F465614

General Info

Members Datasets Scaffolds Average Seq Length
577 288 540 355

Family's Representative Sequence

Representative Sequence 3300013306|Ga0163162_10048954|Ga0163162_100489542
Length 389
Sequence MLRRPATAAAAHGCAHMPSLTFVMPHWLYWAGLLLFPLIATYLVRRQLKHAPDARPSLFIAYLFWLCSGFLGIHRFYLRSGLGFAFIPVFLFVIYCNAQVREVRDDTSRTFAALEQAQHAADIAKPSETNPTPEATAQYERAQADVKKMQAEFDVAKAVTDSWNARARWGAIVLAIMLLADAVLMPTLVRRQRKHESATPHRPIAEPPPVVAEPVLAEDPTLHFHSRFTDFIEMINVKAGEYVAWWSLIAVFVYYYEVLARFVFNSPTNWVHESMFLMFGMQYMLSGAYAYREDQHVRVDVIYAKFSPRGKAIADIITSVFFFIFIGTMLVTGYRFAADAVNVGEHSFTEWGIQYWPVKLAIPIGAALLLLQGVAKLIKDILFVSRRGA

Samples

Sample ID Description Type Environment
1 2513237094 Bradyrhizobium sp. WSM3983 Isolate Nodule
2 2599185301 Mesorhizobium sp. NFR06 Isolate Rhizoplane
3 2643221651 Afipia sp. Root123D2 Isolate Unclassified
4 2791355082 Ensifer alkalisoli YIC4027 Isolate Nodule
5 2802429268 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
6 2847670302 Mesorhizobium sp. M3A.F.Ca.ET.080.04.2.1 Isolate Nodule
7 2847686936 Mesorhizobium sp. M1A.F.Ca.IN.022.06.1.1 Isolate Nodule
8 2856314179 Mesorhizobium sp. M3A.F.Ca.ET.175.01.1.1 Isolate Nodule
9 2871444079 Mesorhizobium sp. M1A.F.Ca.IN.020.06.1.1 Isolate Nodule
10 2874102143 Mesorhizobium sp. M1A.F.Ca.IN.022.04.1.1 Isolate Nodule
11 2874123672 Mesorhizobium sp. M00.F.Ca.ET.216.01.1.1 Isolate Nodule
12 2876369609 Mesorhizobium sp. USDA-HM6 Isolate Unclassified
13 2878035449 Mesorhizobium sp. M3A.F.Ca.ET.201.01.1.1 Isolate Nodule
14 2881147464 Mesorhizobium sp. M1B.F.Ca.ET.045.04.1.1 Isolate Nodule
15 2885326080 Mesorhizobium sp. M1E.F.Ca.ET.041.01.1.1 Isolate Nodule
16 2888350351 Mesorhizobium sp. M2A.F.Ca.ET.046.03.2.1 Isolate Nodule
17 2906328253 Mesorhizobium sp. M1A.T.Ca.IN.004.03.1.1 Isolate Nodule
18 2906414383 Mesorhizobium sp. M3A.F.Ca.ET.174.01.1.1 Isolate Nodule
19 2906626472 Bradyrhizobium hipponense aSej3 Isolate Unclassified
20 2913295892 Sinorhizobium kostiensis DSM 13372 Isolate Nodule
21 2922130491 Mesorhizobium sp. M00.F.Ca.ET.038.03.1.1 Isolate Nodule
22 2922158528 Mesorhizobium sp. M1A.F.Ca.IN.022.05.2.1 Isolate Nodule
23 2924726620 Mesorhizobium sp. M1A.F.Ca.IN.020.03.2.1 Isolate Nodule
24 2937891427 Mesorhizobium sp. M1A.F.Ca.IN.022.07.1.1 Isolate Nodule
25 2958115193 Mesorhizobium sp. M00.F.Ca.ET.217.01.1.1 Isolate Nodule
26 2965062239 Mesorhizobium sp. M1A.F.Ca.ET.072.01.1.1 Isolate Nodule
27 2965119406 Mesorhizobium sp. M2A.F.Ca.ET.067.02.1.1 Isolate Nodule
28 2968091066 Mesorhizobium sp. AA23 Isolate Unclassified
29 2968097103 Mesorhizobium sp. M1A.F.Ca.IN.020.30.1.1 Isolate Nodule
30 2968128360 Mesorhizobium sp. WSM3873 Isolate Unclassified
31 2977858184 Mesorhizobium sp. M1A.F.Ca.IN.020.03.1.1 Isolate Nodule
32 2979742915 Mesorhizobium sp. M2A.F.Ca.ET.046.02.1.1 Isolate Nodule
33 2979779861 Mesorhizobium sp. M1A.F.Ca.IN.022.02.1.1 Isolate Nodule
34 2996341866 Mesorhizobium sp. M1A.F.Ca.IN.020.32.1.1 Isolate Nodule
35 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
36 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
37 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
38 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
39 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
40 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
41 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
42 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
43 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
44 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
45 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
46 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
47 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
48 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
49 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
50 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
51 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
52 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
53 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
54 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
55 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
56 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
57 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
58 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
59 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
60 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
61 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
62 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
63 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
64 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
65 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
66 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
67 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
68 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
69 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
70 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
71 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
72 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
73 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
74 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
75 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
76 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
77 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
78 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
79 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
80 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
81 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
82 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
83 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
84 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
85 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
86 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
87 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
88 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
89 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
90 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
91 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
92 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
93 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
94 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
95 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
96 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
97 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
98 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
99 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
100 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
101 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
102 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
103 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
104 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
105 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
106 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
107 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
108 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
109 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
110 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
111 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
112 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
113 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
114 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
115 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
116 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
117 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
118 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
119 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
120 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
121 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
122 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
123 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
124 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
125 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
126 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
127 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
180 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
182 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
183 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
184 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
185 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
186 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
187 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
188 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
189 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
190 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
191 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
192 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
193 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
194 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
195 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
196 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
197 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
198 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
199 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
200 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
201 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
202 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
203 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
204 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
205 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
206 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
207 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
208 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
209 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
210 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
211 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
212 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
213 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
214 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
215 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
216 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
217 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
218 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
219 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
220 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
221 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
222 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
223 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
224 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
225 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
226 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
227 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
228 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
229 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
230 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
231 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
232 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
233 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
234 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
235 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
236 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
237 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
238 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
239 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
240 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
241 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
242 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
243 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
244 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
245 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
246 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
247 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
248 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
249 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
250 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
251 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
252 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
253 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
254 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
255 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
256 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
257 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
258 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
259 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
260 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
261 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
262 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
263 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
264 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
265 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
266 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
267 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
268 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
269 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
270 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
271 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
272 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
273 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
274 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
275 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
276 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
277 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
278 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
279 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
280 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
281 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
282 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
283 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
284 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
285 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
286 8004445564 Mesorhizobium sp. M1A.F.Ca.IN.020.04.1.1 Isolate Nodule
287 8004703790 Mesorhizobium sp. M00.F.Ca.ET.158.01.1.1 Isolate Nodule
288 8049293176 Ensifer alkalisoli YIC4027 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 93.59
Metatranscriptomes 0
Isolates 6.41

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 5.2
Rhizoplane 3.12
Rhizosphere 90.64
Stem 0
Stem Tuber 0
Unclassified 1.04

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0065712_10074754 3300005290 Bacteria 4018
2 Ga0065715_10097391 3300005293 Bacteria 3713
3 Ga0070658_10009579 3300005327 Bacteria 7776
4 Ga0070658_10068697 3300005327 Bacteria 2897
5 Ga0070658_10080380 3300005327 Bacteria 2678
6 Ga0070676_10060667 3300005328 Bacteria 2247
7 Ga0070683_100005874 3300005329 Bacteria 10272
8 Ga0070683_100022132 3300005329 Bacteria 5678
9 Ga0070683_100036908 3300005329 Bacteria 4471
10 Ga0070690_100010980 3300005330 Bacteria 5288
11 Ga0070690_100128128 3300005330 Bacteria 1711
12 Ga0070670_100040336 3300005331 Bacteria 4015
13 Ga0070670_100083451 3300005331 Bacteria 2745
14 Ga0070677_10024137 3300005333 Bacteria 2258
15 Ga0068869_100001503 3300005334 Bacteria 13819
16 Ga0068869_100106122 3300005334 Bacteria 2131
17 Ga0068869_100269756 3300005334 Bacteria 1365
18 Ga0070666_10006712 3300005335 Bacteria 7084
19 Ga0070680_100010191 3300005336 Bacteria 7247
20 Ga0070680_100034827 3300005336 Bacteria 4061
21 Ga0070680_100094594 3300005336 Bacteria 2477
22 Ga0070682_100141373 3300005337 Bacteria 1641
23 Ga0068868_100033960 3300005338 Bacteria 3935
24 Ga0068868_100208250 3300005338 Bacteria 1633
25 Ga0070660_100001424 3300005339 Bacteria 16292
26 Ga0070660_100006417 3300005339 Bacteria 8150
27 Ga0070660_100017014 3300005339 Bacteria 5292
28 Ga0070660_100033991 3300005339 Bacteria 3848
29 Ga0070689_100011227 3300005340 Bacteria 6410
30 Ga0070689_100070388 3300005340 Bacteria 2731
31 Ga0070661_100001831 3300005344 Bacteria 14718
32 Ga0070661_100003536 3300005344 Bacteria 10765
33 Ga0070661_100007865 3300005344 Bacteria 7360
34 Ga0070661_100009438 3300005344 Bacteria 6752
35 Ga0070661_100012354 3300005344 Bacteria 5975
36 Ga0070661_100036305 3300005344 Bacteria 3582
37 Ga0070661_100054690 3300005344 Bacteria 2923
38 Ga0070692_10026720 3300005345 Bacteria 2856
39 Ga0070669_100054090 3300005353 Bacteria 2940
40 Ga0070669_100094003 3300005353 Bacteria 2252
41 Ga0070675_100059524 3300005354 Bacteria 3151
42 Ga0070675_100061771 3300005354 Bacteria 3095
43 Ga0070671_100016774 3300005355 Bacteria 5923
44 Ga0070671_100337845 3300005355 Bacteria 1284
45 Ga0070673_100017633 3300005364 Bacteria 5083
46 Ga0070673_100040597 3300005364 Bacteria 3571
47 Ga0070688_100014952 3300005365 Bacteria 4406
48 Ga0070659_100020158 3300005366 Bacteria 5062
49 Ga0070659_100023995 3300005366 Bacteria 4672
50 Ga0070659_100028613 3300005366 Bacteria 4305
51 Ga0070659_100115143 3300005366 Bacteria 2173
52 Ga0070659_100168536 3300005366 Bacteria 1793
53 Ga0070667_100028398 3300005367 Bacteria 4657
54 Ga0070667_100044467 3300005367 Bacteria 3730
55 Ga0070709_10061870 3300005434 Bacteria 2385
56 Ga0070714_100013550 3300005435 Bacteria 6535
57 Ga0070705_100010953 3300005440 Bacteria 4556
58 Ga0070700_100055462 3300005441 Bacteria 2480
59 Ga0070694_100015830 3300005444 Bacteria 4745
60 Ga0070663_100014024 3300005455 Bacteria 5133
61 Ga0070663_100121082 3300005455 Bacteria 1977
62 Ga0070678_100003725 3300005456 Bacteria 8533
63 Ga0070678_100208449 3300005456 Bacteria 1618
64 Ga0070662_100000836 3300005457 Bacteria 18940
65 Ga0070681_10002559 3300005458 Bacteria 16698
66 Ga0070681_10047687 3300005458 Bacteria 4283
67 Ga0070681_10089843 3300005458 Bacteria 3023
68 Ga0070685_10001663 3300005466 Bacteria 11684
69 Ga0070685_10001881 3300005466 Bacteria 10953
70 Ga0070707_100031265 3300005468 Bacteria 5070
71 Ga0070699_100022222 3300005518 Bacteria 5465
72 Ga0070679_100002918 3300005530 Bacteria 15548
73 Ga0070679_100025151 3300005530 Bacteria 5840
74 Ga0070679_100035826 3300005530 Bacteria 4923
75 Ga0070679_100038208 3300005530 Bacteria 4772
76 Ga0070684_100010852 3300005535 Bacteria 7237
77 Ga0070684_100017058 3300005535 Bacteria 5952
78 Ga0070697_100016546 3300005536 Bacteria 5802
79 Ga0068853_100013069 3300005539 Bacteria 6771
80 Ga0068853_100104695 3300005539 Bacteria 2505
81 Ga0068853_100109606 3300005539 Bacteria 2451
82 Ga0068853_100183987 3300005539 Bacteria 1896
83 Ga0070672_100034784 3300005543 Bacteria 3826
84 Ga0070695_100005747 3300005545 Bacteria 7309
85 Ga0070696_100016902 3300005546 Bacteria 4921
86 Ga0070696_100023628 3300005546 Bacteria 4178
87 Ga0070693_100002563 3300005547 Bacteria 8375
88 Ga0070665_100082387 3300005548 Bacteria 3222
89 Ga0070704_100189886 3300005549 Bacteria 1650
90 Ga0068855_100002546 3300005563 Bacteria 22453
91 Ga0068855_100022311 3300005563 Bacteria 7585
92 Ga0068855_100059960 3300005563 Bacteria 4451
93 Ga0068855_100341898 3300005563 Bacteria 1650
94 Ga0070664_100008394 3300005564 Bacteria 8353
95 Ga0070664_100009647 3300005564 Bacteria 7832
96 Ga0070664_100016817 3300005564 Bacteria 6004
97 Ga0070664_100028464 3300005564 Bacteria 4648
98 Ga0070664_100065826 3300005564 Bacteria 3093
99 Ga0070664_100094650 3300005564 Bacteria 2590
100 Ga0070664_100151243 3300005564 Bacteria 2049
101 Ga0068857_100004656 3300005577 Bacteria 11621
102 Ga0068857_100122249 3300005577 Bacteria 2345
103 Ga0068854_100003076 3300005578 Bacteria 10391
104 Ga0068854_100025183 3300005578 Bacteria 4082
105 Ga0068854_100100417 3300005578 Bacteria 2168
106 Ga0068856_100001602 3300005614 Bacteria 23652
107 Ga0068856_100058259 3300005614 Bacteria 3814
108 Ga0068856_100265146 3300005614 Bacteria 1733
109 Ga0068852_100002065 3300005616 Bacteria 13708
110 Ga0068852_100007728 3300005616 Bacteria 7863
111 Ga0068852_100008311 3300005616 Bacteria 7638
112 Ga0068852_100028380 3300005616 Bacteria 4579
113 Ga0068852_100030078 3300005616 Bacteria 4467
114 Ga0068852_100119015 3300005616 Bacteria 2414
115 Ga0068852_100137041 3300005616 Bacteria 2261
116 Ga0068859_100006388 3300005617 Bacteria 11959
117 Ga0068859_100043553 3300005617 Bacteria 4511
118 Ga0068864_100023643 3300005618 Bacteria 5162
119 Ga0068866_10001382 3300005718 Bacteria 10464
120 Ga0068861_100064739 3300005719 Bacteria 2814
121 Ga0068851_10002317 3300005834 Bacteria 8380
122 Ga0068851_10010765 3300005834 Bacteria 4275
123 Ga0068851_10049004 3300005834 Bacteria 2142
124 Ga0068863_100000521 3300005841 Bacteria 39214
125 Ga0068863_100010980 3300005841 Bacteria 8784
126 Ga0068858_100002595 3300005842 Bacteria 18196
127 Ga0068858_100062480 3300005842 Bacteria 3443
128 Ga0068860_100165232 3300005843 Bacteria 2136
129 Ga0068862_100013593 3300005844 Bacteria 6740
130 Ga0081455_10221121 3300005937 Unclassified 1403
131 Ga0081540_1009885 3300005983 Bacteria 6517
132 Ga0081539_10006541 3300005985 Bacteria 11117
133 Ga0097621_100035711 3300006237 Bacteria 3973
134 Ga0097621_100303583 3300006237 Bacteria 1410
135 Ga0068871_100021589 3300006358 Bacteria 4951
136 Ga0068871_100120521 3300006358 Bacteria 2215
137 Ga0068871_100192063 3300006358 Bacteria 1759
138 Ga0068865_100005114 3300006881 Bacteria 7938
139 Ga0068865_100180912 3300006881 Bacteria 1623
140 Ga0075436_100019016 3300006914 Bacteria 4705
141 Ga0097620_100006387 3300006931 Bacteria 11959
142 Ga0097620_100043554 3300006931 Bacteria 4511
143 Ga0105240_10046619 3300009093 Bacteria 5491
144 Ga0105240_10075677 3300009093 Bacteria 4152
145 Ga0105240_10135227 3300009093 Bacteria 2952
146 Ga0105240_10170468 3300009093 Bacteria 2579
147 Ga0111539_10022960 3300009094 Bacteria 7660
148 Ga0105245_10004684 3300009098 Bacteria 12091
149 Ga0105245_10004874 3300009098 Bacteria 11811
150 Ga0105243_10240364 3300009148 Bacteria 1611
151 Ga0105241_10005054 3300009174 Bacteria 9729
152 Ga0105241_10128560 3300009174 Bacteria 2048
153 Ga0105242_10007936 3300009176 Bacteria 8175
154 Ga0105248_10046839 3300009177 Bacteria 4848
155 Ga0105237_10252927 3300009545 Bacteria 1764
156 Ga0105238_10016630 3300009551 Bacteria 7450
157 Ga0105238_10022863 3300009551 Bacteria 6373
158 Ga0105238_10121488 3300009551 Bacteria 2591
159 Ga0105246_10097819 3300011119 Bacteria 2131
160 Ga0157373_10000924 3300013100 Bacteria 22752
161 Ga0157373_10005626 3300013100 Bacteria 9396
162 Ga0157373_10010452 3300013100 Bacteria 6829
163 Ga0157371_10000522 3300013102 Bacteria 45892
164 Ga0157371_10092963 3300013102 Bacteria 2137
165 Ga0157371_10109427 3300013102 Bacteria 1961
166 Ga0157371_10110555 3300013102 Bacteria 1951
167 Ga0157370_10019308 3300013104 Bacteria 6842
168 Ga0157370_10021260 3300013104 Bacteria 6469
169 Ga0157370_10024337 3300013104 Bacteria 5996
170 Ga0157370_10026655 3300013104 Bacteria 5704
171 Ga0157370_10030822 3300013104 Bacteria 5253
172 Ga0157370_10153070 3300013104 Bacteria 2146
173 Ga0157369_10002022 3300013105 Bacteria 24464
174 Ga0157369_10013944 3300013105 Bacteria 9082
175 Ga0157369_10052019 3300013105 Bacteria 4432
176 Ga0157369_10105364 3300013105 Bacteria 3002
177 Ga0157369_10111519 3300013105 Bacteria 2907
178 Ga0157374_10004205 3300013296 Bacteria 12099
179 Ga0157374_10104198 3300013296 Bacteria 2723
180 Ga0157378_10011028 3300013297 Bacteria 7909
181 Ga0157378_10016424 3300013297 Bacteria 6481
182 Ga0157378_10157456 3300013297 Bacteria 2121
183 Ga0163162_10005749 3300013306 Bacteria 11996
184 Ga0163162_10019620 3300013306 Bacteria 6636
185 Ga0163162_10048954 3300013306 Bacteria 4236
186 Ga0157372_10000791 3300013307 Bacteria 34366
187 Ga0157372_10009509 3300013307 Bacteria 10336
188 Ga0157372_10023388 3300013307 Bacteria 6698
189 Ga0157372_10043976 3300013307 Bacteria 4947
190 Ga0157372_10133216 3300013307 Bacteria 2861
191 Ga0157372_10202722 3300013307 Bacteria 2298
192 Ga0157372_10212922 3300013307 Bacteria 2239
193 Ga0157372_10243311 3300013307 Bacteria 2087
194 Ga0157372_10298891 3300013307 Bacteria 1873
195 Ga0157375_10219422 3300013308 Bacteria 2060
196 Ga0163163_10047688 3300014325 Bacteria 4212
197 Ga0157379_10002212 3300014968 Bacteria 16183
198 Ga0157379_10009512 3300014968 Bacteria 8464
199 Ga0157376_10012087 3300014969 Bacteria 6391
200 Ga0163161_10025411 3300017792 Bacteria 4192
201 Ga0207697_10000450 3300025315 Bacteria 23178
202 Ga0207656_10005762 3300025321 Bacteria 4407
203 Ga0207656_10014690 3300025321 Bacteria 3022
204 Ga0207642_10001187 3300025899 Bacteria 8031
205 Ga0207688_10010358 3300025901 Bacteria 5074
206 Ga0207680_10048735 3300025903 Bacteria 2518
207 Ga0207680_10056941 3300025903 Bacteria 2363
208 Ga0207680_10074458 3300025903 Bacteria 2114
209 Ga0207699_10108194 3300025906 Bacteria 1777
210 Ga0207645_10001587 3300025907 Bacteria 18531
211 Ga0207643_10000429 3300025908 Bacteria 27769
212 Ga0207705_10012215 3300025909 Bacteria 6206
213 Ga0207705_10118089 3300025909 Bacteria 1965
214 Ga0207705_10138788 3300025909 Bacteria 1814
215 Ga0207684_10033492 3300025910 Bacteria 4368
216 Ga0207654_10004312 3300025911 Bacteria 7172
217 Ga0207654_10008078 3300025911 Bacteria 5305
218 Ga0207707_10003585 3300025912 Bacteria 13765
219 Ga0207707_10005932 3300025912 Bacteria 10689
220 Ga0207707_10033524 3300025912 Bacteria 4493
221 Ga0207695_10014512 3300025913 Bacteria 9326
222 Ga0207695_10038581 3300025913 Bacteria 5140
223 Ga0207695_10070564 3300025913 Bacteria 3571
224 Ga0207663_10024134 3300025916 Bacteria 3499
225 Ga0207660_10002460 3300025917 Bacteria 12166
226 Ga0207660_10118138 3300025917 Bacteria 2005
227 Ga0207660_10123786 3300025917 Bacteria 1961
228 Ga0207662_10022596 3300025918 Bacteria 3607
229 Ga0207662_10111683 3300025918 Bacteria 1705
230 Ga0207657_10000297 3300025919 Bacteria 52991
231 Ga0207657_10000657 3300025919 Bacteria 36802
232 Ga0207657_10004018 3300025919 Bacteria 15631
233 Ga0207657_10005722 3300025919 Bacteria 12970
234 Ga0207657_10015368 3300025919 Bacteria 7418
235 Ga0207657_10193448 3300025919 Bacteria 1640
236 Ga0207649_10003651 3300025920 Bacteria 8404
237 Ga0207649_10007402 3300025920 Bacteria 5973
238 Ga0207649_10032774 3300025920 Bacteria 3099
239 Ga0207649_10039934 3300025920 Bacteria 2848
240 Ga0207649_10117885 3300025920 Bacteria 1785
241 Ga0207649_10118456 3300025920 Bacteria 1781
242 Ga0207652_10011598 3300025921 Bacteria 7110
243 Ga0207652_10015423 3300025921 Bacteria 6208
244 Ga0207652_10023700 3300025921 Bacteria 5087
245 Ga0207652_10046377 3300025921 Bacteria 3708
246 Ga0207652_10184286 3300025921 Bacteria 1877
247 Ga0207681_10016827 3300025923 Bacteria 4584
248 Ga0207694_10041058 3300025924 Bacteria 3564
249 Ga0207650_10000503 3300025925 Bacteria 32602
250 Ga0207659_10001307 3300025926 Bacteria 14875
251 Ga0207687_10011244 3300025927 Bacteria 5846
252 Ga0207687_10014035 3300025927 Bacteria 5237
253 Ga0207664_10008715 3300025929 Bacteria 7091
254 Ga0207644_10007750 3300025931 Bacteria 7008
255 Ga0207644_10092409 3300025931 Bacteria 2257
256 Ga0207690_10000412 3300025932 Bacteria 28034
257 Ga0207690_10004753 3300025932 Bacteria 8016
258 Ga0207690_10032515 3300025932 Bacteria 3348
259 Ga0207690_10090755 3300025932 Bacteria 2158
260 Ga0207690_10151460 3300025932 Bacteria 1720
261 Ga0207706_10000164 3300025933 Bacteria 73885
262 Ga0207706_10066056 3300025933 Bacteria 3184
263 Ga0207686_10002716 3300025934 Bacteria 9600
264 Ga0207670_10003032 3300025936 Bacteria 8859
265 Ga0207691_10071179 3300025940 Bacteria 3139
266 Ga0207711_10000654 3300025941 Bacteria 34558
267 Ga0207689_10003889 3300025942 Bacteria 13608
268 Ga0207689_10021399 3300025942 Bacteria 5438
269 Ga0207689_10133337 3300025942 Bacteria 2045
270 Ga0207661_10009378 3300025944 Bacteria 7017
271 Ga0207661_10157323 3300025944 Bacteria 1969
272 Ga0207679_10000601 3300025945 Bacteria 24040
273 Ga0207679_10009854 3300025945 Bacteria 6134
274 Ga0207679_10011564 3300025945 Bacteria 5724
275 Ga0207679_10026327 3300025945 Bacteria 4009
276 Ga0207679_10052132 3300025945 Bacteria 2999
277 Ga0207667_10000695 3300025949 Bacteria 43623
278 Ga0207667_10003052 3300025949 Bacteria 20782
279 Ga0207667_10184620 3300025949 Bacteria 2141
280 Ga0207667_10203916 3300025949 Bacteria 2028
281 Ga0207667_10250929 3300025949 Bacteria 1810
282 Ga0207667_10274172 3300025949 Bacteria 1724
283 Ga0207667_10286994 3300025949 Bacteria 1682
284 Ga0207651_10034709 3300025960 Bacteria 3270
285 Ga0207651_10052331 3300025960 Bacteria 2783
286 Ga0207640_10005704 3300025981 Bacteria 6783
287 Ga0207640_10082952 3300025981 Bacteria 2196
288 Ga0207658_10004210 3300025986 Bacteria 10022
289 Ga0207658_10045089 3300025986 Bacteria 3213
290 Ga0207658_10064037 3300025986 Bacteria 2756
291 Ga0207677_10000162 3300026023 Bacteria 53309
292 Ga0207677_10029584 3300026023 Bacteria 3483
293 Ga0207703_10010978 3300026035 Bacteria 7058
294 Ga0207639_10013780 3300026041 Bacteria 5669
295 Ga0207639_10069988 3300026041 Bacteria 2739
296 Ga0207639_10423179 3300026041 Bacteria 1204
297 Ga0207678_10011759 3300026067 Bacteria 7683
298 Ga0207678_10148156 3300026067 Bacteria 2003
299 Ga0207678_10163519 3300026067 Bacteria 1901
300 Ga0207678_10294787 3300026067 Bacteria 1393
301 Ga0207708_10057134 3300026075 Bacteria 2977
302 Ga0207708_10351074 3300026075 Bacteria 1210
303 Ga0207702_10001837 3300026078 Bacteria 20897
304 Ga0207702_10042852 3300026078 Bacteria 3798
305 Ga0207702_10181386 3300026078 Bacteria 1939
306 Ga0207641_10002418 3300026088 Bacteria 17241
307 Ga0207648_10068279 3300026089 Bacteria 3097
308 Ga0207676_10000845 3300026095 Bacteria 23780
309 Ga0207676_10049890 3300026095 Bacteria 3259
310 Ga0207674_10000396 3300026116 Bacteria 56376
311 Ga0207674_10014843 3300026116 Bacteria 8591
312 Ga0207674_10105737 3300026116 Bacteria 2792
313 Ga0207675_100004233 3300026118 Bacteria 13885
314 Ga0207683_10001007 3300026121 Bacteria 25719
315 Ga0207698_10000732 3300026142 Bacteria 19003
316 Ga0207698_10007413 3300026142 Bacteria 6872
317 Ga0207698_10021638 3300026142 Bacteria 4453
318 Ga0207698_10027156 3300026142 Bacteria 4060
319 Ga0207698_10095682 3300026142 Bacteria 2445
320 Ga0207698_10294985 3300026142 Bacteria 1507
321 Ga0209974_10004530 3300027876 Bacteria 4946
322 Ga0268264_10005787 3300028381 Bacteria 10481
323 Ga0268264_10053425 3300028381 Bacteria 3370
324 Ga0268264_10162997 3300028381 Bacteria 2010
325 Ga0307408_100187220 3300031548 Bacteria 1665
326 Ga0307410_10015234 3300031852 Bacteria 4554
327 Ga0307407_10015800 3300031903 Bacteria 3743
328 Ga0307412_10010002 3300031911 Bacteria 5456
329 Ga0307409_100000903 3300031995 Bacteria 13753
330 Ga0307415_100004603 3300032126 Bacteria 7195
331 Ga0373923_0006384 3300035111 Bacteria 4072
332 Ga0373923_0021739 3300035111 Bacteria 2508
333 Ga0373936_0018609 3300035113 Bacteria 2684
334 Ga0373945_0034565 3300035116 Bacteria 1802
335 Ga0373945_0043741 3300035116 Bacteria 1626
336 Ga0373953_0002065 3300035117 Bacteria 5990
337 Ga0373954_0000001 3300035118 Bacteria 158201
338 Ga0373954_0005441 3300035118 Bacteria 5509
339 Ga0373954_0009183 3300035118 Bacteria 4349
340 Ga0373954_0018297 3300035118 Bacteria 3152
341 Ga0373956_0006326 3300035119 Bacteria 4740
342 Ga0373956_0010448 3300035119 Bacteria 3805
343 Ga0373943_0033098 3300035170 Bacteria 2460
344 Ga0373943_0036182 3300035170 Bacteria 2363
345 Ga0373955_0008460 3300035172 Bacteria 4781
346 Ga0373955_0017595 3300035172 Bacteria 3540
347 Ga0373955_0018192 3300035172 Bacteria 3491
348 Ga0373955_0026361 3300035172 Bacteria 2993
349 Ga0373924_0000883 3300035410 Bacteria 9450
350 Ga0373924_0006601 3300035410 Bacteria 4161
351 Ga0373924_0016434 3300035410 Bacteria 2824
352 Ga0373935_0031819 3300035692 Bacteria 3276
353 Ga0373927_0010594 3300035695 Bacteria 6144
354 Ga0373927_0127253 3300035695 Bacteria 1663
355 Ga0373933_0012221 3300035724 Bacteria 4743
356 Ga0373933_0037569 3300035724 Bacteria 2841
357 Ga0373933_0186966 3300035724 Bacteria 1322
358 Ga0373947_0015771 3300035725 Bacteria 4340
359 Ga0373947_0039702 3300035725 Bacteria 2801
360 Ga0373947_0041584 3300035725 Bacteria 2741
361 Ga0373937_0005181 3300036401 Bacteria 11122
362 Ga0373937_0020151 3300036401 Bacteria 5976
363 Ga0373937_0028653 3300036401 Bacteria 5040
364 Ga0373937_0032018 3300036401 Bacteria 4767
365 Ga0373937_0047293 3300036401 Bacteria 3936
366 Ga0373937_0227667 3300036401 Bacteria 1755
367 Ga0316584_0010926 3300036712 Bacteria 6359
368 Ga0373925_0010065 3300037068 Bacteria 6868
369 Ga0373925_0025023 3300037068 Bacteria 4360
370 Ga0373925_0033237 3300037068 Bacteria 3802
371 Ga0373925_0149014 3300037068 Bacteria 1836
372 Ga0373925_0218660 3300037068 Bacteria 1520
373 Ga0373925_0233943 3300037068 Bacteria 1470
374 Ga0395899_0001564 3300037312 Bacteria 19269
375 Ga0395900_0018529 3300037418 Bacteria 7099
376 Ga0395900_0262605 3300037418 Bacteria 1724
377 Ga0395898_0003262 3300037466 Bacteria 18232
378 Ga0395898_0053882 3300037466 Bacteria 3927
379 Ga0395905_0000126 3300037471 Bacteria 126035
380 Ga0395905_0005168 3300037471 Bacteria 13388
381 Ga0395905_0017017 3300037471 Bacteria 6902
382 Ga0395905_0041120 3300037471 Bacteria 4337
383 Ga0395901_0069291 3300038443 Bacteria 3673
384 Ga0439448_0053765 3300042005 Bacteria 1322
385 Ga0495592_0063538 3300046454 Bacteria 2707
386 Ga0495592_0066301 3300046454 Bacteria 2642
387 Ga0495592_0165457 3300046454 Bacteria 1518
388 Ga0495629_0020556 3300046459 Bacteria 4715
389 Ga0495651_0002598 3300046462 Bacteria 13965
390 Ga0495651_0007571 3300046462 Bacteria 8307
391 Ga0495651_0125247 3300046462 Bacteria 1882
392 Ga0495653_0007240 3300046463 Bacteria 9090
393 Ga0495653_0203989 3300046463 Bacteria 1340
394 Ga0495580_0012254 3300046472 Bacteria 6584
395 Ga0495580_0023199 3300046472 Bacteria 4559
396 Ga0495582_0003184 3300046473 Bacteria 9225
397 Ga0495582_0015855 3300046473 Bacteria 4132
398 Ga0495639_0024590 3300046475 Bacteria 2652
399 Ga0495664_0002776 3300046477 Bacteria 9425
400 Ga0495664_0033125 3300046477 Bacteria 3036
401 Ga0495594_0050909 3300046499 Bacteria 2279
402 Ga0495608_0010400 3300046511 Bacteria 6494
403 Ga0495608_0016080 3300046511 Bacteria 5176
404 Ga0495618_0011734 3300046514 Bacteria 5319
405 Ga0495628_0023409 3300046516 Bacteria 5069
406 Ga0495628_0033001 3300046516 Bacteria 4175
407 Ga0495628_0227203 3300046516 Bacteria 1400
408 Ga0495630_0018764 3300046517 Bacteria 5083
409 Ga0495630_0025880 3300046517 Bacteria 4341
410 Ga0495666_0041781 3300046526 Bacteria 2219
411 Ga0495652_0016901 3300046529 Bacteria 6519
412 Ga0495652_0036330 3300046529 Bacteria 4285
413 Ga0495652_0134326 3300046529 Bacteria 1954
414 Ga0495665_0010123 3300046531 Bacteria 5109
415 Ga0495665_0011441 3300046531 Bacteria 4802
416 Ga0495665_0105710 3300046531 Bacteria 1477
417 Ga0495640_0014254 3300046533 Bacteria 6022
418 Ga0495640_0015001 3300046533 Bacteria 5839
419 Ga0495586_0006225 3300046535 Bacteria 6379
420 Ga0495587_0002421 3300046536 Bacteria 12435
421 Ga0495587_0034279 3300046536 Bacteria 3062
422 Ga0495621_0005862 3300046539 Bacteria 3558
423 Ga0495645_0000056 3300046543 Bacteria 81955
424 Ga0495645_0004831 3300046543 Bacteria 9208
425 Ga0495645_0005680 3300046543 Bacteria 8589
426 Ga0495645_0010684 3300046543 Bacteria 6446
427 Ga0495667_0000293 3300046559 Bacteria 32233
428 Ga0495667_0016751 3300046559 Bacteria 4950
429 Ga0495667_0135517 3300046559 Bacteria 1587
430 Ga0495634_0026307 3300046642 Bacteria 4062
431 Ga0495634_0069400 3300046642 Bacteria 2325
432 Ga0495635_0037690 3300046663 Bacteria 3346
433 Ga0495635_0063114 3300046663 Bacteria 2544
434 Ga0495635_0168396 3300046663 Bacteria 1490
435 Ga0495657_0027802 3300046675 Bacteria 3987
436 Ga0495657_0041951 3300046675 Bacteria 3127
437 Ga0495657_0214335 3300046675 Bacteria 1169
438 Ga0495599_0016654 3300046678 Bacteria 4565
439 Ga0495599_0029876 3300046678 Bacteria 3418
440 Ga0495623_0018229 3300046679 Bacteria 4533
441 Ga0495623_0073494 3300046679 Bacteria 2125
442 Ga0495646_0001995 3300046680 Bacteria 12333
443 Ga0495647_0002608 3300046681 Bacteria 5712
444 Ga0495647_0014894 3300046681 Bacteria 2715
445 Ga0495658_0003919 3300046683 Bacteria 7348
446 Ga0495658_0012866 3300046683 Bacteria 4250
447 Ga0495658_0013527 3300046683 Bacteria 4154
448 Ga0495613_0061734 3300046689 Bacteria 2744
449 Ga0495613_0078920 3300046689 Bacteria 2394
450 Ga0495600_0010886 3300046809 Bacteria 5657
451 Ga0495600_0032156 3300046809 Bacteria 3403
452 Ga0495581_0001661 3300047315 Bacteria 12389
453 Ga0495604_0003730 3300047317 Bacteria 12131
454 Ga0495604_0022595 3300047317 Bacteria 5022
455 Ga0495604_0089663 3300047317 Bacteria 2285
456 Ga0495674_0001667 3300047319 Bacteria 21836
457 Ga0495674_0001748 3300047319 Bacteria 21384
458 Ga0495676_0059396 3300047321 Bacteria 3003
459 Ga0495680_0003160 3300047322 Bacteria 16401
460 Ga0495680_0026771 3300047322 Bacteria 4748
461 Ga0495680_0044134 3300047322 Bacteria 3526
462 Ga0495675_0013454 3300047444 Bacteria 5165
463 Ga0495675_0021285 3300047444 Bacteria 4129
464 Ga0495684_0002788 3300047471 Bacteria 13787
465 Ga0495684_0020748 3300047471 Bacteria 5062
466 Ga0495684_0055876 3300047471 Bacteria 3010
467 Ga0495684_0177721 3300047471 Bacteria 1579
468 Ga0495602_0003569 3300048088 Bacteria 16101
469 Ga0496101_0009607 3300048904 Bacteria 6363
470 Ga0496102_0011937 3300048905 Bacteria 7502
471 Ga0496102_0028354 3300048905 Bacteria 4999
472 Ga0496102_0166516 3300048905 Bacteria 2074
473 Ga0496104_0091398 3300048907 Bacteria 2909
474 Ga0496104_0285634 3300048907 Bacteria 1563
475 Ga0496105_0062729 3300048908 Bacteria 3067
476 Ga0496106_0005422 3300048909 Bacteria 9436
477 Ga0496106_0069303 3300048909 Bacteria 2692
478 Ga0496106_0173454 3300048909 Bacteria 1710
479 Ga0496107_0038768 3300048910 Bacteria 3417
480 Ga0496108_0213061 3300048911 Bacteria 1677
481 Ga0496109_0101135 3300048912 Bacteria 2675
482 Ga0496109_0316525 3300048912 Bacteria 1472
483 Ga0496110_0034960 3300048913 Bacteria 4356
484 Ga0496112_0018662 3300048915 Bacteria 6537
485 Ga0496112_0124275 3300048915 Bacteria 2551
486 Ga0501032_0240288 3300049569 Bacteria 1177
487 Ga0501034_0207641 3300049571 Bacteria 1914
488 Ga0501036_0364036 3300049572 Bacteria 1207
489 Ga0501038_0176593 3300049574 Bacteria 1726
490 Ga0501043_0000009 3300049579 Bacteria 214823
491 Ga0501043_0020921 3300049579 Bacteria 5130
492 Ga0501046_0000022 3300049580 Bacteria 215451
493 Ga0501046_0044864 3300049580 Bacteria 3514
494 Ga0501047_0000021 3300049581 Bacteria 254841
495 Ga0501047_0020495 3300049581 Bacteria 6348
496 Ga0501047_0023869 3300049581 Bacteria 5873
497 Ga0501047_0067747 3300049581 Bacteria 3439
498 Ga0501047_0104367 3300049581 Bacteria 2714
499 Ga0501047_0242429 3300049581 Bacteria 1653
500 Ga0501048_0003510 3300049582 Bacteria 11922
501 Ga0501070_0000979 3300049586 Bacteria 25649
502 Ga0501070_0031620 3300049586 Bacteria 4434
503 Ga0501070_0069169 3300049586 Bacteria 2923
504 Ga0501070_0158494 3300049586 Bacteria 1866
505 Ga0501071_0145867 3300049587 Bacteria 1764
506 Ga0501072_0004295 3300049588 Bacteria 10819
507 Ga0501073_0042997 3300049589 Bacteria 3187
508 Ga0501073_0054936 3300049589 Bacteria 2787
509 Ga0501074_0006077 3300049590 Bacteria 8719
510 Ga0501079_0008169 3300049741 Bacteria 7933
511 Ga0501080_0010364 3300049742 Bacteria 8524
512 Ga0501080_0022597 3300049742 Bacteria 5826
513 Ga0501080_0109168 3300049742 Bacteria 2564
514 Ga0501080_0285865 3300049742 Bacteria 1498
515 Ga0501083_0112604 3300049744 Bacteria 1788
516 Ga0501083_0158264 3300049744 Bacteria 1482
517 Ga0501035_0060482 3300049822 Bacteria 3372
518 Ga0501035_0068818 3300049822 Bacteria 3139
519 Ga0501035_0147680 3300049822 Bacteria 2041
520 Ga0501044_0055738 3300049823 Bacteria 4059
521 Ga0501044_0076337 3300049823 Bacteria 3401
522 Ga0501044_0129214 3300049823 Bacteria 2522
523 Ga0501044_0257803 3300049823 Bacteria 1683
524 Ga0501044_0298528 3300049823 Bacteria 1540
525 nmdc:mga08y16_332360_c1 3300050511 Bacteria 1563
526 nmdc:mga0n895_191062_c1 3300050512 Bacteria 2078
527 nmdc:mga08x19_45651_c1 3300050514 Bacteria 2800
528 Ga0495601_0004409 3300053077 Bacteria 8134
529 Ga0495601_0023907 3300053077 Bacteria 3758
530 Ga0495612_0002196 3300053078 Bacteria 8023
531 Ga0495612_0102634 3300053078 Bacteria 1219
532 Ga0495595_0001285 3300053084 Bacteria 9794
533 Ga0495619_0007680 3300053085 Bacteria 6827
534 Ga0495619_0008116 3300053085 Bacteria 6646
535 Ga0495619_0012565 3300053085 Bacteria 5332
536 Ga0495619_0017076 3300053085 Bacteria 4601
537 Ga0495619_0042548 3300053085 Bacteria 2975
538 Ga0495619_0070169 3300053085 Bacteria 2343
539 Ga0501084_0253460 3300054114 Bacteria 1485
540 Ga0501082_0077085 3300060353 Bacteria 2874

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300042005 Ga0439448_0053765 Ga0439448_0053765_23_991 270
2 3300026075 Ga0207708_10351074 Ga0207708_103510741 290
3 3300005937 Ga0081455_10221121 Ga0081455_102211212 299
4 3300035410 Ga0373924_0016434 Ga0373924_0016434_22_1110 302
5 3300049823 Ga0501044_0129214 Ga0501044_0129214_875_2008 306
6 3300005456 Ga0070678_100003725 Ga0070678_10000372510 307
7 3300005546 Ga0070696_100016902 Ga0070696_1000169022 307
8 3300005547 Ga0070693_100002563 Ga0070693_1000025635 307
9 3300005718 Ga0068866_10001382 Ga0068866_1000138213 307
10 3300005985 Ga0081539_10006541 Ga0081539_100065415 307
11 3300006881 Ga0068865_100180912 Ga0068865_1001809122 307
12 3300009098 Ga0105245_10004874 Ga0105245_1000487414 307
13 3300009174 Ga0105241_10128560 Ga0105241_101285602 307
14 3300009176 Ga0105242_10007936 Ga0105242_100079368 307
15 3300013297 Ga0157378_10011028 Ga0157378_100110282 307
16 3300013306 Ga0163162_10019620 Ga0163162_100196208 307
17 3300017792 Ga0163161_10025411 Ga0163161_100254114 307
18 3300025899 Ga0207642_10001187 Ga0207642_100011873 307
19 3300025903 Ga0207680_10074458 Ga0207680_100744582 307
20 3300025927 Ga0207687_10014035 Ga0207687_100140352 307
21 3300025931 Ga0207644_10092409 Ga0207644_100924092 307
22 3300025934 Ga0207686_10002716 Ga0207686_100027163 307
23 3300025942 Ga0207689_10021399 Ga0207689_100213992 307
24 3300026121 Ga0207683_10001007 Ga0207683_1000100711 307
25 3300049569 Ga0501032_0240288 Ga0501032_0240288_62_1132 307
26 iso_pu_bacteria 2885326080 2885332234 307
27 3300046462 Ga0495651_0125247 Ga0495651_0125247_493_1638 312
28 3300025949 Ga0207667_10184620 Ga0207667_101846202 313
29 3300035111 Ga0373923_0006384 Ga0373923_0006384_2848_3969 313
30 3300035113 Ga0373936_0018609 Ga0373936_0018609_965_2086 313
31 3300035119 Ga0373956_0010448 Ga0373956_0010448_738_1859 313
32 3300035172 Ga0373955_0017595 Ga0373955_0017595_104_1225 313
33 3300035724 Ga0373933_0037569 Ga0373933_0037569_1671_2792 313
34 3300046462 Ga0495651_0002598 Ga0495651_0002598_1595_2716 313
35 3300046472 Ga0495580_0012254 Ga0495580_0012254_2274_3395 313
36 3300046477 Ga0495664_0002776 Ga0495664_0002776_4734_5855 313
37 3300046499 Ga0495594_0050909 Ga0495594_0050909_841_1962 313
38 3300046516 Ga0495628_0033001 Ga0495628_0033001_200_1321 313
39 3300046526 Ga0495666_0041781 Ga0495666_0041781_192_1313 313
40 3300046529 Ga0495652_0134326 Ga0495652_0134326_338_1459 313
41 3300046531 Ga0495665_0105710 Ga0495665_0105710_323_1444 313
42 3300046533 Ga0495640_0015001 Ga0495640_0015001_2624_3745 313
43 3300046642 Ga0495634_0069400 Ga0495634_0069400_1004_2125 313
44 3300046675 Ga0495657_0041951 Ga0495657_0041951_1572_2693 313
45 3300046678 Ga0495599_0029876 Ga0495599_0029876_812_1933 313
46 3300046683 Ga0495658_0012866 Ga0495658_0012866_2833_3954 313
47 3300046809 Ga0495600_0010886 Ga0495600_0010886_1832_2953 313
48 3300047317 Ga0495604_0089663 Ga0495604_0089663_1100_2221 313
49 3300047319 Ga0495674_0001667 Ga0495674_0001667_1602_2723 313
50 3300047322 Ga0495680_0026771 Ga0495680_0026771_2986_4107 313
51 3300047444 Ga0495675_0021285 Ga0495675_0021285_1730_2851 313
52 3300047471 Ga0495684_0177721 Ga0495684_0177721_105_1226 313
53 3300048907 Ga0496104_0285634 Ga0496104_0285634_35_1144 313
54 3300053085 Ga0495619_0012565 Ga0495619_0012565_1675_2796 313
55 3300035118 Ga0373954_0005441 Ga0373954_0005441_2872_3990 315
56 3300005336 Ga0070680_100094594 Ga0070680_1000945942 316
57 3300005344 Ga0070661_100007865 Ga0070661_1000078655 316
58 3300005458 Ga0070681_10002559 Ga0070681_1000255911 316
59 3300005530 Ga0070679_100002918 Ga0070679_1000029183 316
60 3300005539 Ga0068853_100109606 Ga0068853_1001096062 316
61 3300005577 Ga0068857_100122249 Ga0068857_1001222492 316
62 3300013100 Ga0157373_10010452 Ga0157373_100104522 316
63 3300013104 Ga0157370_10030822 Ga0157370_100308223 316
64 3300013307 Ga0157372_10202722 Ga0157372_102027222 316
65 3300025912 Ga0207707_10005932 Ga0207707_100059328 316
66 3300025920 Ga0207649_10118456 Ga0207649_101184562 316
67 3300025921 Ga0207652_10046377 Ga0207652_100463772 316
68 3300026041 Ga0207639_10069988 Ga0207639_100699882 316
69 3300026116 Ga0207674_10105737 Ga0207674_101057372 316
70 3300031548 Ga0307408_100187220 Ga0307408_1001872202 317
71 3300036401 Ga0373937_0227667 Ga0373937_0227667_234_1346 317
72 3300013104 Ga0157370_10021260 Ga0157370_100212602 318
73 3300005330 Ga0070690_100128128 Ga0070690_1001281282 319
74 3300009093 Ga0105240_10075677 Ga0105240_100756771 319
75 3300028381 Ga0268264_10053425 Ga0268264_100534252 319
76 3300049587 Ga0501071_0145867 Ga0501071_0145867_161_1261 319
77 3300005327 Ga0070658_10009579 Ga0070658_100095795 320
78 3300005329 Ga0070683_100022132 Ga0070683_1000221325 320
79 3300005330 Ga0070690_100010980 Ga0070690_1000109806 320
80 3300005334 Ga0068869_100106122 Ga0068869_1001061222 320
81 3300005335 Ga0070666_10006712 Ga0070666_100067123 320
82 3300005336 Ga0070680_100010191 Ga0070680_1000101915 320
83 3300005337 Ga0070682_100141373 Ga0070682_1001413732 320
84 3300005339 Ga0070660_100006417 Ga0070660_1000064175 320
85 3300005340 Ga0070689_100070388 Ga0070689_1000703882 320
86 3300005344 Ga0070661_100012354 Ga0070661_1000123544 320
87 3300005355 Ga0070671_100016774 Ga0070671_1000167742 320
88 3300005364 Ga0070673_100040597 Ga0070673_1000405972 320
89 3300005365 Ga0070688_100014952 Ga0070688_1000149526 320
90 3300005366 Ga0070659_100023995 Ga0070659_1000239952 320
91 3300005367 Ga0070667_100028398 Ga0070667_1000283982 320
92 3300005435 Ga0070714_100013550 Ga0070714_1000135506 320
93 3300005455 Ga0070663_100014024 Ga0070663_1000140245 320
94 3300005458 Ga0070681_10047687 Ga0070681_100476872 320
95 3300005466 Ga0070685_10001663 Ga0070685_1000166313 320
96 3300005530 Ga0070679_100025151 Ga0070679_1000251515 320
97 3300005535 Ga0070684_100010852 Ga0070684_1000108525 320
98 3300005539 Ga0068853_100013069 Ga0068853_1000130695 320
99 3300005548 Ga0070665_100082387 Ga0070665_1000823872 320
100 3300005563 Ga0068855_100059960 Ga0068855_1000599603 320
101 3300005564 Ga0070664_100008394 Ga0070664_1000083945 320
102 3300005577 Ga0068857_100004656 Ga0068857_1000046563 320
103 3300005578 Ga0068854_100003076 Ga0068854_10000307610 320
104 3300005614 Ga0068856_100265146 Ga0068856_1002651462 320
105 3300005616 Ga0068852_100008311 Ga0068852_1000083118 320
106 3300005617 Ga0068859_100006388 Ga0068859_1000063889 320
107 3300005618 Ga0068864_100023643 Ga0068864_1000236432 320
108 3300005841 Ga0068863_100000521 Ga0068863_1000005213 320
109 3300005842 Ga0068858_100002595 Ga0068858_1000025956 320
110 3300005843 Ga0068860_100165232 Ga0068860_1001652322 320
111 3300006358 Ga0068871_100120521 Ga0068871_1001205212 320
112 3300006931 Ga0097620_100006387 Ga0097620_1000063876 320
113 3300009093 Ga0105240_10046619 Ga0105240_100466192 320
114 3300009098 Ga0105245_10004684 Ga0105245_1000468414 320
115 3300009174 Ga0105241_10005054 Ga0105241_100050545 320
116 3300009177 Ga0105248_10046839 Ga0105248_100468392 320
117 3300009545 Ga0105237_10252927 Ga0105237_102529272 320
118 3300009551 Ga0105238_10022863 Ga0105238_100228634 320
119 3300013100 Ga0157373_10005626 Ga0157373_100056265 320
120 3300013102 Ga0157371_10092963 Ga0157371_100929632 320
121 3300013104 Ga0157370_10024337 Ga0157370_100243375 320
122 3300013296 Ga0157374_10004205 Ga0157374_1000420514 320
123 3300013297 Ga0157378_10016424 Ga0157378_100164248 320
124 3300013306 Ga0163162_10005749 Ga0163162_100057492 320
125 3300013307 Ga0157372_10023388 Ga0157372_100233883 320
126 3300013308 Ga0157375_10219422 Ga0157375_102194222 320
127 3300014325 Ga0163163_10047688 Ga0163163_100476882 320
128 3300014968 Ga0157379_10002212 Ga0157379_100022126 320
129 3300014969 Ga0157376_10012087 Ga0157376_100120872 320
130 3300025903 Ga0207680_10056941 Ga0207680_100569412 320
131 3300025909 Ga0207705_10012215 Ga0207705_100122155 320
132 3300025911 Ga0207654_10008078 Ga0207654_100080785 320
133 3300025912 Ga0207707_10003585 Ga0207707_100035858 320
134 3300025913 Ga0207695_10014512 Ga0207695_100145125 320
135 3300025916 Ga0207663_10024134 Ga0207663_100241343 320
136 3300025917 Ga0207660_10002460 Ga0207660_100024605 320
137 3300025919 Ga0207657_10000297 Ga0207657_1000029721 320
138 3300025920 Ga0207649_10003651 Ga0207649_100036518 320
139 3300025921 Ga0207652_10011598 Ga0207652_100115985 320
140 3300025924 Ga0207694_10041058 Ga0207694_100410584 320
141 3300025927 Ga0207687_10011244 Ga0207687_100112442 320
142 3300025929 Ga0207664_10008715 Ga0207664_100087155 320
143 3300025931 Ga0207644_10007750 Ga0207644_100077508 320
144 3300025932 Ga0207690_10004753 Ga0207690_100047535 320
145 3300025941 Ga0207711_10000654 Ga0207711_1000065438 320
146 3300025942 Ga0207689_10133337 Ga0207689_101333372 320
147 3300025944 Ga0207661_10009378 Ga0207661_100093784 320
148 3300025945 Ga0207679_10011564 Ga0207679_100115643 320
149 3300025949 Ga0207667_10000695 Ga0207667_1000069531 320
150 3300025960 Ga0207651_10034709 Ga0207651_100347092 320
151 3300025981 Ga0207640_10005704 Ga0207640_100057044 320
152 3300025986 Ga0207658_10004210 Ga0207658_100042103 320
153 3300026023 Ga0207677_10000162 Ga0207677_1000016258 320
154 3300026035 Ga0207703_10010978 Ga0207703_100109788 320
155 3300026041 Ga0207639_10013780 Ga0207639_100137804 320
156 3300026067 Ga0207678_10011759 Ga0207678_100117599 320
157 3300026078 Ga0207702_10042852 Ga0207702_100428524 320
158 3300026088 Ga0207641_10002418 Ga0207641_100024186 320
159 3300026095 Ga0207676_10000845 Ga0207676_100008455 320
160 3300026116 Ga0207674_10000396 Ga0207674_1000039615 320
161 3300026142 Ga0207698_10000732 Ga0207698_100007328 320
162 3300028381 Ga0268264_10005787 Ga0268264_100057878 320
163 3300035118 Ga0373954_0018297 Ga0373954_0018297_506_1651 320
164 3300036401 Ga0373937_0047293 Ga0373937_0047293_1366_2511 320
165 3300048911 Ga0496108_0213061 Ga0496108_0213061_369_1514 320
166 3300048915 Ga0496112_0018662 Ga0496112_0018662_3824_4969 320
167 3300049571 Ga0501034_0207641 Ga0501034_0207641_122_1216 321
168 3300049580 Ga0501046_0044864 Ga0501046_0044864_1137_2231 321
169 3300049742 Ga0501080_0109168 Ga0501080_0109168_1119_2213 321
170 3300049822 Ga0501035_0147680 Ga0501035_0147680_223_1317 321
171 3300049823 Ga0501044_0055738 Ga0501044_0055738_2112_3206 321
172 3300037466 Ga0395898_0053882 Ga0395898_0053882_839_1963 322
173 3300005539 Ga0068853_100104695 Ga0068853_1001046952 326
174 3300005564 Ga0070664_100065826 Ga0070664_1000658262 326
175 3300005616 Ga0068852_100119015 Ga0068852_1001190152 326
176 3300013102 Ga0157371_10109427 Ga0157371_101094272 326
177 3300013105 Ga0157369_10105364 Ga0157369_101053642 326
178 3300025919 Ga0207657_10015368 Ga0207657_100153682 326
179 3300026041 Ga0207639_10423179 Ga0207639_104231791 326
180 3300026067 Ga0207678_10294787 Ga0207678_102947871 326
181 3300031903 Ga0307407_10015800 Ga0307407_100158003 326
182 3300031911 Ga0307412_10010002 Ga0307412_100100023 326
183 3300031995 Ga0307409_100000903 Ga0307409_1000009032 326
184 3300032126 Ga0307415_100004603 Ga0307415_1000046031 326
185 3300046472 Ga0495580_0023199 Ga0495580_0023199_1095_2240 327
186 3300046473 Ga0495582_0015855 Ga0495582_0015855_2543_3688 327
187 3300046475 Ga0495639_0024590 Ga0495639_0024590_92_1237 327
188 3300046531 Ga0495665_0010123 Ga0495665_0010123_1432_2577 327
189 3300046539 Ga0495621_0005862 Ga0495621_0005862_1583_2728 327
190 3300046675 Ga0495657_0214335 Ga0495657_0214335_30_1079 327
191 3300046681 Ga0495647_0014894 Ga0495647_0014894_602_1747 327
192 3300046683 Ga0495658_0003919 Ga0495658_0003919_1831_2976 327
193 3300053085 Ga0495619_0070169 Ga0495619_0070169_234_1379 327
194 3300049572 Ga0501036_0364036 Ga0501036_0364036_20_1072 328
195 3300049581 Ga0501047_0020495 Ga0501047_0020495_189_1331 328
196 3300049586 Ga0501070_0158494 Ga0501070_0158494_381_1523 328
197 3300049744 Ga0501083_0158264 Ga0501083_0158264_62_1216 330
198 3300049574 Ga0501038_0176593 Ga0501038_0176593_35_1177 331
199 3300049822 Ga0501035_0060482 Ga0501035_0060482_1811_2953 331
200 3300049823 Ga0501044_0076337 Ga0501044_0076337_494_1636 331
201 3300005329 Ga0070683_100036908 Ga0070683_1000369083 333
202 3300005338 Ga0068868_100033960 Ga0068868_1000339602 333
203 3300005339 Ga0070660_100033991 Ga0070660_1000339912 333
204 3300005344 Ga0070661_100009438 Ga0070661_1000094383 333
205 3300005345 Ga0070692_10026720 Ga0070692_100267202 333
206 3300005366 Ga0070659_100020158 Ga0070659_1000201585 333
207 3300005434 Ga0070709_10061870 Ga0070709_100618702 333
208 3300005440 Ga0070705_100010953 Ga0070705_1000109532 333
209 3300005444 Ga0070694_100015830 Ga0070694_1000158303 333
210 3300005518 Ga0070699_100022222 Ga0070699_1000222223 333
211 3300005530 Ga0070679_100038208 Ga0070679_1000382083 333
212 3300005535 Ga0070684_100017058 Ga0070684_1000170583 333
213 3300005536 Ga0070697_100016546 Ga0070697_1000165463 333
214 3300005545 Ga0070695_100005747 Ga0070695_1000057472 333
215 3300005546 Ga0070696_100023628 Ga0070696_1000236283 333
216 3300005549 Ga0070704_100189886 Ga0070704_1001898862 333
217 3300005578 Ga0068854_100025183 Ga0068854_1000251833 333
218 3300005616 Ga0068852_100030078 Ga0068852_1000300782 333
219 3300009093 Ga0105240_10135227 Ga0105240_101352272 333
220 3300009551 Ga0105238_10121488 Ga0105238_101214882 333
221 3300013102 Ga0157371_10110555 Ga0157371_101105552 333
222 3300013104 Ga0157370_10026655 Ga0157370_100266555 333
223 3300025906 Ga0207699_10108194 Ga0207699_101081942 333
224 3300025910 Ga0207684_10033492 Ga0207684_100334922 333
225 3300025911 Ga0207654_10004312 Ga0207654_100043124 333
226 3300025917 Ga0207660_10123786 Ga0207660_101237861 333
227 3300025919 Ga0207657_10004018 Ga0207657_100040184 333
228 3300025921 Ga0207652_10015423 Ga0207652_100154235 333
229 3300026023 Ga0207677_10029584 Ga0207677_100295844 333
230 3300026116 Ga0207674_10014843 Ga0207674_100148436 333
231 3300035170 Ga0373943_0033098 Ga0373943_0033098_457_1584 333
232 3300048905 Ga0496102_0011937 Ga0496102_0011937_1382_2527 333
233 3300048909 Ga0496106_0069303 Ga0496106_0069303_922_2067 333
234 3300048915 Ga0496112_0124275 Ga0496112_0124275_1366_2511 333
235 3300050512 nmdc:mga0n895_191062_c1 nmdc:mga0n895_191062_c1_256_1401 333
236 3300005468 Ga0070707_100031265 Ga0070707_1000312653 334
237 3300006914 Ga0075436_100019016 Ga0075436_1000190164 334
238 3300037418 Ga0395900_0262605 Ga0395900_0262605_188_1342 334
239 3300037471 Ga0395905_0005168 Ga0395905_0005168_11969_13024 334
240 3300049581 Ga0501047_0242429 Ga0501047_0242429_11_1105 334
241 3300050514 nmdc:mga08x19_45651_c1 nmdc:mga08x19_45651_c1_758_1867 334
242 3300005327 Ga0070658_10068697 Ga0070658_100686972 336
243 3300011119 Ga0105246_10097819 Ga0105246_100978192 336
244 3300035111 Ga0373923_0021739 Ga0373923_0021739_1284_2450 336
245 3300035117 Ga0373953_0002065 Ga0373953_0002065_1434_2600 336
246 3300035118 Ga0373954_0009183 Ga0373954_0009183_1624_2790 336
247 3300035119 Ga0373956_0006326 Ga0373956_0006326_2094_3260 336
248 3300035172 Ga0373955_0008460 Ga0373955_0008460_1293_2459 336
249 3300035724 Ga0373933_0012221 Ga0373933_0012221_1484_2650 336
250 3300036401 Ga0373937_0028653 Ga0373937_0028653_1568_2734 336
251 3300037068 Ga0373925_0218660 Ga0373925_0218660_398_1501 336
252 3300046511 Ga0495608_0010400 Ga0495608_0010400_2094_3260 336
253 3300046514 Ga0495618_0011734 Ga0495618_0011734_1847_3013 336
254 3300046517 Ga0495630_0025880 Ga0495630_0025880_1560_2726 336
255 3300046535 Ga0495586_0006225 Ga0495586_0006225_3119_4285 336
256 3300046559 Ga0495667_0016751 Ga0495667_0016751_2094_3260 336
257 3300047317 Ga0495604_0022595 Ga0495604_0022595_2094_3260 336
258 3300047322 Ga0495680_0044134 Ga0495680_0044134_1431_2597 336
259 3300047471 Ga0495684_0020748 Ga0495684_0020748_1658_2824 336
260 3300048905 Ga0496102_0166516 Ga0496102_0166516_206_1333 336
261 3300048912 Ga0496109_0316525 Ga0496109_0316525_132_1259 336
262 3300049579 Ga0501043_0000009 Ga0501043_0000009_206578_207639 336
263 3300049580 Ga0501046_0000022 Ga0501046_0000022_206567_207628 336
264 3300049581 Ga0501047_0000021 Ga0501047_0000021_206625_207686 336
265 3300049582 Ga0501048_0003510 Ga0501048_0003510_3034_4095 336
266 3300053085 Ga0495619_0042548 Ga0495619_0042548_1492_2658 336
267 3300005344 Ga0070661_100036305 Ga0070661_1000363052 337
268 3300005564 Ga0070664_100028464 Ga0070664_1000284643 337
269 3300005616 Ga0068852_100137041 Ga0068852_1001370411 337
270 3300005834 Ga0068851_10049004 Ga0068851_100490042 337
271 3300013105 Ga0157369_10052019 Ga0157369_100520193 337
272 3300013307 Ga0157372_10243311 Ga0157372_102433112 337
273 3300025920 Ga0207649_10039934 Ga0207649_100399342 337
274 3300060353 Ga0501082_0077085 Ga0501082_0077085_490_1644 337
275 3300035172 Ga0373955_0026361 Ga0373955_0026361_757_1884 338
276 3300035410 Ga0373924_0006601 Ga0373924_0006601_583_1728 338
277 3300036401 Ga0373937_0032018 Ga0373937_0032018_1040_2167 338
278 3300037068 Ga0373925_0233943 Ga0373925_0233943_214_1341 338
279 3300046454 Ga0495592_0063538 Ga0495592_0063538_381_1508 338
280 3300046462 Ga0495651_0007571 Ga0495651_0007571_4389_5516 338
281 3300046463 Ga0495653_0007240 Ga0495653_0007240_2158_3285 338
282 3300046477 Ga0495664_0033125 Ga0495664_0033125_1726_2853 338
283 3300046511 Ga0495608_0016080 Ga0495608_0016080_1517_2644 338
284 3300046516 Ga0495628_0023409 Ga0495628_0023409_1582_2709 338
285 3300046517 Ga0495630_0018764 Ga0495630_0018764_1550_2677 338
286 3300046529 Ga0495652_0036330 Ga0495652_0036330_2802_3929 338
287 3300046533 Ga0495640_0014254 Ga0495640_0014254_2940_4067 338
288 3300046536 Ga0495587_0002421 Ga0495587_0002421_4993_6120 338
289 3300046543 Ga0495645_0005680 Ga0495645_0005680_2590_3717 338
290 3300046559 Ga0495667_0000293 Ga0495667_0000293_13491_14618 338
291 3300046642 Ga0495634_0026307 Ga0495634_0026307_2012_3139 338
292 3300046663 Ga0495635_0037690 Ga0495635_0037690_1614_2741 338
293 3300046679 Ga0495623_0018229 Ga0495623_0018229_1738_2865 338
294 3300046680 Ga0495646_0001995 Ga0495646_0001995_8551_9678 338
295 3300046689 Ga0495613_0061734 Ga0495613_0061734_1520_2647 338
296 3300046809 Ga0495600_0032156 Ga0495600_0032156_1427_2554 338
297 3300047317 Ga0495604_0003730 Ga0495604_0003730_2582_3709 338
298 3300047319 Ga0495674_0001748 Ga0495674_0001748_17675_18802 338
299 3300047322 Ga0495680_0003160 Ga0495680_0003160_11121_12248 338
300 3300047444 Ga0495675_0013454 Ga0495675_0013454_2625_3752 338
301 3300048088 Ga0495602_0003569 Ga0495602_0003569_2600_3727 338
302 3300049581 Ga0501047_0067747 Ga0501047_0067747_101_1222 338
303 3300049586 Ga0501070_0031620 Ga0501070_0031620_1155_2276 338
304 3300049589 Ga0501073_0042997 Ga0501073_0042997_636_1757 338
305 3300049742 Ga0501080_0010364 Ga0501080_0010364_4912_6033 338
306 3300049742 Ga0501080_0285865 Ga0501080_0285865_306_1451 338
307 3300049744 Ga0501083_0112604 Ga0501083_0112604_551_1672 338
308 3300049822 Ga0501035_0068818 Ga0501035_0068818_37_1158 338
309 3300053077 Ga0495601_0023907 Ga0495601_0023907_2605_3732 338
310 3300053078 Ga0495612_0002196 Ga0495612_0002196_5849_6976 338
311 3300053084 Ga0495595_0001285 Ga0495595_0001285_1623_2750 338
312 3300053085 Ga0495619_0008116 Ga0495619_0008116_5163_6290 338
313 3300005983 Ga0081540_1009885 Ga0081540_10098855 339
314 3300005564 Ga0070664_100016817 Ga0070664_1000168172 340
315 iso_pu_bacteria 8004445564 8004451291 340
316 3300005334 Ga0068869_100269756 Ga0068869_1002697562 341
317 3300006237 Ga0097621_100035711 Ga0097621_1000357112 341
318 3300006358 Ga0068871_100021589 Ga0068871_1000215892 341
319 3300046454 Ga0495592_0066301 Ga0495592_0066301_1254_2378 341
320 3300046516 Ga0495628_0227203 Ga0495628_0227203_136_1260 341
321 3300046536 Ga0495587_0034279 Ga0495587_0034279_1798_2922 341
322 3300046543 Ga0495645_0004831 Ga0495645_0004831_5916_7040 341
323 3300046663 Ga0495635_0063114 Ga0495635_0063114_1179_2303 341
324 3300046675 Ga0495657_0027802 Ga0495657_0027802_723_1847 341
325 3300046679 Ga0495623_0073494 Ga0495623_0073494_65_1189 341
326 3300049588 Ga0501072_0004295 Ga0501072_0004295_5747_6877 341
327 3300053077 Ga0495601_0004409 Ga0495601_0004409_5004_6128 341
328 3300053085 Ga0495619_0017076 Ga0495619_0017076_3213_4337 341
329 3300054114 Ga0501084_0253460 Ga0501084_0253460_220_1350 341
330 iso_pu_bacteria 2847670302 2847675386 342
331 iso_pu_bacteria 2878035449 2878042617 342
332 3300026078 Ga0207702_10181386 Ga0207702_101813861 343
333 3300035118 Ga0373954_0000001 Ga0373954_0000001_125007_126149 343
334 3300035172 Ga0373955_0018192 Ga0373955_0018192_1703_2845 343
335 3300036401 Ga0373937_0005181 Ga0373937_0005181_7346_8488 343
336 3300037312 Ga0395899_0001564 Ga0395899_0001564_14984_16078 343
337 3300037418 Ga0395900_0018529 Ga0395900_0018529_3375_4469 343
338 3300037466 Ga0395898_0003262 Ga0395898_0003262_2435_3529 343
339 3300037471 Ga0395905_0000126 Ga0395905_0000126_18281_19375 343
340 3300037471 Ga0395905_0017017 Ga0395905_0017017_156_1250 343
341 3300037471 Ga0395905_0041120 Ga0395905_0041120_2076_3170 343
342 3300038443 Ga0395901_0069291 Ga0395901_0069291_1773_2867 343
343 3300049586 Ga0501070_0069169 Ga0501070_0069169_15_1157 344
344 3300005614 Ga0068856_100058259 Ga0068856_1000582592 345
345 3300025949 Ga0207667_10286994 Ga0207667_102869942 345
346 3300049590 Ga0501074_0006077 Ga0501074_0006077_2046_3179 345
347 3300005331 Ga0070670_100040336 Ga0070670_1000403363 346
348 3300005338 Ga0068868_100208250 Ga0068868_1002082501 346
349 3300005344 Ga0070661_100001831 Ga0070661_1000018317 346
350 3300005456 Ga0070678_100208449 Ga0070678_1002084491 346
351 3300005564 Ga0070664_100009647 Ga0070664_1000096472 346
352 3300005616 Ga0068852_100002065 Ga0068852_1000020651 346
353 3300005834 Ga0068851_10002317 Ga0068851_100023179 346
354 3300006237 Ga0097621_100303583 Ga0097621_1003035832 346
355 3300013105 Ga0157369_10111519 Ga0157369_101115192 346
356 3300013307 Ga0157372_10133216 Ga0157372_101332162 346
357 3300025321 Ga0207656_10014690 Ga0207656_100146902 346
358 3300025903 Ga0207680_10048735 Ga0207680_100487352 346
359 3300025909 Ga0207705_10118089 Ga0207705_101180892 346
360 3300025920 Ga0207649_10117885 Ga0207649_101178852 346
361 3300025932 Ga0207690_10090755 Ga0207690_100907551 346
362 3300025945 Ga0207679_10009854 Ga0207679_100098541 346
363 3300025981 Ga0207640_10082952 Ga0207640_100829521 346
364 3300026142 Ga0207698_10095682 Ga0207698_100956822 346
365 3300049823 Ga0501044_0257803 Ga0501044_0257803_561_1655 346
366 iso_pu_bacteria 2513237094 2513643176 346
367 iso_pu_bacteria 2643221651 2644287152 346
368 3300046543 Ga0495645_0010684 Ga0495645_0010684_3149_4249 347
369 iso_pu_bacteria 2599185301 2599940885 348
370 iso_pu_bacteria 2847686936 2847692002 348
371 iso_pu_bacteria 2856314179 2856320307 348
372 iso_pu_bacteria 2871444079 2871446624 348
373 iso_pu_bacteria 2874102143 2874103760 348
374 iso_pu_bacteria 2874123672 2874127119 348
375 iso_pu_bacteria 2876369609 2876371127 348
376 iso_pu_bacteria 2881147464 2881149372 348
377 iso_pu_bacteria 2888350351 2888354510 348
378 iso_pu_bacteria 2906328253 2906330261 348
379 iso_pu_bacteria 2906414383 2906420913 348
380 iso_pu_bacteria 2906626472 2906634842 348
381 iso_pu_bacteria 2922130491 2922132073 348
382 iso_pu_bacteria 2922158528 2922165267 348
383 iso_pu_bacteria 2924726620 2924727541 348
384 iso_pu_bacteria 2937891427 2937893881 348
385 iso_pu_bacteria 2958115193 2958118208 348
386 iso_pu_bacteria 2965062239 2965066409 348
387 iso_pu_bacteria 2968091066 2968092112 348
388 iso_pu_bacteria 2968097103 2968098614 348
389 iso_pu_bacteria 2968128360 2968130766 348
390 iso_pu_bacteria 2977858184 2977860599 348
391 iso_pu_bacteria 2979742915 2979750839 348
392 iso_pu_bacteria 2979779861 2979782498 348
393 iso_pu_bacteria 2996341866 2996346521 348
394 iso_pu_bacteria 8004703790 8004709111 348
395 3300005366 Ga0070659_100168536 Ga0070659_1001685362 349
396 3300005539 Ga0068853_100183987 Ga0068853_1001839872 349
397 3300013105 Ga0157369_10013944 Ga0157369_100139449 349
398 3300025919 Ga0207657_10193448 Ga0207657_101934482 349
399 3300025949 Ga0207667_10274172 Ga0207667_102741722 349
400 3300026142 Ga0207698_10294985 Ga0207698_102949852 349
401 iso_pu_bacteria 2791355082 2792584770 349
402 iso_pu_bacteria 2802429268 2804755278 349
403 iso_pu_bacteria 2913295892 2913296021 349
404 iso_pu_bacteria 8049293176 8049297900 349
405 3300005327 Ga0070658_10080380 Ga0070658_100803802 350
406 3300005366 Ga0070659_100115143 Ga0070659_1001151432 350
407 3300005563 Ga0068855_100022311 Ga0068855_1000223114 350
408 3300005616 Ga0068852_100007728 Ga0068852_1000077283 350
409 3300009551 Ga0105238_10016630 Ga0105238_100166303 350
410 3300013104 Ga0157370_10153070 Ga0157370_101530702 350
411 3300013105 Ga0157369_10002022 Ga0157369_100020227 350
412 3300013296 Ga0157374_10104198 Ga0157374_101041982 350
413 3300013307 Ga0157372_10009509 Ga0157372_100095099 350
414 3300013307 Ga0157372_10298891 Ga0157372_102988912 350
415 3300025909 Ga0207705_10138788 Ga0207705_101387882 350
416 3300025913 Ga0207695_10038581 Ga0207695_100385814 350
417 3300025932 Ga0207690_10032515 Ga0207690_100325152 350
418 3300025932 Ga0207690_10151460 Ga0207690_101514602 350
419 3300025949 Ga0207667_10203916 Ga0207667_102039162 350
420 3300026142 Ga0207698_10021638 Ga0207698_100216384 350
421 3300035724 Ga0373933_0186966 Ga0373933_0186966_34_1155 351
422 3300046454 Ga0495592_0165457 Ga0495592_0165457_343_1464 351
423 3300046529 Ga0495652_0016901 Ga0495652_0016901_1456_2592 351
424 3300046543 Ga0495645_0000056 Ga0495645_0000056_38835_39971 351
425 3300046559 Ga0495667_0135517 Ga0495667_0135517_447_1568 351
426 3300046678 Ga0495599_0016654 Ga0495599_0016654_1388_2524 351
427 3300047471 Ga0495684_0055876 Ga0495684_0055876_240_1361 351
428 3300035695 Ga0373927_0010594 Ga0373927_0010594_412_1539 352
429 3300035725 Ga0373947_0039702 Ga0373947_0039702_275_1402 352
430 3300047321 Ga0495676_0059396 Ga0495676_0059396_316_1443 352
431 3300049579 Ga0501043_0020921 Ga0501043_0020921_2568_3692 352
432 3300049581 Ga0501047_0023869 Ga0501047_0023869_701_1825 352
433 iso_pu_bacteria 2965119406 2965123502 352
434 3300005336 Ga0070680_100034827 Ga0070680_1000348272 353
435 3300005530 Ga0070679_100035826 Ga0070679_1000358263 353
436 3300025917 Ga0207660_10118138 Ga0207660_101181381 353
437 3300025921 Ga0207652_10023700 Ga0207652_100237006 353
438 3300036712 Ga0316584_0010926 Ga0316584_0010926_1806_2945 353
439 3300049581 Ga0501047_0104367 Ga0501047_0104367_1371_2504 353
440 3300049586 Ga0501070_0000979 Ga0501070_0000979_22802_23935 353
441 3300049589 Ga0501073_0054936 Ga0501073_0054936_1585_2718 353
442 3300049741 Ga0501079_0008169 Ga0501079_0008169_1399_2532 353
443 3300049742 Ga0501080_0022597 Ga0501080_0022597_2800_3933 353
444 3300049823 Ga0501044_0298528 Ga0501044_0298528_341_1474 353
445 3300005339 Ga0070660_100017014 Ga0070660_1000170142 354
446 3300005458 Ga0070681_10089843 Ga0070681_100898432 354
447 3300005564 Ga0070664_100094650 Ga0070664_1000946502 354
448 3300013307 Ga0157372_10043976 Ga0157372_100439762 354
449 3300025912 Ga0207707_10033524 Ga0207707_100335243 354
450 3300025918 Ga0207662_10111683 Ga0207662_101116832 354
451 3300025919 Ga0207657_10005722 Ga0207657_1000572214 354
452 3300025921 Ga0207652_10184286 Ga0207652_101842862 354
453 3300025945 Ga0207679_10026327 Ga0207679_100263273 354
454 3300031852 Ga0307410_10015234 Ga0307410_100152344 354
455 3300035116 Ga0373945_0034565 Ga0373945_0034565_624_1745 354
456 3300035170 Ga0373943_0036182 Ga0373943_0036182_320_1441 354
457 3300035692 Ga0373935_0031819 Ga0373935_0031819_1594_2715 354
458 3300035695 Ga0373927_0127253 Ga0373927_0127253_29_1150 354
459 3300035725 Ga0373947_0041584 Ga0373947_0041584_1028_2149 354
460 3300036401 Ga0373937_0020151 Ga0373937_0020151_3381_4502 354
461 3300037068 Ga0373925_0010065 Ga0373925_0010065_3396_4517 354
462 3300037068 Ga0373925_0033237 Ga0373925_0033237_1981_3123 354
463 3300037068 Ga0373925_0149014 Ga0373925_0149014_169_1293 354
464 3300046459 Ga0495629_0020556 Ga0495629_0020556_3066_4187 354
465 3300046463 Ga0495653_0203989 Ga0495653_0203989_76_1197 354
466 3300046473 Ga0495582_0003184 Ga0495582_0003184_2585_3706 354
467 3300046531 Ga0495665_0011441 Ga0495665_0011441_859_1980 354
468 3300046663 Ga0495635_0168396 Ga0495635_0168396_268_1389 354
469 3300046681 Ga0495647_0002608 Ga0495647_0002608_3033_4154 354
470 3300046683 Ga0495658_0013527 Ga0495658_0013527_1848_2969 354
471 3300046689 Ga0495613_0078920 Ga0495613_0078920_55_1176 354
472 3300047315 Ga0495581_0001661 Ga0495581_0001661_5208_6329 354
473 3300047471 Ga0495684_0002788 Ga0495684_0002788_2584_3705 354
474 3300053078 Ga0495612_0102634 Ga0495612_0102634_52_1194 354
475 3300053085 Ga0495619_0007680 Ga0495619_0007680_1271_2392 354
476 3300005290 Ga0065712_10074754 Ga0065712_100747543 355
477 3300005293 Ga0065715_10097391 Ga0065715_100973912 355
478 3300005328 Ga0070676_10060667 Ga0070676_100606672 355
479 3300005329 Ga0070683_100005874 Ga0070683_1000058747 355
480 3300005331 Ga0070670_100083451 Ga0070670_1000834512 355
481 3300005333 Ga0070677_10024137 Ga0070677_100241372 355
482 3300005334 Ga0068869_100001503 Ga0068869_1000015035 355
483 3300005339 Ga0070660_100001424 Ga0070660_1000014245 355
484 3300005340 Ga0070689_100011227 Ga0070689_1000112272 355
485 3300005344 Ga0070661_100003536 Ga0070661_1000035368 355
486 3300005344 Ga0070661_100054690 Ga0070661_1000546902 355
487 3300005353 Ga0070669_100054090 Ga0070669_1000540902 355
488 3300005353 Ga0070669_100094003 Ga0070669_1000940031 355
489 3300005354 Ga0070675_100059524 Ga0070675_1000595242 355
490 3300005354 Ga0070675_100061771 Ga0070675_1000617712 355
491 3300005355 Ga0070671_100337845 Ga0070671_1003378451 355
492 3300005364 Ga0070673_100017633 Ga0070673_1000176332 355
493 3300005366 Ga0070659_100028613 Ga0070659_1000286133 355
494 3300005367 Ga0070667_100044467 Ga0070667_1000444674 355
495 3300005441 Ga0070700_100055462 Ga0070700_1000554621 355
496 3300005455 Ga0070663_100121082 Ga0070663_1001210822 355
497 3300005457 Ga0070662_100000836 Ga0070662_1000008364 355
498 3300005466 Ga0070685_10001881 Ga0070685_100018815 355
499 3300005543 Ga0070672_100034784 Ga0070672_1000347842 355
500 3300005563 Ga0068855_100002546 Ga0068855_1000025463 355
501 3300005563 Ga0068855_100341898 Ga0068855_1003418982 355
502 3300005564 Ga0070664_100151243 Ga0070664_1001512432 355
503 3300005578 Ga0068854_100100417 Ga0068854_1001004172 355
504 3300005614 Ga0068856_100001602 Ga0068856_1000016025 355
505 3300005616 Ga0068852_100028380 Ga0068852_1000283803 355
506 3300005617 Ga0068859_100043553 Ga0068859_1000435535 355
507 3300005719 Ga0068861_100064739 Ga0068861_1000647392 355
508 3300005834 Ga0068851_10010765 Ga0068851_100107652 355
509 3300005841 Ga0068863_100010980 Ga0068863_1000109808 355
510 3300005842 Ga0068858_100062480 Ga0068858_1000624802 355
511 3300005844 Ga0068862_100013593 Ga0068862_1000135936 355
512 3300006358 Ga0068871_100192063 Ga0068871_1001920632 355
513 3300006881 Ga0068865_100005114 Ga0068865_1000051145 355
514 3300006931 Ga0097620_100043554 Ga0097620_1000435545 355
515 3300009093 Ga0105240_10170468 Ga0105240_101704682 355
516 3300009094 Ga0111539_10022960 Ga0111539_100229606 355
517 3300009148 Ga0105243_10240364 Ga0105243_102403641 355
518 3300013100 Ga0157373_10000924 Ga0157373_100009243 355
519 3300013102 Ga0157371_10000522 Ga0157371_1000052220 355
520 3300013104 Ga0157370_10019308 Ga0157370_100193088 355
521 3300013297 Ga0157378_10157456 Ga0157378_101574562 355
522 3300013306 Ga0163162_10048954 Ga0163162_100489542 355
523 3300013307 Ga0157372_10000791 Ga0157372_100007917 355
524 3300013307 Ga0157372_10212922 Ga0157372_102129221 355
525 3300014968 Ga0157379_10009512 Ga0157379_100095125 355
526 3300025315 Ga0207697_10000450 Ga0207697_1000045014 355
527 3300025321 Ga0207656_10005762 Ga0207656_100057622 355
528 3300025901 Ga0207688_10010358 Ga0207688_100103584 355
529 3300025907 Ga0207645_10001587 Ga0207645_100015879 355
530 3300025908 Ga0207643_10000429 Ga0207643_1000042914 355
531 3300025913 Ga0207695_10070564 Ga0207695_100705642 355
532 3300025918 Ga0207662_10022596 Ga0207662_100225962 355
533 3300025919 Ga0207657_10000657 Ga0207657_1000065730 355
534 3300025920 Ga0207649_10007402 Ga0207649_100074026 355
535 3300025920 Ga0207649_10032774 Ga0207649_100327742 355
536 3300025923 Ga0207681_10016827 Ga0207681_100168272 355
537 3300025925 Ga0207650_10000503 Ga0207650_1000050313 355
538 3300025926 Ga0207659_10001307 Ga0207659_1000130710 355
539 3300025932 Ga0207690_10000412 Ga0207690_1000041226 355
540 3300025933 Ga0207706_10000164 Ga0207706_1000016430 355
541 3300025933 Ga0207706_10066056 Ga0207706_100660562 355
542 3300025936 Ga0207670_10003032 Ga0207670_100030328 355
543 3300025940 Ga0207691_10071179 Ga0207691_100711792 355
544 3300025942 Ga0207689_10003889 Ga0207689_100038892 355
545 3300025944 Ga0207661_10157323 Ga0207661_101573231 355
546 3300025945 Ga0207679_10000601 Ga0207679_1000060118 355
547 3300025945 Ga0207679_10052132 Ga0207679_100521322 355
548 3300025949 Ga0207667_10003052 Ga0207667_100030525 355
549 3300025949 Ga0207667_10250929 Ga0207667_102509292 355
550 3300025960 Ga0207651_10052331 Ga0207651_100523312 355
551 3300025986 Ga0207658_10045089 Ga0207658_100450892 355
552 3300025986 Ga0207658_10064037 Ga0207658_100640372 355
553 3300026067 Ga0207678_10148156 Ga0207678_101481562 355
554 3300026067 Ga0207678_10163519 Ga0207678_101635192 355
555 3300026075 Ga0207708_10057134 Ga0207708_100571342 355
556 3300026078 Ga0207702_10001837 Ga0207702_1000183711 355
557 3300026089 Ga0207648_10068279 Ga0207648_100682791 355
558 3300026095 Ga0207676_10049890 Ga0207676_100498902 355
559 3300026118 Ga0207675_100004233 Ga0207675_10000423311 355
560 3300026142 Ga0207698_10007413 Ga0207698_100074135 355
561 3300026142 Ga0207698_10027156 Ga0207698_100271562 355
562 3300027876 Ga0209974_10004530 Ga0209974_100045306 355
563 3300028381 Ga0268264_10162997 Ga0268264_101629972 355
564 3300035116 Ga0373945_0043741 Ga0373945_0043741_195_1322 355
565 3300035410 Ga0373924_0000883 Ga0373924_0000883_3344_4468 355
566 3300035725 Ga0373947_0015771 Ga0373947_0015771_126_1253 355
567 3300037068 Ga0373925_0025023 Ga0373925_0025023_2064_3191 355
568 3300048904 Ga0496101_0009607 Ga0496101_0009607_1027_2154 355
569 3300048905 Ga0496102_0028354 Ga0496102_0028354_890_2011 355
570 3300048907 Ga0496104_0091398 Ga0496104_0091398_930_2057 355
571 3300048908 Ga0496105_0062729 Ga0496105_0062729_552_1679 355
572 3300048909 Ga0496106_0005422 Ga0496106_0005422_1425_2546 355
573 3300048909 Ga0496106_0173454 Ga0496106_0173454_492_1619 355
574 3300048910 Ga0496107_0038768 Ga0496107_0038768_1136_2257 355
575 3300048912 Ga0496109_0101135 Ga0496109_0101135_666_1793 355
576 3300048913 Ga0496110_0034960 Ga0496110_0034960_236_1363 355
577 3300050511 nmdc:mga08y16_332360_c1 nmdc:mga08y16_332360_c1_423_1550 355

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04290

DctQ

Tripartite ATP-independent periplasmic transporters, DctQ component

250

383

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
2rmk-assembly1.cif.gz_B rac1/prk1 complex 0.8047 79 152
4i9q-assembly2.cif.gz_B crystal structure of the ternary complex of the d714a mutant of rb69 dna polymerase 0.7244 82 154
2rmk-assembly1.cif.gz_B rac1/prk1 complex 0.7025 79 152
2zdi-assembly1.cif.gz_B-2 crystal structure of prefoldin from pyrococcus horikoshii ot3 0.6725 72 160
6vjf-assembly2.cif.gz_C the p-loop k to a mutation of c. therm vps1 gtpase-bse 0.6412 67 142
ID Description Score Start End Superfamily
2rmkB00 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;HR1 repeat 0.8047 79 152 1.10.287.160
5x60A03 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;ATP synthase, gamma subunit, helix hairpin domain 0.7718 71 156 1.10.287.80
2x0lA03 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;ATP synthase, gamma subunit, helix hairpin domain 0.7662 71 156 1.10.287.80
5h6rA03 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;ATP synthase, gamma subunit, helix hairpin domain 0.7638 71 156 1.10.287.80
5lhhA03 Mainly Alpha;Orthogonal Bundle;Helix Hairpins;ATP synthase, gamma subunit, helix hairpin domain 0.7614 71 156 1.10.287.80
ID Description Score Start End GO Terms
AF-H9ZS63-F1-model_v4 TRAP-type mannitol/chloroaromatic compound transport system, small permease component 0.896 193 355 GO:0005886
AF-A0A1V5DVT7-F1-model_v4 2,3-diketo-L-gulonate TRAP transporter small permease protein YiaM 0.8918 193 354 GO:0005886
AF-A0A661RPS1-F1-model_v4 Transporter 0.8907 193 350 GO:0005886
AF-A0A1J5DU15-F1-model_v4 C4-dicarboxylate ABC transporter substrate-binding protein 0.8905 193 350 GO:0005886
AF-A0A1H0SP04-F1-model_v4 TRAP-type mannitol/chloroaromatic compound transport system, small permease component 0.887 193 354 GO:0005886

Feature Viewer

pLDDT pTM Quality
76.58 0.56 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map