 3300005983 Bacteria 2145
72 Ga0075365_10028679 3300006038 Bacteria 3551
73 Ga0075368_10040193 3300006042 Bacteria 1836
74 Ga0075368_10045595 3300006042 Bacteria 1732
75 Ga0075363_100108671 3300006048 Bacteria 1540
76 Ga0075363_100110971 3300006048 Bacteria 1524
77 Ga0075364_10025553 3300006051 Bacteria 3759
78 Ga0075364_10100986 3300006051 Bacteria 1920
79 Ga0070712_100013835 3300006175 Bacteria 5164
80 Ga0075367_10022741 3300006178 Bacteria 3519
81 Ga0075367_10025168 3300006178 Bacteria 3364
82 Ga0075367_10186326 3300006178 Bacteria 1294
83 Ga0075369_10004982 3300006186 Bacteria 4941
84 Ga0075366_10005206 3300006195 Bacteria 7039
85 Ga0075366_10013465 3300006195 Bacteria 4658
86 Ga0097621_100210341 3300006237 Bacteria 1692
87 Ga0075370_10049274 3300006353 Bacteria 2387
88 Ga0075370_10087433 3300006353 Bacteria 1796
89 Ga0075428_100048269 3300006844 Bacteria 4673
90 Ga0075428_100112212 3300006844 Bacteria 2969
91 Ga0068865_100230059 3300006881 Bacteria 1454
92 Ga0097620_100040116 3300006931 Bacteria 4699
93 Ga0097620_100352776 3300006931 Bacteria 1566
94 Ga0099824_1010107 3300006942 Bacteria 11310
95 Ga0099822_1001351 3300006943 Bacteria 28251
96 Ga0105240_10000014 3300009093 Bacteria 482033
97 Ga0105240_10419039 3300009093 Bacteria 1505
98 Ga0105245_10001585 3300009098 Bacteria 20674
99 Ga0105247_10019591 3300009101 Bacteria 4062
100 Ga0114129_10006854 3300009147 Bacteria 16194
101 Ga0105242_10068951 3300009176 Bacteria 2928
102 Ga0105242_10258480 3300009176 Bacteria 1572
103 Ga0105248_10023815 3300009177 Bacteria 6806
104 Ga0105248_10055885 3300009177 Bacteria 4428
105 Ga0105248_10056381 3300009177 Bacteria 4408
106 Ga0105248_10305689 3300009177 Bacteria 1791
107 Ga0105237_10006102 3300009545 Bacteria 13469
108 Ga0105237_10240014 3300009545 Bacteria 1813
109 Ga0105238_10129002 3300009551 Bacteria 2507
110 Ga0105249_10044906 3300009553 Bacteria 4018
111 Ga0105249_10127186 3300009553 Bacteria 2428
112 Ga0105239_10005173 3300010375 Bacteria 15375
113 Ga0105239_10175077 3300010375 Bacteria 2400
114 Ga0105239_10250159 3300010375 Bacteria 1990
115 Ga0105246_10028796 3300011119 Bacteria 3651
116 Ga0105246_10054761 3300011119 Bacteria 2750
117 Ga0105246_10166814 3300011119 Bacteria 1682
118 Ga0157373_10003649 3300013100 Bacteria 11632
119 Ga0157370_10000015 3300013104 Bacteria 185771
120 Ga0157370_10478013 3300013104 Bacteria 1145
121 Ga0157369_10127162 3300013105 Bacteria 2701
122 Ga0157374_10044638 3300013296 Bacteria 4096
123 Ga0157378_10017661 3300013297 Bacteria 6262
124 Ga0157378_10423149 3300013297 Bacteria 1317
125 Ga0157375_10041728 3300013308 Bacteria 4433
126 Ga0163163_10032288 3300014325 Bacteria 5056
127 Ga0163163_10038522 3300014325 Bacteria 4661
128 Ga0163163_10368757 3300014325 Bacteria 1493
129 Ga0157380_10399677 3300014326 Bacteria 1303
130 Ga0157379_10053696 3300014968 Bacteria 3600
131 Ga0182007_10002551 3300015262 Bacteria 8961
132 Ga0182005_1002250 3300015265 Bacteria 7081
133 Ga0163161_10210738 3300017792 Bacteria 1501
134 Ga0228598_1001818 3300024227 Bacteria 4642
135 Ga0209435_100005 3300025206 Bacteria 573745
136 Ga0209437_100058 3300025233 Bacteria 357279
137 Ga0209437_100060 3300025233 Bacteria 355034
138 Ga0209646_1000011 3300025246 Bacteria 573745
139 Ga0209646_1003398 3300025246 Bacteria 3154
140 Ga0209026_1000008 3300025250 Bacteria 573745
141 Ga0209677_100281 3300025253 Bacteria 33858
142 Ga0209677_100897 3300025253 Bacteria 14582
143 Ga0209759_1000004 3300025256 Bacteria 573745
144 Ga0209233_1000137 3300025261 Bacteria 200314
145 Ga0209233_1000149 3300025261 Bacteria 181183
146 Ga0209233_1000160 3300025261 Bacteria 159035
147 Ga0209233_1000921 3300025261 Bacteria 12845
148 Ga0209233_1006615 3300025261 Bacteria 3721
149 Ga0209025_1028152 3300025294 Bacteria 2764
150 Ga0209564_1003706 3300025295 Bacteria 10045
151 Ga0209564_1034651 3300025295 Bacteria 1477
152 Ga0209758_1000903 3300025297 Bacteria 40307
153 Ga0209257_1017217 3300025304 Bacteria 2862
154 Ga0207710_10013137 3300025900 Bacteria 3488
155 Ga0207710_10089764 3300025900 Bacteria 1437
156 Ga0207688_10001843 3300025901 Bacteria 11323
157 Ga0207645_10010034 3300025907 Bacteria 6520
158 Ga0207643_10020992 3300025908 Bacteria 3586
159 Ga0207707_10000615 3300025912 Bacteria 35495
160 Ga0207707_10000914 3300025912 Bacteria 28757
161 Ga0207707_10058416 3300025912 Bacteria 3357
162 Ga0207707_10113341 3300025912 Bacteria 2370
163 Ga0207695_10000037 3300025913 Bacteria 476303
164 Ga0207695_10085465 3300025913 Bacteria 3183
165 Ga0207671_10089475 3300025914 Bacteria 2317
166 Ga0207693_10063204 3300025915 Bacteria 2900
167 Ga0207663_10017960 3300025916 Bacteria 3951
168 Ga0207663_10109954 3300025916 Bacteria 1869
169 Ga0207660_10000729 3300025917 Bacteria 21878
170 Ga0207660_10021828 3300025917 Bacteria 4308
171 Ga0207662_10013946 3300025918 Bacteria 4499
172 Ga0207649_10165906 3300025920 Bacteria 1534
173 Ga0207652_10003555 3300025921 Bacteria 12865
174 Ga0207694_10293614 3300025924 Bacteria 1337
175 Ga0207650_10000666 3300025925 Bacteria 26991
176 Ga0207650_10007474 3300025925 Bacteria 7446
177 Ga0207650_10044083 3300025925 Bacteria 3277
178 Ga0207650_10113179 3300025925 Bacteria 2103
179 Ga0207659_10303962 3300025926 Bacteria 1311
180 Ga0207687_10011012 3300025927 Bacteria 5910
181 Ga0207687_10031401 3300025927 Bacteria 3589
182 Ga0207700_10001630 3300025928 Bacteria 12742
183 Ga0207700_10025188 3300025928 Bacteria 4128
184 Ga0207700_10272140 3300025928 Bacteria 1454
185 Ga0207644_10003067 3300025931 Bacteria 10760
186 Ga0207690_10209417 3300025932 Bacteria 1485
187 Ga0207706_10010880 3300025933 Bacteria 8301
188 Ga0207706_10023923 3300025933 Bacteria 5480
189 Ga0207706_10115488 3300025933 Bacteria 2361
190 Ga0207686_10091486 3300025934 Bacteria 2010
191 Ga0207709_10028709 3300025935 Bacteria 3219
192 Ga0207670_10276802 3300025936 Bacteria 1306
193 Ga0207669_10107544 3300025937 Bacteria 1860
194 Ga0207704_10018073 3300025938 Bacteria 3672
195 Ga0207691_10013141 3300025940 Bacteria 7926
196 Ga0207691_10310534 3300025940 Bacteria 1353
197 Ga0207711_10113049 3300025941 Bacteria 2417
198 Ga0207711_10389189 3300025941 Bacteria 1294
199 Ga0207689_10089558 3300025942 Bacteria 2527
200 Ga0207679_10232251 3300025945 Bacteria 1558
201 Ga0207679_10264484 3300025945 Bacteria 1468
202 Ga0207679_10292331 3300025945 Bacteria 1401
203 Ga0207667_10061384 3300025949 Bacteria 3932
204 Ga0207651_10039396 3300025960 Bacteria 3116
205 Ga0207640_10000905 3300025981 Bacteria 16651
206 Ga0207640_10073439 3300025981 Bacteria 2311
207 Ga0207640_10134092 3300025981 Bacteria 1795
208 Ga0207677_10018924 3300026023 Bacteria 4146
209 Ga0207677_10054518 3300026023 Bacteria 2729
210 Ga0207677_10059995 3300026023 Bacteria 2627
211 Ga0207703_10046212 3300026035 Bacteria 3506
212 Ga0207703_10080930 3300026035 Bacteria 2706
213 Ga0207703_10405162 3300026035 Bacteria 1266
214 Ga0207678_10055479 3300026067 Bacteria 3413
215 Ga0207678_10163673 3300026067 Bacteria 1900
216 Ga0207708_10018464 3300026075 Bacteria 5253
217 Ga0207702_10026046 3300026078 Bacteria 4855
218 Ga0207702_10049286 3300026078 Bacteria 3554
219 Ga0207641_10061894 3300026088 Bacteria 3192
220 Ga0207648_10063764 3300026089 Bacteria 3211
221 Ga0207676_10113283 3300026095 Bacteria 2273
222 Ga0207674_10080434 3300026116 Bacteria 3262
223 Ga0207675_100018937 3300026118 Bacteria 6426
224 Ga0207698_10084958 3300026142 Bacteria 2568
225 Ga0209589_1000006 3300027357 Bacteria 436292
226 Ga0209489_100007 3300027361 Bacteria 436292
227 Ga0209700_100008 3300027363 Bacteria 436292
228 Ga0207428_10031975 3300027907 Bacteria 4334
229 Ga0268266_10063441 3300028379 Bacteria 3189
230 Ga0268266_10066508 3300028379 Bacteria 3118
231 Ga0268265_10058079 3300028380 Bacteria 2952
232 Ga0268264_10180739 3300028381 Bacteria 1915
233 Ga0265332_10031519 3300031238 Bacteria 2312
234 Ga0307508_10030322 3300031616 Bacteria 4888
235 Ga0307516_10004419 3300031730 Bacteria 17372
236 Ga0307516_10079474 3300031730 Bacteria 3124
237 Ga0373934_0039398 3300035086 Bacteria 1863
238 Ga0373923_0089810 3300035111 Bacteria 1342
239 Ga0373936_0027514 3300035113 Bacteria 2230
240 Ga0373954_0018867 3300035118 Bacteria 3108
241 Ga0373955_0011982 3300035172 Bacteria 4155
242 Ga0373924_0008070 3300035410 Bacteria 3813
243 Ga0373927_0030720 3300035695 Bacteria 3504
244 Ga0373933_0032113 3300035724 Bacteria 3050
245 Ga0373947_0035079 3300035725 Bacteria 2969
246 Ga0373937_0158396 3300036401 Bacteria 2122
247 Ga0395900_0035738 3300037418 Bacteria 5119
248 Ga0395900_0281146 3300037418 Bacteria 1656
249 Ga0395898_0006673 3300037466 Bacteria 12309
250 Ga0395898_0017739 3300037466 Bacteria 7264
251 Ga0436364_1000946 3300037853 Bacteria 1243
252 Ga0395901_0074428 3300038443 Bacteria 3543
253 Ga0436365_0254253 3300039437 Bacteria 1388
254 Ga0436365_0944082 3300039437 Bacteria 5399
255 Ga0436365_1685274 3300039437 Bacteria 3141
256 Ga0439446_0008791 3300042156 Bacteria 2691
257 Ga0439434_0010453 3300042435 Bacteria 2735
258 Ga0466963_0020974 3300044694 Bacteria 4116
259 Ga0466971_0052257 3300044719 Bacteria 1840
260 Ga0466970_0007088 3300044765 Bacteria 5608
261 Ga0466957_0011840 3300044842 Bacteria 5043
262 Ga0466957_0135823 3300044842 Bacteria 1580
263 Ga0466959_0086098 3300045049 Bacteria 2261
264 Ga0466958_0011895 3300045836 Bacteria 4914
265 Ga0466958_0176837 3300045836 Bacteria 1353
266 Ga0466967_0026825 3300045976 Bacteria 4780
267 Ga0495629_0214430 3300046459 Bacteria 1329
268 Ga0495651_0056932 3300046462 Bacteria 3002
269 Ga0495653_0197954 3300046463 Bacteria 1366
270 Ga0495580_0034230 3300046472 Bacteria 3658
271 Ga0495582_0023546 3300046473 Bacteria 3369
272 Ga0495639_0019067 3300046475 Bacteria 2993
273 Ga0495662_0066304 3300046476 Bacteria 1746
274 Ga0495610_0016114 3300046512 Plasmid 4319
275 Ga0495616_0081133 3300046513 Bacteria 1552
276 Ga0495631_0000068 3300046518 Bacteria 64881
277 Ga0495643_0060766 3300046522 Bacteria 2005
278 Ga0495652_0116909 3300046529 Bacteria 2134
279 Ga0495665_0016217 3300046531 Bacteria 4014
280 Ga0495665_0049860 3300046531 Bacteria 2220
281 Ga0495640_0013301 3300046533 Bacteria 6256
282 Ga0495622_0062100 3300046557 Bacteria 1730
283 Ga0495656_0018966 3300046615 Bacteria 2649
284 Ga0495625_0001719 3300046660 Bacteria 25443
285 Ga0495625_0004709 3300046660 Bacteria 12776
286 Ga0495647_0021731 3300046681 Bacteria 2313
287 Ga0495670_0000994 3300046691 Bacteria 13780
288 Ga0495589_0055749 3300046794 Bacteria 1947
289 Ga0495604_0113418 3300047317 Bacteria 1973
290 Ga0495674_0228385 3300047319 Bacteria 1537
291 Ga0495672_0120165 3300047320 Bacteria 1398
292 Ga0495676_0195296 3300047321 Bacteria 1409
293 Ga0495680_0168640 3300047322 Bacteria 1586
294 Ga0495687_076514 3300047443 Bacteria 1324
295 Ga0495684_0004856 3300047471 Bacteria 10490
296 Ga0495593_0021527 3300047673 Bacteria 3600
297 Ga0495593_0104381 3300047673 Bacteria 1451
298 Ga0496100_0014089 3300048903 Bacteria 4634
299 Ga0496100_0075522 3300048903 Bacteria 2260
300 Ga0496101_0017549 3300048904 Bacteria 4854
301 Ga0496101_0053356 3300048904 Bacteria 2917
302 Ga0496101_0243996 3300048904 Bacteria 1398
303 Ga0496102_0010591 3300048905 Bacteria 7942
304 Ga0496102_0070159 3300048905 Bacteria 3217
305 Ga0496102_0113768 3300048905 Bacteria 2525
306 Ga0496103_0003532 3300048906 Bacteria 9552
307 Ga0496103_0009028 3300048906 Bacteria 5904
308 Ga0496103_0025666 3300048906 Bacteria 3563
309 Ga0496104_0001496 3300048907 Bacteria 20148
310 Ga0496104_0009501 3300048907 Bacteria 8655
311 Ga0496105_0008375 3300048908 Bacteria 8034
312 Ga0496106_0002833 3300048909 Bacteria 12865
313 Ga0496106_0014798 3300048909 Bacteria 5768
314 Ga0496106_0241839 3300048909 Bacteria 1442
315 Ga0496107_0003151 3300048910 Bacteria 10962
316 Ga0496107_0007961 3300048910 Bacteria 7315
317 Ga0496108_0001611 3300048911 Bacteria 17883
318 Ga0496108_0051188 3300048911 Bacteria 3459
319 Ga0496109_0000704 3300048912 Bacteria 27798
320 Ga0496109_0055581 3300048912 Bacteria 3611
321 Ga0496111_0013603 3300048914 Bacteria 5542
322 Ga0496112_0005181 3300048915 Bacteria 11210
323 Ga0496112_0082885 3300048915 Bacteria 3171
324 Ga0496113_0000675 3300048916 Bacteria 17346
325 Ga0496115_0002859 3300048918 Bacteria 12429
326 Ga0496115_0077047 3300048918 Bacteria 2711
327 Ga0496115_0385624 3300048918 Bacteria 1139
328 Ga0496116_0004200 3300048919 Bacteria 13851
329 Ga0496116_0098433 3300048919 Bacteria 1755
330 Ga0496117_0004154 3300048920 Bacteria 16186
331 Ga0496117_0036871 3300048920 Bacteria 3651
332 Ga0496117_0044962 3300048920 Bacteria 3194
333 Ga0496117_0053187 3300048920 Bacteria 2847
334 Ga0496118_0002863 3300048921 Bacteria 22510
335 Ga0496118_0007010 3300048921 Bacteria 12138
336 Ga0496118_0069301 3300048921 Bacteria 2555
337 Ga0496118_0081279 3300048921 Bacteria 2276
338 Ga0496119_0010275 3300048922 Bacteria 7890
339 Ga0496119_0116342 3300048922 Bacteria 1476
340 Ga0496119_0122029 3300048922 Bacteria 1431
341 Ga0496121_0003295 3300048924 Bacteria 23190
342 Ga0496121_0010917 3300048924 Bacteria 10149
343 Ga0496121_0012634 3300048924 Bacteria 9173
344 Ga0496121_0047909 3300048924 Bacteria 3641
345 Ga0496121_0052069 3300048924 Bacteria 3442
346 Ga0496121_0187333 3300048924 Bacteria 1487
347 Ga0496122_0061949 3300048925 Bacteria 2741
348 Ga0496122_0065408 3300048925 Bacteria 2636
349 Ga0496123_0005436 3300048926 Bacteria 12826
350 Ga0496123_0006650 3300048926 Bacteria 11147
351 Ga0496123_0100221 3300048926 Bacteria 1688
352 Ga0496124_0042585 3300048927 Bacteria 3909
353 Ga0496124_0057558 3300048927 Bacteria 3274
354 Ga0496124_0127789 3300048927 Bacteria 2023
355 Ga0496125_0075582 3300048928 Bacteria 2606
356 Ga0496125_0125491 3300048928 Bacteria 1820
357 Ga0496125_0168553 3300048928 Bacteria 1475
358 Ga0496126_0009480 3300048929 Bacteria 10331
359 Ga0496126_0010298 3300048929 Bacteria 9818
360 Ga0496126_0249191 3300048929 Bacteria 1481
361 Ga0496126_0259809 3300048929 Bacteria 1444
362 Ga0501031_0000035 3300049568 Bacteria 73884
363 Ga0501032_0000022 3300049569 Bacteria 146790
364 Ga0501033_0000037 3300049570 Bacteria 146582
365 Ga0501034_0000634 3300049571 Bacteria 54577
366 Ga0501036_0000013 3300049572 Bacteria 155326
367 Ga0501037_0000016 3300049573 Bacteria 161027
368 Ga0501038_0000015 3300049574 Bacteria 161983
369 Ga0501039_0000013 3300049575 Bacteria 234418
370 Ga0501043_0000299 3300049579 Bacteria 44816
371 Ga0501046_0104776 3300049580 Bacteria 2167
372 Ga0501047_0005024 3300049581 Bacteria 12416
373 Ga0501070_0015723 3300049586 Bacteria 6364
374 Ga0501075_0342255 3300049591 Bacteria 1140
375 Ga0501035_0000046 3300049822 Bacteria 146599
376 Ga0501044_0000038 3300049823 Bacteria 161027
377 Ga0501045_0326963 3300049824 Bacteria 1141
378 nmdc:mga03n38_85937_c1 3300050490 Bacteria 1488
379 nmdc:mga00v17_156351_c1 3300050491 Bacteria 1466
380 nmdc:mga0yw44_125541_c1 3300050492 Bacteria 1657
381 nmdc:mga0yw44_150920_c1 3300050492 Bacteria 1516
382 nmdc:mga0yw44_2599_c1 3300050492 Bacteria 7756
383 nmdc:mga0yw44_66020_c1 3300050492 Bacteria 2232
384 nmdc:mga0yw44_82152_c1 3300050492 Bacteria 2021
385 nmdc:mga0k408_146847_c1 3300050493 Bacteria 1404
386 nmdc:mga0k408_30033_c1 3300050493 Bacteria 3097
387 nmdc:mga06z11_13060_c1 3300050494 Bacteria 3633
388 nmdc:mga06z11_49715_c1 3300050494 Bacteria 2140
389 nmdc:mga07m45_65239_c1 3300050496 Bacteria 2067
390 nmdc:mga05p37_1928_c1 3300050507 Bacteria 24149
391 nmdc:mga08y16_125898_c1 3300050511 Bacteria 2665
392 nmdc:mga0n895_16793_c1 3300050512 Bacteria 6726
393 nmdc:mga0sz30_17271_c1 3300050516 Bacteria 2370
394 Ga0495601_0019513 3300053077 Bacteria 4135
395 Ga0495601_0124072 3300053077 Bacteria 1679
396 Ga0495601_0132429 3300053077 Bacteria 1624
397 Ga0495612_0017447 3300053078 Bacteria 2875
398 Ga0500610_0016027 3300053079 Bacteria 3563
399 Ga0495595_0006786 3300053084 Bacteria 4672
400 Ga0495619_0086616 3300053085 Bacteria 2117
401 Ga0500651_0151790 3300053093 Bacteria 1391
402 Ga0500566_0001073 3300053094 Bacteria 15835
403 Ga0500650_0060878 3300053098 Bacteria 1762
404 Ga0500556_0000002 3300053104 Bacteria 773626
405 Ga0500569_017580 3300053109 Bacteria 1831
406 Ga0500572_000102 3300053111 Bacteria 27944
407 Ga0500594_0009542 3300053118 Bacteria 2237
408 Ga0500594_0013147 3300053118 Bacteria 1963
409 Ga0500642_0000026 3300053130 Bacteria 127731
410 Ga0500652_000060 3300053131 Bacteria 48953
411 Ga0500568_0000922 3300053139 Bacteria 20296
412 Ga0500573_0076066 3300053140 Bacteria 1911
413 Ga0500573_0141552 3300053140 Bacteria 1324
414 Ga0500577_0043485 3300053142 Bacteria 1651
415 Ga0500622_0000994 3300053156 Bacteria 23922
416 Ga0500634_0132381 3300053161 Bacteria 1195
417 Ga0500639_005225 3300053163 Bacteria 6634
418 Ga0500636_0004153 3300053177 Bacteria 8194
419 Ga0500636_0016322 3300053177 Bacteria 4379
420 Ga0500636_0047349 3300053177 Bacteria 2533
421 Ga0500636_0105515 3300053177 Bacteria 1597
422 Ga0500596_000960 3300053735 Bacteria 5741
423 2509153218 2508501128 Bacteria 8613869
424 2511120884 2510917020 Bacteria 5657507
425 2511397976 2511231028 Bacteria 8046582
426 2513628751 2513237092 Bacteria 8341956
427 2513642741 2513237094 Bacteria 8789602
428 2513653142 2513237095 Bacteria 8976980
429 2513675655 2513237098 Bacteria 9902361
430 2513706790 2513237102 Bacteria 7703324
431 2513720868 2513237104 Bacteria 10034502
432 2513875949 2513237139 Bacteria 8737671
433 2514011391 2513237161 Bacteria 8871253
434 2517103432 2517093001 Bacteria 9002274
435 2524465086 2524023210 Bacteria 9029266
436 2524533762 2524023228 Bacteria 10118060
437 2528852571 2528768022 Bacteria 10457665
438 2585279390 2582581308 Bacteria 7413247
439 2585331120 2582581316 Bacteria 7774528
440 2585531126 2585427527 Bacteria 7273426
441 2585552952 2585427530 Bacteria 7383882
442 2603861350 2602042107 Bacteria 6226103
443 2616306963 2615840626 Bacteria 7921970
444 2616554573 2615840698 Bacteria 7319877
445 2617349388 2617270735 Bacteria 9163226
446 2617378097 2617270741 Bacteria 8201522
447 2617384924 2617270742 Bacteria 6808054
448 2671111822 2667528174 Bacteria 6435400
449 2671123700 2667528175 Bacteria 7532676
450 2671694021 2671180139 Bacteria 4196045
451 2778173326 2775507266 Bacteria 7392367
452 2793060162 2791355196 Bacteria 7323613
453 2793066387 2791355197 Bacteria 8420563
454 2805917519 2802429603 Bacteria 8777136
455 2818242369 2816332527 Bacteria 8933356
456 2819609967 2818991448 Bacteria 6772224
457 2819640078 2818991453 Bacteria 7181617
458 2824602035 2824600985 Bacteria 8488197
459 2824610023 2824609381 Bacteria 8672835
460 2824620180 2824617872 Bacteria 8814715
461 2824627609 2824626560 Bacteria 8813858
462 2824639419 2824635225 Bacteria 8785348
463 2824646527 2824644064 Bacteria 8743947
464 2824654879 2824653114 Bacteria 8493680
465 2824662218 2824661429 Bacteria 9877870
466 2824677123 2824671348 Bacteria 8369588
467 2824682461 2824679649 Bacteria 8248951
468 2824693887 2824687955 Bacteria 8360029
469 2824697018 2824696289 Bacteria 8335049
470 2824722459 2824714736 Bacteria 8717648
471 2824726985 2824723954 Bacteria 8758240
472 2824733632 2824732956 Bacteria 7810675
473 2824747360 2824746037 Bacteria 7911610
474 2824774124 2824773399 Bacteria 8360218
475 2838033278 2838029111 Bacteria 6603031
476 2838127706 2838122688 Bacteria 8803140
477 2841914617 2841911363 Bacteria 6173697
478 2841920218 2841917233 Bacteria 6173500
479 2841941346 2841941048 Bacteria 8688029
480 2841952646 2841949485 Bacteria 8680857
481 2841959677 2841957949 Bacteria 8652217
482 2841967481 2841966195 Bacteria 8673214
483 2841979122 2841974524 Bacteria 8931498
484 2841986665 2841983080 Bacteria 8395090
485 2842480057 2842475841 Bacteria 6603183
486 2842483752 2842482326 Bacteria 7212537
487 2842505158 2842502639 Bacteria 6604161
488 2847945303 2847939898 Bacteria 8606328
489 2849080514 2849076700 Bacteria 7039503
490 2852644694 2852643534 Bacteria 3013378
491 2857510139 2857509624 Bacteria 7472071
492 2857530121 2857524615 Bacteria 6615449
493 2857734193 2857733635 Bacteria 3532004
494 2873314615 2873314349 Bacteria 8512634
495 2874618391 2874612657 Bacteria 8252029
496 2874632626 2874628541 Bacteria 8630250
497 2876766518 2876761206 Bacteria 10111113
498 2879109222 2879099564 Bacteria 10442239
499 2881670392 2881665667 Bacteria 8175609
500 2885372738 2885366525 Bacteria 8326213
501 2885385004 2885383462 Bacteria 9473874
502 2885409749 2885409591 Bacteria 9235467
503 2888382709 2888378607 Bacteria 9652610
504 2888423216 2888419890 Bacteria 7857137
505 2903729756 2903727486 Bacteria 8281579
506 2903770183 2903768456 Bacteria 9749579
507 2904699055 2904690495 Bacteria 9412302
508 2904700895
509 2908741372 2908739725 Bacteria 8628932
510 2908763419 2908756301 Bacteria 8864324
511 2908778864 2908775508 Bacteria 8092255
512 2919076876 2919073203 Bacteria 6531949
513 2919410322 2919408235 Bacteria 6149349
514 2922375289
515 2922395143 2922393267 Bacteria 8285685
516 2922431776
517 2929615966 2929615660 Bacteria 9193770
518 2929630579 2929624759 Bacteria 9339455
519 2932433949 2932431166 Bacteria 4215299
520 2932800982 2932794094 Bacteria 7915132
521 2932804636 2932801729 Bacteria 7987968
522 2932819623 2932818245 Bacteria 9955613
523 2933578748 2933577622 Bacteria 9116884
524 2935611285 2935608549 Bacteria 8203142
525 2935618804 2935616580 Bacteria 9032984
526 2935636859 2935630451 Bacteria 8169952
527 2935647435 2935638405 Bacteria 10015038
528 2935672894 2935665750 Bacteria 9571747
529 2935676814 2935675223 Bacteria 9928132
530 2935687775 2935684952 Bacteria 9590419
531 2935695590 2935694250 Bacteria 9291695
532 2935708142 2935703347 Bacteria 10242284
533 2935714794 2935713505 Bacteria 9608509
534 2935726641 2935722832 Bacteria 9608746
535 2935739410 2935732158 Bacteria 9706831
536 2935748448 2935741537 Bacteria 9707219
537 2935754969 2935750917 Bacteria 9590372
538 2935761049 2935760218 Bacteria 9817913
539 2935809821 2935801545 Bacteria 9301974
540 2935820762 2935819856 Bacteria 8261050
541 2935836803 2935827899 Bacteria 10038562
542 2935839420 2935837841 Bacteria 9454360
543 2935850978 2935847175 Bacteria 8228321
544 2935857169 2935855204 Bacteria 9035059
545 2935864710 2935864058 Bacteria 9784707
546 2935876488 2935873716 Bacteria 9632195
547 2935885133 2935883170 Bacteria 7964738
548 2935963521 2935959822 Bacteria 7869783
549 2936009378 2936002035 Bacteria 9362176
550 2940559654 2940556831 Bacteria 9590747
551 2941513496 2941507105 Bacteria 8166816
552 2941521459 2941515067 Bacteria 8166720
553 2941529221 2941523033 Bacteria 8169134
554 2941536184 2941531003 Bacteria 7653939
555 2941540109 2941538514 Bacteria 9402094
556 3005418857 3005416602 Bacteria 7064308
557 3005481594 3005474847 Bacteria 9259049
558 3005488094 3005483717 Bacteria 7877331
559 3005512783 3005506211 Bacteria 6943378
560 3005590548 3005587118 Bacteria 7794411
561 3005713685 3005710791 Bacteria 7622528
562 3005721071 3005718088 Bacteria 8283608
563 8005318251 8005314921 Bacteria 7072929
564 8005488868 8005484373 Bacteria 6297373
565 8005645757 8005645114 Bacteria 6950293
566 8005682562 8005682033 Bacteria 6726518
567 8006927047 8006926726 Bacteria 6749210
568 8006939145 8006933436 Bacteria 10410654
569 8006978803 8006973647 Bacteria 10679141
570 8019581148 8019576017 Bacteria 10049540
571 8019588800 8019586578 Bacteria 10212056
572 8019602457 8019597564 Bacteria 10041141
573 8019616102 8019608314 Bacteria 10042931
574 8019656692 8019648815 Bacteria 10014479
575 8055747613 8055742211 Bacteria 9226248
576 8056684182 8056681323 Bacteria 8472857
577 8056690520 8056689827 Bacteria 6712655
578 8056972256 8056967851 Bacteria 9038162
579 Ga0500608_113852
580 JGI24740J21852_10000932
581 JGI24743J22301_10001993
582 JGI24750J21931_1001566
583 JGI25155J39150_1000122
584 JGI25156J39149_1000242
585 JGI25162J39368_1000545
586 JGI25154J39366_1000225
587 JGI25157J39369_1000273
588 JGI25165J46597_1000411
589 JGI25165J46597_1001848
590 Ga0070683_100288615
591 Ga0070690_100020662
592 Ga0070670_100001813
593 Ga0070670_100005712
594 Ga0070670_100011583
595 Ga0070670_100255501
596 Ga0070682_100159682
597 Ga0068868_100182411
598 Ga0070660_100228760
599 Ga0070661_100005543
600 Ga0070669_100042529
601 Ga0070675_100016589
602 Ga0070675_100021266
603 Ga0070674_100027738
604 Ga0070673_100171039
605 Ga0070688_100145063
606 Ga0070667_100017341
607 Ga0070714_100068061
608 Ga0070713_100002646
609 Ga0070713_100098561
610 Ga0070713_100104803
611 Ga0070701_10088393
612 Ga0070711_100018265
613 Ga0070711_100025377
614 Ga0070700_100014170
615 Ga0070663_100173683
616 Ga0070663_100336294
617 Ga0070662_100004623
618 Ga0070681_10150259
619 Ga0070685_10008944
620 Ga0070698_100221849
621 Ga0070699_100011090
622 Ga0070684_100001331
623 Ga0070686_100013106
624 Ga0070686_100061650
625 Ga0070665_100028657
626 Ga0070704_100042810
627 Ga0070664_100198988
628 Ga0070664_100286149
629 Ga0068857_100123280
630 Ga0068854_100054108
631 Ga0068856_100020697
632 Ga0068856_100070101
633 Ga0070702_100004877
634 Ga0068852_100118590
635 Ga0068859_100040117
636 Ga0068859_100352810
637 Ga0068864_100043667
638 Ga0068866_10019587
639 Ga0068861_100043844
640 Ga0068870_10014484
641 Ga0068863_100072479
642 Ga0068863_100151843
643 Ga0068863_100379370
644 Ga0068858_100020520
645 Ga0068858_100097403
646 Ga0068858_100215592
647 Ga0068862_100027901
648 Ga0081455_10186854
649 Ga0081540_1047913
650 Ga0075365_10028679
651 Ga0075368_10040193
652 Ga0075368_10045595
653 Ga0075363_100108671
654 Ga0075363_100110971
655 Ga0075364_10025553
656 Ga0075364_10100986
657 Ga0070712_100013835
658 Ga0075367_10022741
659 Ga0075367_10025168
660 Ga0075367_10186326
661 Ga0075369_10004982
662 Ga0075366_10005206
663 Ga0075366_10013465
664 Ga0097621_100210341
665 Ga0075370_10049274
666 Ga0075370_10087433
667 Ga0075428_100048269
668 Ga0075428_100112212
669 Ga0068865_100230059
670 Ga0097620_100040116
671 Ga0097620_100352776
672 Ga0099824_1010107
673 Ga0099822_1001351
674 Ga0105240_10000014
675 Ga0105240_10419039
676 Ga0105245_10001585
677 Ga0105247_10019591
678 Ga0114129_10006854
679 Ga0105242_10068951
680 Ga0105242_10258480
681 Ga0105248_10023815
682 Ga0105248_10055885
683 Ga0105248_10056381
684 Ga0105248_10305689
685 Ga0105237_10006102
686 Ga0105237_10240014
687 Ga0105238_10129002
688 Ga0105249_10044906
689 Ga0105249_10127186
690 Ga0105239_10005173
691 Ga0105239_10175077
692 Ga0105239_10250159
693 Ga0105246_10028796
694 Ga0105246_10054761
695 Ga0105246_10166814
696 Ga0157373_10003649
697 Ga0157370_10000015
698 Ga0157370_10478013
699 Ga0157369_10127162
700 Ga0157374_10044638
701 Ga0157378_10017661
702 Ga0157378_10423149
703 Ga0157375_10041728
704 Ga0163163_10032288
705 Ga0163163_10038522
706 Ga0163163_10368757
707 Ga0157380_10399677
708 Ga0157379_10053696
709 Ga0182007_10002551
710 Ga0182005_1002250
711 Ga0163161_10210738
712 Ga0228598_1001818
713 Ga0209435_100005
714 Ga0209437_100058
715 Ga0209437_100060
716 Ga0209646_1000011
717 Ga0209646_1003398
718 Ga0209026_1000008
719 Ga0209677_100281
720 Ga0209677_100897
721 Ga0209759_1000004
722 Ga0209233_1000137
723 Ga0209233_1000149
724 Ga0209233_1000160
725 Ga0209233_1000921
726 Ga0209233_1006615
727 Ga0209025_1028152
728 Ga0209564_1003706
729 Ga0209564_1034651
730 Ga0209758_1000903
731 Ga0209257_1017217
732 Ga0207710_10013137
733 Ga0207710_10089764
734 Ga0207688_10001843
735 Ga0207645_10010034
736 Ga0207643_10020992
737 Ga0207707_10000615
738 Ga0207707_10000914
739 Ga0207707_10058416
740 Ga0207707_10113341
741 Ga0207695_10000037
742 Ga0207695_10085465
743 Ga0207671_10089475
744 Ga0207693_10063204
745 Ga0207663_10017960
746 Ga0207663_10109954
747 Ga0207660_10000729
748 Ga0207660_10021828
749 Ga0207662_10013946
750 Ga0207649_10165906
751 Ga0207652_10003555
752 Ga0207694_10293614
753 Ga0207650_10000666
754 Ga0207650_10007474
755 Ga0207650_10044083
756 Ga0207650_10113179
757 Ga0207659_10303962
758 Ga0207687_10011012
759 Ga0207687_10031401
760 Ga0207700_10001630
761 Ga0207700_10025188
762 Ga0207700_10272140
763 Ga0207644_10003067
764 Ga0207690_10209417
765 Ga0207706_10010880
766 Ga0207706_10023923
767 Ga0207706_10115488
768 Ga0207686_10091486
769 Ga0207709_10028709
770 Ga0207670_10276802
771 Ga0207669_10107544
772 Ga0207704_10018073
773 Ga0207691_10013141
774 Ga0207691_10310534
775 Ga0207711_10113049
776 Ga0207711_10389189
777 Ga0207689_10089558
778 Ga0207679_10232251
779 Ga0207679_10264484
780 Ga0207679_10292331
781 Ga0207667_10061384
782 Ga0207651_10039396
783 Ga0207640_10000905
784 Ga0207640_10073439
785 Ga0207640_10134092
786 Ga0207677_10018924
787 Ga0207677_10054518
788 Ga0207677_10059995
789 Ga0207703_10046212
790 Ga0207703_10080930
791 Ga0207703_10405162
792 Ga0207678_10055479
793 Ga0207678_10163673
794 Ga0207708_10018464
795 Ga0207702_10026046
796 Ga0207702_10049286
797 Ga0207641_10061894
798 Ga0207648_10063764
799 Ga0207676_10113283
800 Ga0207674_10080434
801 Ga0207675_100018937
802 Ga0207698_10084958
803 Ga0209589_1000006
804 Ga0209489_100007
805 Ga0209700_100008
806 Ga0207428_10031975
807 Ga0268266_10063441
808 Ga0268266_10066508
809 Ga0268265_10058079
810 Ga0268264_10180739
811 Ga0265332_10031519
812 Ga0307508_10030322
813 Ga0307516_10004419
814 Ga0307516_10079474
815 Ga0373934_0039398
816 Ga0373923_0089810
817 Ga0373936_0027514
818 Ga0373954_0018867
819 Ga0373955_0011982
820 Ga0373924_0008070
821 Ga0373927_0030720
822 Ga0373933_0032113
823 Ga0373947_0035079
824 Ga0373937_0158396
825 Ga0395900_0035738
826 Ga0395900_0281146
827 Ga0395898_0006673
828 Ga0395898_0017739
829 Ga0436364_1000946
830 Ga0395901_0074428
831 Ga0436365_0254253
832 Ga0436365_0944082
833 Ga0436365_1685274
834 Ga0439446_0008791
835 Ga0439434_0010453
836 Ga0466963_0020974
837 Ga0466971_0052257
838 Ga0466970_0007088
839 Ga0466957_0011840
840 Ga0466957_0135823
841 Ga0466959_0086098
842 Ga0466958_0011895
843 Ga0466958_0176837
844 Ga0466967_0026825
845 Ga0495629_0214430
846 Ga0495651_0056932
847 Ga0495653_0197954
848 Ga0495580_0034230
849 Ga0495582_0023546
850 Ga0495639_0019067
851 Ga0495662_0066304
852 Ga0495610_0016114
853 Ga0495616_0081133
854 Ga0495631_0000068
855 Ga0495643_0060766
856 Ga0495652_0116909
857 Ga0495665_0016217
858 Ga0495665_0049860
859 Ga0495640_0013301
860 Ga0495622_0062100
861 Ga0495656_0018966
862 Ga0495625_0001719
863 Ga0495625_0004709
864 Ga0495647_0021731
865 Ga0495670_0000994
866 Ga0495589_0055749
867 Ga0495604_0113418
868 Ga0495674_0228385
869 Ga0495672_0120165
870 Ga0495676_0195296
871 Ga0495680_0168640
872 Ga0495687_076514
873 Ga0495684_0004856
874 Ga0495593_0021527
875 Ga0495593_0104381
876 Ga0496100_0014089
877 Ga0496100_0075522
878 Ga0496101_0017549
879 Ga0496101_0053356
880 Ga0496101_0243996
881 Ga0496102_0010591
882 Ga0496102_0070159
883 Ga0496102_0113768
884 Ga0496103_0003532
885 Ga0496103_0009028
886 Ga0496103_0025666
887 Ga0496104_0001496
888 Ga0496104_0009501
889 Ga0496105_0008375
890 Ga0496106_0002833
891 Ga0496106_0014798
892 Ga0496106_0241839
893 Ga0496107_0003151
894 Ga0496107_0007961
895 Ga0496108_0001611
896 Ga0496108_0051188
897 Ga0496109_0000704
898 Ga0496109_0055581
899 Ga0496111_0013603
900 Ga0496112_0005181
901 Ga0496112_0082885
902 Ga0496113_0000675
903 Ga0496115_0002859
904 Ga0496115_0077047
905 Ga0496115_0385624
906 Ga0496116_0004200
907 Ga0496116_0098433
908 Ga0496117_0004154
909 Ga0496117_0036871
910 Ga0496117_0044962
911 Ga0496117_0053187
912 Ga0496118_0002863
913 Ga0496118_0007010
914 Ga0496118_0069301
915 Ga0496118_0081279
916 Ga0496119_0010275
917 Ga0496119_0116342
918 Ga0496119_0122029
919 Ga0496121_0003295
920 Ga0496121_0010917
921 Ga0496121_0012634
922 Ga0496121_0047909
923 Ga0496121_0052069
924 Ga0496121_0187333
925 Ga0496122_0061949
926 Ga0496122_0065408
927 Ga0496123_0005436
928 Ga0496123_0006650
929 Ga0496123_0100221
930 Ga0496124_0042585
931 Ga0496124_0057558
932 Ga0496124_0127789
933 Ga0496125_0075582
934 Ga0496125_0125491
935 Ga0496125_0168553
936 Ga0496126_0009480
937 Ga0496126_0010298
938 Ga0496126_0249191
939 Ga0496126_0259809
940 Ga0501031_0000035
941 Ga0501032_0000022
942 Ga0501033_0000037
943 Ga0501034_0000634
944 Ga0501036_0000013
945 Ga0501037_0000016
946 Ga0501038_0000015
947 Ga0501039_0000013
948 Ga0501043_0000299
949 Ga0501046_0104776
950 Ga0501047_0005024
951 Ga0501070_0015723
952 Ga0501075_0342255
953 Ga0501035_0000046
954 Ga0501044_0000038
955 Ga0501045_0326963
956 nmdc:mga03n38_85937_c1
957 nmdc:mga00v17_156351_c1
958 nmdc:mga0yw44_125541_c1
959 nmdc:mga0yw44_150920_c1
960 nmdc:mga0yw44_2599_c1
961 nmdc:mga0yw44_66020_c1
962 nmdc:mga0yw44_82152_c1
963 nmdc:mga0k408_146847_c1
964 nmdc:mga0k408_30033_c1
965 nmdc:mga06z11_13060_c1
966 nmdc:mga06z11_49715_c1
967 nmdc:mga07m45_65239_c1
968 nmdc:mga05p37_1928_c1
969 nmdc:mga08y16_125898_c1
970 nmdc:mga0n895_16793_c1
971 nmdc:mga0sz30_17271_c1
972 Ga0495601_0019513
973 Ga0495601_0124072
974 Ga0495601_0132429
975 Ga0495612_0017447
976 Ga0500610_0016027
977 Ga0495595_0006786
978 Ga0495619_0086616
979 Ga0500651_0151790
980 Ga0500566_0001073
981 Ga0500650_0060878
982 Ga0500556_0000002
983 Ga0500569_017580
984 Ga0500572_000102
985 Ga0500594_0009542
986 Ga0500594_0013147
987 Ga0500642_0000026
988 Ga0500652_000060
989 Ga0500568_0000922
990 Ga0500573_0076066
991 Ga0500573_0141552
992 Ga0500577_0043485
993 Ga0500622_0000994
994 Ga0500634_0132381
995 Ga0500639_005225
996 Ga0500636_0004153
997 Ga0500636_0016322
998 Ga0500636_0047349
999 Ga0500636_0105515
1000 Ga0500596_000960
1001 2509153218
1002 2511120884
1003 2511397976
1004 2513628751
1005 2513642741
1006 2513653142
1007 2513675655
1008 2513706790
1009 2513720868
1010 2513875949
1011 2514011391
1012 2517103432
1013 2524465086
1014 2524533762
1015 2528852571
1016 2585279390
1017 2585331120
1018 2585531126
1019 2585552952
1020 2603861350
1021 2616306963
1022 2616554573
1023 2617349388
1024 2617378097
1025 2617384924
1026 2671111822
1027 2671123700
1028 2671694021
1029 2778173326
1030 2793060162
1031 2793066387
1032 2805917519
1033 2818242369
1034 2819609967
1035 2819640078
1036 2824602035
1037 2824610023
1038 2824620180
1039 2824627609
1040 2824639419
1041 2824646527
1042 2824654879
1043 2824662218
1044 2824677123
1045 2824682461
1046 2824693887
1047 2824697018
1048 2824722459
1049 2824726985
1050 2824733632
1051 2824747360
1052 2824774124
1053 2838033278
1054 2838127706
1055 2841914617
1056 2841920218
1057 2841941346
1058 2841952646
1059 2841959677
1060 2841967481
1061 2841979122
1062 2841986665
1063 2842480057
1064 2842483752
1065 2842505158
1066 2847945303
1067 2849080514
1068 2852644694
1069 2857510139
1070 2857530121
1071 2857734193
1072 2873314615
1073 2874618391
1074 2874632626
1075 2876766518
1076 2879109222
1077 2881670392
1078 2885372738
1079 2885385004
1080 2885409749
1081 2888382709
1082 2888423216
1083 2903729756
1084 2903770183
1085 2904699055
1086 2904700895
1087 2908741372
1088 2908763419
1089 2908778864
1090 2919076876
1091 2919410322
1092 2922375289
1093 2922395143
1094 2922431776
1095 2929615966
1096 2929630579
1097 2932433949
1098 2932800982
1099 2932804636
1100 2932819623
1101 2933578748
1102 2935611285
1103 2935618804
1104 2935636859
1105 2935647435
1106 2935672894
1107 2935676814
1108 2935687775
1109 2935695590
1110 2935708142
1111 2935714794
1112 2935726641
1113 2935739410
1114 2935748448
1115 2935754969
1116 2935761049
1117 2935809821
1118 2935820762
1119 2935836803
1120 2935839420
1121 2935850978
1122 2935857169
1123 2935864710
1124 2935876488
1125 2935885133
1126 2935963521
1127 2936009378
1128 2940559654
1129 2941513496
1130 2941521459
1131 2941529221
1132 2941536184
1133 2941540109
1134 3005418857
1135 3005481594
1136 3005488094
1137 3005512783
1138 3005590548
1139 3005713685
1140 3005721071
1141 8005318251
1142 8005488868
1143 8005645757
1144 8005682562
1145 8006927047
1146 8006939145
1147 8006978803
1148 8019581148
1149 8019588800
1150 8019602457
1151 8019616102
1152 8019656692
1153 8055747613
1154 8056684182
1155 8056690520
1156 8056972256

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00296

Bac_luciferase

Luciferase-like monooxygenase

10

300

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
2i7g-assembly1.cif.gz_A crystal structure of monooxygenase from agrobacterium tumefaciens 0.9541 7 343
2i7g-assembly1.cif.gz_A crystal structure of monooxygenase from agrobacterium tumefaciens 0.9325 7 343
7bip-assembly1.cif.gz_B crystal structure of monooxygenase rslo1 from streptomyces bottropensis 0.8719 7 337
1luc-assembly1.cif.gz_A bacterial luciferase 0.8646 7 337
7bip-assembly1.cif.gz_B crystal structure of monooxygenase rslo1 from streptomyces bottropensis 0.8596 7 337
ID Description Score Start End Superfamily
af_Q2G136_3_353_3.20.20.30 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Luciferase-like domain 0.943 3 345 3.20.20.30
2i7gA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Luciferase-like domain 0.9413 7 343 3.20.20.30
af_Q2G136_3_353_3.20.20.30 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Luciferase-like domain 0.935 3 345 3.20.20.30
2i7gA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Luciferase-like domain 0.9331 7 343 3.20.20.30
af_I6X7W8_4_352_3.20.20.30 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Luciferase-like domain 0.8474 6 337 3.20.20.30
ID Description Score Start End GO Terms
AF-A0A0H2KSM3-F1-model_v4 Luciferase 0.9896 1 344 GO:0004497
GO:0005829
GO:0016705
AF-A0A4P6N0C1-F1-model_v4 LLM class flavin-dependent oxidoreductase 0.9882 5 344 GO:0004497
GO:0005829
GO:0016705
AF-A0A4Q3IUY5-F1-model_v4 deleted 0.9879 6 299
AF-A0A558H8F2-F1-model_v4 LLM class flavin-dependent oxidoreductase 0.9855 3 344 GO:0004497
GO:0005829
GO:0016705
AF-A0A6G0F4X8-F1-model_v4 LLM class flavin-dependent oxidoreductase 0.9851 3 345 GO:0004497
GO:0005829
GO:0016705

Map