F465614
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 577 | 288 | 540 | 355 |
Family's Representative Sequence
| Representative Sequence | 3300013306|Ga0163162_10048954|Ga0163162_100489542 |
| Length | 389 |
| Sequence | MLRRPATAAAAHGCAHMPSLTFVMPHWLYWAGLLLFPLIATYLVRRQLKHAPDARPSLFIAYLFWLCSGFLGIHRFYLRSGLGFAFIPVFLFVIYCNAQVREVRDDTSRTFAALEQAQHAADIAKPSETNPTPEATAQYERAQADVKKMQAEFDVAKAVTDSWNARARWGAIVLAIMLLADAVLMPTLVRRQRKHESATPHRPIAEPPPVVAEPVLAEDPTLHFHSRFTDFIEMINVKAGEYVAWWSLIAVFVYYYEVLARFVFNSPTNWVHESMFLMFGMQYMLSGAYAYREDQHVRVDVIYAKFSPRGKAIADIITSVFFFIFIGTMLVTGYRFAADAVNVGEHSFTEWGIQYWPVKLAIPIGAALLLLQGVAKLIKDILFVSRRGA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2513237094 | Bradyrhizobium sp. WSM3983 | Isolate | Nodule |
| 2 | 2599185301 | Mesorhizobium sp. NFR06 | Isolate | Rhizoplane |
| 3 | 2643221651 | Afipia sp. Root123D2 | Isolate | Unclassified |
| 4 | 2791355082 | Ensifer alkalisoli YIC4027 | Isolate | Nodule |
| 5 | 2802429268 | Sinorhizobium sojae CCBAU 05684 | Isolate | Unclassified |
| 6 | 2847670302 | Mesorhizobium sp. M3A.F.Ca.ET.080.04.2.1 | Isolate | Nodule |
| 7 | 2847686936 | Mesorhizobium sp. M1A.F.Ca.IN.022.06.1.1 | Isolate | Nodule |
| 8 | 2856314179 | Mesorhizobium sp. M3A.F.Ca.ET.175.01.1.1 | Isolate | Nodule |
| 9 | 2871444079 | Mesorhizobium sp. M1A.F.Ca.IN.020.06.1.1 | Isolate | Nodule |
| 10 | 2874102143 | Mesorhizobium sp. M1A.F.Ca.IN.022.04.1.1 | Isolate | Nodule |
| 11 | 2874123672 | Mesorhizobium sp. M00.F.Ca.ET.216.01.1.1 | Isolate | Nodule |
| 12 | 2876369609 | Mesorhizobium sp. USDA-HM6 | Isolate | Unclassified |
| 13 | 2878035449 | Mesorhizobium sp. M3A.F.Ca.ET.201.01.1.1 | Isolate | Nodule |
| 14 | 2881147464 | Mesorhizobium sp. M1B.F.Ca.ET.045.04.1.1 | Isolate | Nodule |
| 15 | 2885326080 | Mesorhizobium sp. M1E.F.Ca.ET.041.01.1.1 | Isolate | Nodule |
| 16 | 2888350351 | Mesorhizobium sp. M2A.F.Ca.ET.046.03.2.1 | Isolate | Nodule |
| 17 | 2906328253 | Mesorhizobium sp. M1A.T.Ca.IN.004.03.1.1 | Isolate | Nodule |
| 18 | 2906414383 | Mesorhizobium sp. M3A.F.Ca.ET.174.01.1.1 | Isolate | Nodule |
| 19 | 2906626472 | Bradyrhizobium hipponense aSej3 | Isolate | Unclassified |
| 20 | 2913295892 | Sinorhizobium kostiensis DSM 13372 | Isolate | Nodule |
| 21 | 2922130491 | Mesorhizobium sp. M00.F.Ca.ET.038.03.1.1 | Isolate | Nodule |
| 22 | 2922158528 | Mesorhizobium sp. M1A.F.Ca.IN.022.05.2.1 | Isolate | Nodule |
| 23 | 2924726620 | Mesorhizobium sp. M1A.F.Ca.IN.020.03.2.1 | Isolate | Nodule |
| 24 | 2937891427 | Mesorhizobium sp. M1A.F.Ca.IN.022.07.1.1 | Isolate | Nodule |
| 25 | 2958115193 | Mesorhizobium sp. M00.F.Ca.ET.217.01.1.1 | Isolate | Nodule |
| 26 | 2965062239 | Mesorhizobium sp. M1A.F.Ca.ET.072.01.1.1 | Isolate | Nodule |
| 27 | 2965119406 | Mesorhizobium sp. M2A.F.Ca.ET.067.02.1.1 | Isolate | Nodule |
| 28 | 2968091066 | Mesorhizobium sp. AA23 | Isolate | Unclassified |
| 29 | 2968097103 | Mesorhizobium sp. M1A.F.Ca.IN.020.30.1.1 | Isolate | Nodule |
| 30 | 2968128360 | Mesorhizobium sp. WSM3873 | Isolate | Unclassified |
| 31 | 2977858184 | Mesorhizobium sp. M1A.F.Ca.IN.020.03.1.1 | Isolate | Nodule |
| 32 | 2979742915 | Mesorhizobium sp. M2A.F.Ca.ET.046.02.1.1 | Isolate | Nodule |
| 33 | 2979779861 | Mesorhizobium sp. M1A.F.Ca.IN.022.02.1.1 | Isolate | Nodule |
| 34 | 2996341866 | Mesorhizobium sp. M1A.F.Ca.IN.020.32.1.1 | Isolate | Nodule |
| 35 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 36 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 37 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 40 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 41 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 44 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 46 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 47 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 48 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 50 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 52 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 57 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 60 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 63 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 64 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 68 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 69 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 70 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 71 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 72 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 73 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 74 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 75 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 76 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 77 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 78 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 79 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 80 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 81 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 82 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 83 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 84 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 85 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 86 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 87 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 88 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 89 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 90 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 91 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 92 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 93 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 94 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 95 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 96 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 97 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 98 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 99 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 101 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 102 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 103 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 109 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 111 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 112 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 113 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 114 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 126 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 127 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 182 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 183 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 184 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 185 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 186 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 187 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 188 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 189 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 190 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 191 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 192 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 193 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 194 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 195 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 196 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 197 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 198 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 199 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 200 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 201 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 202 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 203 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 204 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 205 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 206 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 207 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 208 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 209 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 250 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 251 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 252 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 253 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 254 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 255 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 256 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 257 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 258 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 259 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 260 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 261 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 262 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 263 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 264 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 265 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 266 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 267 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 268 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 269 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 270 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 271 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 272 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 273 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 274 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 275 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 276 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 277 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 278 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 279 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 280 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 285 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 286 | 8004445564 | Mesorhizobium sp. M1A.F.Ca.IN.020.04.1.1 | Isolate | Nodule |
| 287 | 8004703790 | Mesorhizobium sp. M00.F.Ca.ET.158.01.1.1 | Isolate | Nodule |
| 288 | 8049293176 | Ensifer alkalisoli YIC4027 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 93.59 |
| Metatranscriptomes | 0 |
| Isolates | 6.41 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 5.2 |
| Rhizoplane | 3.12 |
| Rhizosphere | 90.64 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 1.04 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0065712_10074754 | 3300005290 | Bacteria | 4018 |
| 2 | Ga0065715_10097391 | 3300005293 | Bacteria | 3713 |
| 3 | Ga0070658_10009579 | 3300005327 | Bacteria | 7776 |
| 4 | Ga0070658_10068697 | 3300005327 | Bacteria | 2897 |
| 5 | Ga0070658_10080380 | 3300005327 | Bacteria | 2678 |
| 6 | Ga0070676_10060667 | 3300005328 | Bacteria | 2247 |
| 7 | Ga0070683_100005874 | 3300005329 | Bacteria | 10272 |
| 8 | Ga0070683_100022132 | 3300005329 | Bacteria | 5678 |
| 9 | Ga0070683_100036908 | 3300005329 | Bacteria | 4471 |
| 10 | Ga0070690_100010980 | 3300005330 | Bacteria | 5288 |
| 11 | Ga0070690_100128128 | 3300005330 | Bacteria | 1711 |
| 12 | Ga0070670_100040336 | 3300005331 | Bacteria | 4015 |
| 13 | Ga0070670_100083451 | 3300005331 | Bacteria | 2745 |
| 14 | Ga0070677_10024137 | 3300005333 | Bacteria | 2258 |
| 15 | Ga0068869_100001503 | 3300005334 | Bacteria | 13819 |
| 16 | Ga0068869_100106122 | 3300005334 | Bacteria | 2131 |
| 17 | Ga0068869_100269756 | 3300005334 | Bacteria | 1365 |
| 18 | Ga0070666_10006712 | 3300005335 | Bacteria | 7084 |
| 19 | Ga0070680_100010191 | 3300005336 | Bacteria | 7247 |
| 20 | Ga0070680_100034827 | 3300005336 | Bacteria | 4061 |
| 21 | Ga0070680_100094594 | 3300005336 | Bacteria | 2477 |
| 22 | Ga0070682_100141373 | 3300005337 | Bacteria | 1641 |
| 23 | Ga0068868_100033960 | 3300005338 | Bacteria | 3935 |
| 24 | Ga0068868_100208250 | 3300005338 | Bacteria | 1633 |
| 25 | Ga0070660_100001424 | 3300005339 | Bacteria | 16292 |
| 26 | Ga0070660_100006417 | 3300005339 | Bacteria | 8150 |
| 27 | Ga0070660_100017014 | 3300005339 | Bacteria | 5292 |
| 28 | Ga0070660_100033991 | 3300005339 | Bacteria | 3848 |
| 29 | Ga0070689_100011227 | 3300005340 | Bacteria | 6410 |
| 30 | Ga0070689_100070388 | 3300005340 | Bacteria | 2731 |
| 31 | Ga0070661_100001831 | 3300005344 | Bacteria | 14718 |
| 32 | Ga0070661_100003536 | 3300005344 | Bacteria | 10765 |
| 33 | Ga0070661_100007865 | 3300005344 | Bacteria | 7360 |
| 34 | Ga0070661_100009438 | 3300005344 | Bacteria | 6752 |
| 35 | Ga0070661_100012354 | 3300005344 | Bacteria | 5975 |
| 36 | Ga0070661_100036305 | 3300005344 | Bacteria | 3582 |
| 37 | Ga0070661_100054690 | 3300005344 | Bacteria | 2923 |
| 38 | Ga0070692_10026720 | 3300005345 | Bacteria | 2856 |
| 39 | Ga0070669_100054090 | 3300005353 | Bacteria | 2940 |
| 40 | Ga0070669_100094003 | 3300005353 | Bacteria | 2252 |
| 41 | Ga0070675_100059524 | 3300005354 | Bacteria | 3151 |
| 42 | Ga0070675_100061771 | 3300005354 | Bacteria | 3095 |
| 43 | Ga0070671_100016774 | 3300005355 | Bacteria | 5923 |
| 44 | Ga0070671_100337845 | 3300005355 | Bacteria | 1284 |
| 45 | Ga0070673_100017633 | 3300005364 | Bacteria | 5083 |
| 46 | Ga0070673_100040597 | 3300005364 | Bacteria | 3571 |
| 47 | Ga0070688_100014952 | 3300005365 | Bacteria | 4406 |
| 48 | Ga0070659_100020158 | 3300005366 | Bacteria | 5062 |
| 49 | Ga0070659_100023995 | 3300005366 | Bacteria | 4672 |
| 50 | Ga0070659_100028613 | 3300005366 | Bacteria | 4305 |
| 51 | Ga0070659_100115143 | 3300005366 | Bacteria | 2173 |
| 52 | Ga0070659_100168536 | 3300005366 | Bacteria | 1793 |
| 53 | Ga0070667_100028398 | 3300005367 | Bacteria | 4657 |
| 54 | Ga0070667_100044467 | 3300005367 | Bacteria | 3730 |
| 55 | Ga0070709_10061870 | 3300005434 | Bacteria | 2385 |
| 56 | Ga0070714_100013550 | 3300005435 | Bacteria | 6535 |
| 57 | Ga0070705_100010953 | 3300005440 | Bacteria | 4556 |
| 58 | Ga0070700_100055462 | 3300005441 | Bacteria | 2480 |
| 59 | Ga0070694_100015830 | 3300005444 | Bacteria | 4745 |
| 60 | Ga0070663_100014024 | 3300005455 | Bacteria | 5133 |
| 61 | Ga0070663_100121082 | 3300005455 | Bacteria | 1977 |
| 62 | Ga0070678_100003725 | 3300005456 | Bacteria | 8533 |
| 63 | Ga0070678_100208449 | 3300005456 | Bacteria | 1618 |
| 64 | Ga0070662_100000836 | 3300005457 | Bacteria | 18940 |
| 65 | Ga0070681_10002559 | 3300005458 | Bacteria | 16698 |
| 66 | Ga0070681_10047687 | 3300005458 | Bacteria | 4283 |
| 67 | Ga0070681_10089843 | 3300005458 | Bacteria | 3023 |
| 68 | Ga0070685_10001663 | 3300005466 | Bacteria | 11684 |
| 69 | Ga0070685_10001881 | 3300005466 | Bacteria | 10953 |
| 70 | Ga0070707_100031265 | 3300005468 | Bacteria | 5070 |
| 71 | Ga0070699_100022222 | 3300005518 | Bacteria | 5465 |
| 72 | Ga0070679_100002918 | 3300005530 | Bacteria | 15548 |
| 73 | Ga0070679_100025151 | 3300005530 | Bacteria | 5840 |
| 74 | Ga0070679_100035826 | 3300005530 | Bacteria | 4923 |
| 75 | Ga0070679_100038208 | 3300005530 | Bacteria | 4772 |
| 76 | Ga0070684_100010852 | 3300005535 | Bacteria | 7237 |
| 77 | Ga0070684_100017058 | 3300005535 | Bacteria | 5952 |
| 78 | Ga0070697_100016546 | 3300005536 | Bacteria | 5802 |
| 79 | Ga0068853_100013069 | 3300005539 | Bacteria | 6771 |
| 80 | Ga0068853_100104695 | 3300005539 | Bacteria | 2505 |
| 81 | Ga0068853_100109606 | 3300005539 | Bacteria | 2451 |
| 82 | Ga0068853_100183987 | 3300005539 | Bacteria | 1896 |
| 83 | Ga0070672_100034784 | 3300005543 | Bacteria | 3826 |
| 84 | Ga0070695_100005747 | 3300005545 | Bacteria | 7309 |
| 85 | Ga0070696_100016902 | 3300005546 | Bacteria | 4921 |
| 86 | Ga0070696_100023628 | 3300005546 | Bacteria | 4178 |
| 87 | Ga0070693_100002563 | 3300005547 | Bacteria | 8375 |
| 88 | Ga0070665_100082387 | 3300005548 | Bacteria | 3222 |
| 89 | Ga0070704_100189886 | 3300005549 | Bacteria | 1650 |
| 90 | Ga0068855_100002546 | 3300005563 | Bacteria | 22453 |
| 91 | Ga0068855_100022311 | 3300005563 | Bacteria | 7585 |
| 92 | Ga0068855_100059960 | 3300005563 | Bacteria | 4451 |
| 93 | Ga0068855_100341898 | 3300005563 | Bacteria | 1650 |
| 94 | Ga0070664_100008394 | 3300005564 | Bacteria | 8353 |
| 95 | Ga0070664_100009647 | 3300005564 | Bacteria | 7832 |
| 96 | Ga0070664_100016817 | 3300005564 | Bacteria | 6004 |
| 97 | Ga0070664_100028464 | 3300005564 | Bacteria | 4648 |
| 98 | Ga0070664_100065826 | 3300005564 | Bacteria | 3093 |
| 99 | Ga0070664_100094650 | 3300005564 | Bacteria | 2590 |
| 100 | Ga0070664_100151243 | 3300005564 | Bacteria | 2049 |
| 101 | Ga0068857_100004656 | 3300005577 | Bacteria | 11621 |
| 102 | Ga0068857_100122249 | 3300005577 | Bacteria | 2345 |
| 103 | Ga0068854_100003076 | 3300005578 | Bacteria | 10391 |
| 104 | Ga0068854_100025183 | 3300005578 | Bacteria | 4082 |
| 105 | Ga0068854_100100417 | 3300005578 | Bacteria | 2168 |
| 106 | Ga0068856_100001602 | 3300005614 | Bacteria | 23652 |
| 107 | Ga0068856_100058259 | 3300005614 | Bacteria | 3814 |
| 108 | Ga0068856_100265146 | 3300005614 | Bacteria | 1733 |
| 109 | Ga0068852_100002065 | 3300005616 | Bacteria | 13708 |
| 110 | Ga0068852_100007728 | 3300005616 | Bacteria | 7863 |
| 111 | Ga0068852_100008311 | 3300005616 | Bacteria | 7638 |
| 112 | Ga0068852_100028380 | 3300005616 | Bacteria | 4579 |
| 113 | Ga0068852_100030078 | 3300005616 | Bacteria | 4467 |
| 114 | Ga0068852_100119015 | 3300005616 | Bacteria | 2414 |
| 115 | Ga0068852_100137041 | 3300005616 | Bacteria | 2261 |
| 116 | Ga0068859_100006388 | 3300005617 | Bacteria | 11959 |
| 117 | Ga0068859_100043553 | 3300005617 | Bacteria | 4511 |
| 118 | Ga0068864_100023643 | 3300005618 | Bacteria | 5162 |
| 119 | Ga0068866_10001382 | 3300005718 | Bacteria | 10464 |
| 120 | Ga0068861_100064739 | 3300005719 | Bacteria | 2814 |
| 121 | Ga0068851_10002317 | 3300005834 | Bacteria | 8380 |
| 122 | Ga0068851_10010765 | 3300005834 | Bacteria | 4275 |
| 123 | Ga0068851_10049004 | 3300005834 | Bacteria | 2142 |
| 124 | Ga0068863_100000521 | 3300005841 | Bacteria | 39214 |
| 125 | Ga0068863_100010980 | 3300005841 | Bacteria | 8784 |
| 126 | Ga0068858_100002595 | 3300005842 | Bacteria | 18196 |
| 127 | Ga0068858_100062480 | 3300005842 | Bacteria | 3443 |
| 128 | Ga0068860_100165232 | 3300005843 | Bacteria | 2136 |
| 129 | Ga0068862_100013593 | 3300005844 | Bacteria | 6740 |
| 130 | Ga0081455_10221121 | 3300005937 | Unclassified | 1403 |
| 131 | Ga0081540_1009885 | 3300005983 | Bacteria | 6517 |
| 132 | Ga0081539_10006541 | 3300005985 | Bacteria | 11117 |
| 133 | Ga0097621_100035711 | 3300006237 | Bacteria | 3973 |
| 134 | Ga0097621_100303583 | 3300006237 | Bacteria | 1410 |
| 135 | Ga0068871_100021589 | 3300006358 | Bacteria | 4951 |
| 136 | Ga0068871_100120521 | 3300006358 | Bacteria | 2215 |
| 137 | Ga0068871_100192063 | 3300006358 | Bacteria | 1759 |
| 138 | Ga0068865_100005114 | 3300006881 | Bacteria | 7938 |
| 139 | Ga0068865_100180912 | 3300006881 | Bacteria | 1623 |
| 140 | Ga0075436_100019016 | 3300006914 | Bacteria | 4705 |
| 141 | Ga0097620_100006387 | 3300006931 | Bacteria | 11959 |
| 142 | Ga0097620_100043554 | 3300006931 | Bacteria | 4511 |
| 143 | Ga0105240_10046619 | 3300009093 | Bacteria | 5491 |
| 144 | Ga0105240_10075677 | 3300009093 | Bacteria | 4152 |
| 145 | Ga0105240_10135227 | 3300009093 | Bacteria | 2952 |
| 146 | Ga0105240_10170468 | 3300009093 | Bacteria | 2579 |
| 147 | Ga0111539_10022960 | 3300009094 | Bacteria | 7660 |
| 148 | Ga0105245_10004684 | 3300009098 | Bacteria | 12091 |
| 149 | Ga0105245_10004874 | 3300009098 | Bacteria | 11811 |
| 150 | Ga0105243_10240364 | 3300009148 | Bacteria | 1611 |
| 151 | Ga0105241_10005054 | 3300009174 | Bacteria | 9729 |
| 152 | Ga0105241_10128560 | 3300009174 | Bacteria | 2048 |
| 153 | Ga0105242_10007936 | 3300009176 | Bacteria | 8175 |
| 154 | Ga0105248_10046839 | 3300009177 | Bacteria | 4848 |
| 155 | Ga0105237_10252927 | 3300009545 | Bacteria | 1764 |
| 156 | Ga0105238_10016630 | 3300009551 | Bacteria | 7450 |
| 157 | Ga0105238_10022863 | 3300009551 | Bacteria | 6373 |
| 158 | Ga0105238_10121488 | 3300009551 | Bacteria | 2591 |
| 159 | Ga0105246_10097819 | 3300011119 | Bacteria | 2131 |
| 160 | Ga0157373_10000924 | 3300013100 | Bacteria | 22752 |
| 161 | Ga0157373_10005626 | 3300013100 | Bacteria | 9396 |
| 162 | Ga0157373_10010452 | 3300013100 | Bacteria | 6829 |
| 163 | Ga0157371_10000522 | 3300013102 | Bacteria | 45892 |
| 164 | Ga0157371_10092963 | 3300013102 | Bacteria | 2137 |
| 165 | Ga0157371_10109427 | 3300013102 | Bacteria | 1961 |
| 166 | Ga0157371_10110555 | 3300013102 | Bacteria | 1951 |
| 167 | Ga0157370_10019308 | 3300013104 | Bacteria | 6842 |
| 168 | Ga0157370_10021260 | 3300013104 | Bacteria | 6469 |
| 169 | Ga0157370_10024337 | 3300013104 | Bacteria | 5996 |
| 170 | Ga0157370_10026655 | 3300013104 | Bacteria | 5704 |
| 171 | Ga0157370_10030822 | 3300013104 | Bacteria | 5253 |
| 172 | Ga0157370_10153070 | 3300013104 | Bacteria | 2146 |
| 173 | Ga0157369_10002022 | 3300013105 | Bacteria | 24464 |
| 174 | Ga0157369_10013944 | 3300013105 | Bacteria | 9082 |
| 175 | Ga0157369_10052019 | 3300013105 | Bacteria | 4432 |
| 176 | Ga0157369_10105364 | 3300013105 | Bacteria | 3002 |
| 177 | Ga0157369_10111519 | 3300013105 | Bacteria | 2907 |
| 178 | Ga0157374_10004205 | 3300013296 | Bacteria | 12099 |
| 179 | Ga0157374_10104198 | 3300013296 | Bacteria | 2723 |
| 180 | Ga0157378_10011028 | 3300013297 | Bacteria | 7909 |
| 181 | Ga0157378_10016424 | 3300013297 | Bacteria | 6481 |
| 182 | Ga0157378_10157456 | 3300013297 | Bacteria | 2121 |
| 183 | Ga0163162_10005749 | 3300013306 | Bacteria | 11996 |
| 184 | Ga0163162_10019620 | 3300013306 | Bacteria | 6636 |
| 185 | Ga0163162_10048954 | 3300013306 | Bacteria | 4236 |
| 186 | Ga0157372_10000791 | 3300013307 | Bacteria | 34366 |
| 187 | Ga0157372_10009509 | 3300013307 | Bacteria | 10336 |
| 188 | Ga0157372_10023388 | 3300013307 | Bacteria | 6698 |
| 189 | Ga0157372_10043976 | 3300013307 | Bacteria | 4947 |
| 190 | Ga0157372_10133216 | 3300013307 | Bacteria | 2861 |
| 191 | Ga0157372_10202722 | 3300013307 | Bacteria | 2298 |
| 192 | Ga0157372_10212922 | 3300013307 | Bacteria | 2239 |
| 193 | Ga0157372_10243311 | 3300013307 | Bacteria | 2087 |
| 194 | Ga0157372_10298891 | 3300013307 | Bacteria | 1873 |
| 195 | Ga0157375_10219422 | 3300013308 | Bacteria | 2060 |
| 196 | Ga0163163_10047688 | 3300014325 | Bacteria | 4212 |
| 197 | Ga0157379_10002212 | 3300014968 | Bacteria | 16183 |
| 198 | Ga0157379_10009512 | 3300014968 | Bacteria | 8464 |
| 199 | Ga0157376_10012087 | 3300014969 | Bacteria | 6391 |
| 200 | Ga0163161_10025411 | 3300017792 | Bacteria | 4192 |
| 201 | Ga0207697_10000450 | 3300025315 | Bacteria | 23178 |
| 202 | Ga0207656_10005762 | 3300025321 | Bacteria | 4407 |
| 203 | Ga0207656_10014690 | 3300025321 | Bacteria | 3022 |
| 204 | Ga0207642_10001187 | 3300025899 | Bacteria | 8031 |
| 205 | Ga0207688_10010358 | 3300025901 | Bacteria | 5074 |
| 206 | Ga0207680_10048735 | 3300025903 | Bacteria | 2518 |
| 207 | Ga0207680_10056941 | 3300025903 | Bacteria | 2363 |
| 208 | Ga0207680_10074458 | 3300025903 | Bacteria | 2114 |
| 209 | Ga0207699_10108194 | 3300025906 | Bacteria | 1777 |
| 210 | Ga0207645_10001587 | 3300025907 | Bacteria | 18531 |
| 211 | Ga0207643_10000429 | 3300025908 | Bacteria | 27769 |
| 212 | Ga0207705_10012215 | 3300025909 | Bacteria | 6206 |
| 213 | Ga0207705_10118089 | 3300025909 | Bacteria | 1965 |
| 214 | Ga0207705_10138788 | 3300025909 | Bacteria | 1814 |
| 215 | Ga0207684_10033492 | 3300025910 | Bacteria | 4368 |
| 216 | Ga0207654_10004312 | 3300025911 | Bacteria | 7172 |
| 217 | Ga0207654_10008078 | 3300025911 | Bacteria | 5305 |
| 218 | Ga0207707_10003585 | 3300025912 | Bacteria | 13765 |
| 219 | Ga0207707_10005932 | 3300025912 | Bacteria | 10689 |
| 220 | Ga0207707_10033524 | 3300025912 | Bacteria | 4493 |
| 221 | Ga0207695_10014512 | 3300025913 | Bacteria | 9326 |
| 222 | Ga0207695_10038581 | 3300025913 | Bacteria | 5140 |
| 223 | Ga0207695_10070564 | 3300025913 | Bacteria | 3571 |
| 224 | Ga0207663_10024134 | 3300025916 | Bacteria | 3499 |
| 225 | Ga0207660_10002460 | 3300025917 | Bacteria | 12166 |
| 226 | Ga0207660_10118138 | 3300025917 | Bacteria | 2005 |
| 227 | Ga0207660_10123786 | 3300025917 | Bacteria | 1961 |
| 228 | Ga0207662_10022596 | 3300025918 | Bacteria | 3607 |
| 229 | Ga0207662_10111683 | 3300025918 | Bacteria | 1705 |
| 230 | Ga0207657_10000297 | 3300025919 | Bacteria | 52991 |
| 231 | Ga0207657_10000657 | 3300025919 | Bacteria | 36802 |
| 232 | Ga0207657_10004018 | 3300025919 | Bacteria | 15631 |
| 233 | Ga0207657_10005722 | 3300025919 | Bacteria | 12970 |
| 234 | Ga0207657_10015368 | 3300025919 | Bacteria | 7418 |
| 235 | Ga0207657_10193448 | 3300025919 | Bacteria | 1640 |
| 236 | Ga0207649_10003651 | 3300025920 | Bacteria | 8404 |
| 237 | Ga0207649_10007402 | 3300025920 | Bacteria | 5973 |
| 238 | Ga0207649_10032774 | 3300025920 | Bacteria | 3099 |
| 239 | Ga0207649_10039934 | 3300025920 | Bacteria | 2848 |
| 240 | Ga0207649_10117885 | 3300025920 | Bacteria | 1785 |
| 241 | Ga0207649_10118456 | 3300025920 | Bacteria | 1781 |
| 242 | Ga0207652_10011598 | 3300025921 | Bacteria | 7110 |
| 243 | Ga0207652_10015423 | 3300025921 | Bacteria | 6208 |
| 244 | Ga0207652_10023700 | 3300025921 | Bacteria | 5087 |
| 245 | Ga0207652_10046377 | 3300025921 | Bacteria | 3708 |
| 246 | Ga0207652_10184286 | 3300025921 | Bacteria | 1877 |
| 247 | Ga0207681_10016827 | 3300025923 | Bacteria | 4584 |
| 248 | Ga0207694_10041058 | 3300025924 | Bacteria | 3564 |
| 249 | Ga0207650_10000503 | 3300025925 | Bacteria | 32602 |
| 250 | Ga0207659_10001307 | 3300025926 | Bacteria | 14875 |
| 251 | Ga0207687_10011244 | 3300025927 | Bacteria | 5846 |
| 252 | Ga0207687_10014035 | 3300025927 | Bacteria | 5237 |
| 253 | Ga0207664_10008715 | 3300025929 | Bacteria | 7091 |
| 254 | Ga0207644_10007750 | 3300025931 | Bacteria | 7008 |
| 255 | Ga0207644_10092409 | 3300025931 | Bacteria | 2257 |
| 256 | Ga0207690_10000412 | 3300025932 | Bacteria | 28034 |
| 257 | Ga0207690_10004753 | 3300025932 | Bacteria | 8016 |
| 258 | Ga0207690_10032515 | 3300025932 | Bacteria | 3348 |
| 259 | Ga0207690_10090755 | 3300025932 | Bacteria | 2158 |
| 260 | Ga0207690_10151460 | 3300025932 | Bacteria | 1720 |
| 261 | Ga0207706_10000164 | 3300025933 | Bacteria | 73885 |
| 262 | Ga0207706_10066056 | 3300025933 | Bacteria | 3184 |
| 263 | Ga0207686_10002716 | 3300025934 | Bacteria | 9600 |
| 264 | Ga0207670_10003032 | 3300025936 | Bacteria | 8859 |
| 265 | Ga0207691_10071179 | 3300025940 | Bacteria | 3139 |
| 266 | Ga0207711_10000654 | 3300025941 | Bacteria | 34558 |
| 267 | Ga0207689_10003889 | 3300025942 | Bacteria | 13608 |
| 268 | Ga0207689_10021399 | 3300025942 | Bacteria | 5438 |
| 269 | Ga0207689_10133337 | 3300025942 | Bacteria | 2045 |
| 270 | Ga0207661_10009378 | 3300025944 | Bacteria | 7017 |
| 271 | Ga0207661_10157323 | 3300025944 | Bacteria | 1969 |
| 272 | Ga0207679_10000601 | 3300025945 | Bacteria | 24040 |
| 273 | Ga0207679_10009854 | 3300025945 | Bacteria | 6134 |
| 274 | Ga0207679_10011564 | 3300025945 | Bacteria | 5724 |
| 275 | Ga0207679_10026327 | 3300025945 | Bacteria | 4009 |
| 276 | Ga0207679_10052132 | 3300025945 | Bacteria | 2999 |
| 277 | Ga0207667_10000695 | 3300025949 | Bacteria | 43623 |
| 278 | Ga0207667_10003052 | 3300025949 | Bacteria | 20782 |
| 279 | Ga0207667_10184620 | 3300025949 | Bacteria | 2141 |
| 280 | Ga0207667_10203916 | 3300025949 | Bacteria | 2028 |
| 281 | Ga0207667_10250929 | 3300025949 | Bacteria | 1810 |
| 282 | Ga0207667_10274172 | 3300025949 | Bacteria | 1724 |
| 283 | Ga0207667_10286994 | 3300025949 | Bacteria | 1682 |
| 284 | Ga0207651_10034709 | 3300025960 | Bacteria | 3270 |
| 285 | Ga0207651_10052331 | 3300025960 | Bacteria | 2783 |
| 286 | Ga0207640_10005704 | 3300025981 | Bacteria | 6783 |
| 287 | Ga0207640_10082952 | 3300025981 | Bacteria | 2196 |
| 288 | Ga0207658_10004210 | 3300025986 | Bacteria | 10022 |
| 289 | Ga0207658_10045089 | 3300025986 | Bacteria | 3213 |
| 290 | Ga0207658_10064037 | 3300025986 | Bacteria | 2756 |
| 291 | Ga0207677_10000162 | 3300026023 | Bacteria | 53309 |
| 292 | Ga0207677_10029584 | 3300026023 | Bacteria | 3483 |
| 293 | Ga0207703_10010978 | 3300026035 | Bacteria | 7058 |
| 294 | Ga0207639_10013780 | 3300026041 | Bacteria | 5669 |
| 295 | Ga0207639_10069988 | 3300026041 | Bacteria | 2739 |
| 296 | Ga0207639_10423179 | 3300026041 | Bacteria | 1204 |
| 297 | Ga0207678_10011759 | 3300026067 | Bacteria | 7683 |
| 298 | Ga0207678_10148156 | 3300026067 | Bacteria | 2003 |
| 299 | Ga0207678_10163519 | 3300026067 | Bacteria | 1901 |
| 300 | Ga0207678_10294787 | 3300026067 | Bacteria | 1393 |
| 301 | Ga0207708_10057134 | 3300026075 | Bacteria | 2977 |
| 302 | Ga0207708_10351074 | 3300026075 | Bacteria | 1210 |
| 303 | Ga0207702_10001837 | 3300026078 | Bacteria | 20897 |
| 304 | Ga0207702_10042852 | 3300026078 | Bacteria | 3798 |
| 305 | Ga0207702_10181386 | 3300026078 | Bacteria | 1939 |
| 306 | Ga0207641_10002418 | 3300026088 | Bacteria | 17241 |
| 307 | Ga0207648_10068279 | 3300026089 | Bacteria | 3097 |
| 308 | Ga0207676_10000845 | 3300026095 | Bacteria | 23780 |
| 309 | Ga0207676_10049890 | 3300026095 | Bacteria | 3259 |
| 310 | Ga0207674_10000396 | 3300026116 | Bacteria | 56376 |
| 311 | Ga0207674_10014843 | 3300026116 | Bacteria | 8591 |
| 312 | Ga0207674_10105737 | 3300026116 | Bacteria | 2792 |
| 313 | Ga0207675_100004233 | 3300026118 | Bacteria | 13885 |
| 314 | Ga0207683_10001007 | 3300026121 | Bacteria | 25719 |
| 315 | Ga0207698_10000732 | 3300026142 | Bacteria | 19003 |
| 316 | Ga0207698_10007413 | 3300026142 | Bacteria | 6872 |
| 317 | Ga0207698_10021638 | 3300026142 | Bacteria | 4453 |
| 318 | Ga0207698_10027156 | 3300026142 | Bacteria | 4060 |
| 319 | Ga0207698_10095682 | 3300026142 | Bacteria | 2445 |
| 320 | Ga0207698_10294985 | 3300026142 | Bacteria | 1507 |
| 321 | Ga0209974_10004530 | 3300027876 | Bacteria | 4946 |
| 322 | Ga0268264_10005787 | 3300028381 | Bacteria | 10481 |
| 323 | Ga0268264_10053425 | 3300028381 | Bacteria | 3370 |
| 324 | Ga0268264_10162997 | 3300028381 | Bacteria | 2010 |
| 325 | Ga0307408_100187220 | 3300031548 | Bacteria | 1665 |
| 326 | Ga0307410_10015234 | 3300031852 | Bacteria | 4554 |
| 327 | Ga0307407_10015800 | 3300031903 | Bacteria | 3743 |
| 328 | Ga0307412_10010002 | 3300031911 | Bacteria | 5456 |
| 329 | Ga0307409_100000903 | 3300031995 | Bacteria | 13753 |
| 330 | Ga0307415_100004603 | 3300032126 | Bacteria | 7195 |
| 331 | Ga0373923_0006384 | 3300035111 | Bacteria | 4072 |
| 332 | Ga0373923_0021739 | 3300035111 | Bacteria | 2508 |
| 333 | Ga0373936_0018609 | 3300035113 | Bacteria | 2684 |
| 334 | Ga0373945_0034565 | 3300035116 | Bacteria | 1802 |
| 335 | Ga0373945_0043741 | 3300035116 | Bacteria | 1626 |
| 336 | Ga0373953_0002065 | 3300035117 | Bacteria | 5990 |
| 337 | Ga0373954_0000001 | 3300035118 | Bacteria | 158201 |
| 338 | Ga0373954_0005441 | 3300035118 | Bacteria | 5509 |
| 339 | Ga0373954_0009183 | 3300035118 | Bacteria | 4349 |
| 340 | Ga0373954_0018297 | 3300035118 | Bacteria | 3152 |
| 341 | Ga0373956_0006326 | 3300035119 | Bacteria | 4740 |
| 342 | Ga0373956_0010448 | 3300035119 | Bacteria | 3805 |
| 343 | Ga0373943_0033098 | 3300035170 | Bacteria | 2460 |
| 344 | Ga0373943_0036182 | 3300035170 | Bacteria | 2363 |
| 345 | Ga0373955_0008460 | 3300035172 | Bacteria | 4781 |
| 346 | Ga0373955_0017595 | 3300035172 | Bacteria | 3540 |
| 347 | Ga0373955_0018192 | 3300035172 | Bacteria | 3491 |
| 348 | Ga0373955_0026361 | 3300035172 | Bacteria | 2993 |
| 349 | Ga0373924_0000883 | 3300035410 | Bacteria | 9450 |
| 350 | Ga0373924_0006601 | 3300035410 | Bacteria | 4161 |
| 351 | Ga0373924_0016434 | 3300035410 | Bacteria | 2824 |
| 352 | Ga0373935_0031819 | 3300035692 | Bacteria | 3276 |
| 353 | Ga0373927_0010594 | 3300035695 | Bacteria | 6144 |
| 354 | Ga0373927_0127253 | 3300035695 | Bacteria | 1663 |
| 355 | Ga0373933_0012221 | 3300035724 | Bacteria | 4743 |
| 356 | Ga0373933_0037569 | 3300035724 | Bacteria | 2841 |
| 357 | Ga0373933_0186966 | 3300035724 | Bacteria | 1322 |
| 358 | Ga0373947_0015771 | 3300035725 | Bacteria | 4340 |
| 359 | Ga0373947_0039702 | 3300035725 | Bacteria | 2801 |
| 360 | Ga0373947_0041584 | 3300035725 | Bacteria | 2741 |
| 361 | Ga0373937_0005181 | 3300036401 | Bacteria | 11122 |
| 362 | Ga0373937_0020151 | 3300036401 | Bacteria | 5976 |
| 363 | Ga0373937_0028653 | 3300036401 | Bacteria | 5040 |
| 364 | Ga0373937_0032018 | 3300036401 | Bacteria | 4767 |
| 365 | Ga0373937_0047293 | 3300036401 | Bacteria | 3936 |
| 366 | Ga0373937_0227667 | 3300036401 | Bacteria | 1755 |
| 367 | Ga0316584_0010926 | 3300036712 | Bacteria | 6359 |
| 368 | Ga0373925_0010065 | 3300037068 | Bacteria | 6868 |
| 369 | Ga0373925_0025023 | 3300037068 | Bacteria | 4360 |
| 370 | Ga0373925_0033237 | 3300037068 | Bacteria | 3802 |
| 371 | Ga0373925_0149014 | 3300037068 | Bacteria | 1836 |
| 372 | Ga0373925_0218660 | 3300037068 | Bacteria | 1520 |
| 373 | Ga0373925_0233943 | 3300037068 | Bacteria | 1470 |
| 374 | Ga0395899_0001564 | 3300037312 | Bacteria | 19269 |
| 375 | Ga0395900_0018529 | 3300037418 | Bacteria | 7099 |
| 376 | Ga0395900_0262605 | 3300037418 | Bacteria | 1724 |
| 377 | Ga0395898_0003262 | 3300037466 | Bacteria | 18232 |
| 378 | Ga0395898_0053882 | 3300037466 | Bacteria | 3927 |
| 379 | Ga0395905_0000126 | 3300037471 | Bacteria | 126035 |
| 380 | Ga0395905_0005168 | 3300037471 | Bacteria | 13388 |
| 381 | Ga0395905_0017017 | 3300037471 | Bacteria | 6902 |
| 382 | Ga0395905_0041120 | 3300037471 | Bacteria | 4337 |
| 383 | Ga0395901_0069291 | 3300038443 | Bacteria | 3673 |
| 384 | Ga0439448_0053765 | 3300042005 | Bacteria | 1322 |
| 385 | Ga0495592_0063538 | 3300046454 | Bacteria | 2707 |
| 386 | Ga0495592_0066301 | 3300046454 | Bacteria | 2642 |
| 387 | Ga0495592_0165457 | 3300046454 | Bacteria | 1518 |
| 388 | Ga0495629_0020556 | 3300046459 | Bacteria | 4715 |
| 389 | Ga0495651_0002598 | 3300046462 | Bacteria | 13965 |
| 390 | Ga0495651_0007571 | 3300046462 | Bacteria | 8307 |
| 391 | Ga0495651_0125247 | 3300046462 | Bacteria | 1882 |
| 392 | Ga0495653_0007240 | 3300046463 | Bacteria | 9090 |
| 393 | Ga0495653_0203989 | 3300046463 | Bacteria | 1340 |
| 394 | Ga0495580_0012254 | 3300046472 | Bacteria | 6584 |
| 395 | Ga0495580_0023199 | 3300046472 | Bacteria | 4559 |
| 396 | Ga0495582_0003184 | 3300046473 | Bacteria | 9225 |
| 397 | Ga0495582_0015855 | 3300046473 | Bacteria | 4132 |
| 398 | Ga0495639_0024590 | 3300046475 | Bacteria | 2652 |
| 399 | Ga0495664_0002776 | 3300046477 | Bacteria | 9425 |
| 400 | Ga0495664_0033125 | 3300046477 | Bacteria | 3036 |
| 401 | Ga0495594_0050909 | 3300046499 | Bacteria | 2279 |
| 402 | Ga0495608_0010400 | 3300046511 | Bacteria | 6494 |
| 403 | Ga0495608_0016080 | 3300046511 | Bacteria | 5176 |
| 404 | Ga0495618_0011734 | 3300046514 | Bacteria | 5319 |
| 405 | Ga0495628_0023409 | 3300046516 | Bacteria | 5069 |
| 406 | Ga0495628_0033001 | 3300046516 | Bacteria | 4175 |
| 407 | Ga0495628_0227203 | 3300046516 | Bacteria | 1400 |
| 408 | Ga0495630_0018764 | 3300046517 | Bacteria | 5083 |
| 409 | Ga0495630_0025880 | 3300046517 | Bacteria | 4341 |
| 410 | Ga0495666_0041781 | 3300046526 | Bacteria | 2219 |
| 411 | Ga0495652_0016901 | 3300046529 | Bacteria | 6519 |
| 412 | Ga0495652_0036330 | 3300046529 | Bacteria | 4285 |
| 413 | Ga0495652_0134326 | 3300046529 | Bacteria | 1954 |
| 414 | Ga0495665_0010123 | 3300046531 | Bacteria | 5109 |
| 415 | Ga0495665_0011441 | 3300046531 | Bacteria | 4802 |
| 416 | Ga0495665_0105710 | 3300046531 | Bacteria | 1477 |
| 417 | Ga0495640_0014254 | 3300046533 | Bacteria | 6022 |
| 418 | Ga0495640_0015001 | 3300046533 | Bacteria | 5839 |
| 419 | Ga0495586_0006225 | 3300046535 | Bacteria | 6379 |
| 420 | Ga0495587_0002421 | 3300046536 | Bacteria | 12435 |
| 421 | Ga0495587_0034279 | 3300046536 | Bacteria | 3062 |
| 422 | Ga0495621_0005862 | 3300046539 | Bacteria | 3558 |
| 423 | Ga0495645_0000056 | 3300046543 | Bacteria | 81955 |
| 424 | Ga0495645_0004831 | 3300046543 | Bacteria | 9208 |
| 425 | Ga0495645_0005680 | 3300046543 | Bacteria | 8589 |
| 426 | Ga0495645_0010684 | 3300046543 | Bacteria | 6446 |
| 427 | Ga0495667_0000293 | 3300046559 | Bacteria | 32233 |
| 428 | Ga0495667_0016751 | 3300046559 | Bacteria | 4950 |
| 429 | Ga0495667_0135517 | 3300046559 | Bacteria | 1587 |
| 430 | Ga0495634_0026307 | 3300046642 | Bacteria | 4062 |
| 431 | Ga0495634_0069400 | 3300046642 | Bacteria | 2325 |
| 432 | Ga0495635_0037690 | 3300046663 | Bacteria | 3346 |
| 433 | Ga0495635_0063114 | 3300046663 | Bacteria | 2544 |
| 434 | Ga0495635_0168396 | 3300046663 | Bacteria | 1490 |
| 435 | Ga0495657_0027802 | 3300046675 | Bacteria | 3987 |
| 436 | Ga0495657_0041951 | 3300046675 | Bacteria | 3127 |
| 437 | Ga0495657_0214335 | 3300046675 | Bacteria | 1169 |
| 438 | Ga0495599_0016654 | 3300046678 | Bacteria | 4565 |
| 439 | Ga0495599_0029876 | 3300046678 | Bacteria | 3418 |
| 440 | Ga0495623_0018229 | 3300046679 | Bacteria | 4533 |
| 441 | Ga0495623_0073494 | 3300046679 | Bacteria | 2125 |
| 442 | Ga0495646_0001995 | 3300046680 | Bacteria | 12333 |
| 443 | Ga0495647_0002608 | 3300046681 | Bacteria | 5712 |
| 444 | Ga0495647_0014894 | 3300046681 | Bacteria | 2715 |
| 445 | Ga0495658_0003919 | 3300046683 | Bacteria | 7348 |
| 446 | Ga0495658_0012866 | 3300046683 | Bacteria | 4250 |
| 447 | Ga0495658_0013527 | 3300046683 | Bacteria | 4154 |
| 448 | Ga0495613_0061734 | 3300046689 | Bacteria | 2744 |
| 449 | Ga0495613_0078920 | 3300046689 | Bacteria | 2394 |
| 450 | Ga0495600_0010886 | 3300046809 | Bacteria | 5657 |
| 451 | Ga0495600_0032156 | 3300046809 | Bacteria | 3403 |
| 452 | Ga0495581_0001661 | 3300047315 | Bacteria | 12389 |
| 453 | Ga0495604_0003730 | 3300047317 | Bacteria | 12131 |
| 454 | Ga0495604_0022595 | 3300047317 | Bacteria | 5022 |
| 455 | Ga0495604_0089663 | 3300047317 | Bacteria | 2285 |
| 456 | Ga0495674_0001667 | 3300047319 | Bacteria | 21836 |
| 457 | Ga0495674_0001748 | 3300047319 | Bacteria | 21384 |
| 458 | Ga0495676_0059396 | 3300047321 | Bacteria | 3003 |
| 459 | Ga0495680_0003160 | 3300047322 | Bacteria | 16401 |
| 460 | Ga0495680_0026771 | 3300047322 | Bacteria | 4748 |
| 461 | Ga0495680_0044134 | 3300047322 | Bacteria | 3526 |
| 462 | Ga0495675_0013454 | 3300047444 | Bacteria | 5165 |
| 463 | Ga0495675_0021285 | 3300047444 | Bacteria | 4129 |
| 464 | Ga0495684_0002788 | 3300047471 | Bacteria | 13787 |
| 465 | Ga0495684_0020748 | 3300047471 | Bacteria | 5062 |
| 466 | Ga0495684_0055876 | 3300047471 | Bacteria | 3010 |
| 467 | Ga0495684_0177721 | 3300047471 | Bacteria | 1579 |
| 468 | Ga0495602_0003569 | 3300048088 | Bacteria | 16101 |
| 469 | Ga0496101_0009607 | 3300048904 | Bacteria | 6363 |
| 470 | Ga0496102_0011937 | 3300048905 | Bacteria | 7502 |
| 471 | Ga0496102_0028354 | 3300048905 | Bacteria | 4999 |
| 472 | Ga0496102_0166516 | 3300048905 | Bacteria | 2074 |
| 473 | Ga0496104_0091398 | 3300048907 | Bacteria | 2909 |
| 474 | Ga0496104_0285634 | 3300048907 | Bacteria | 1563 |
| 475 | Ga0496105_0062729 | 3300048908 | Bacteria | 3067 |
| 476 | Ga0496106_0005422 | 3300048909 | Bacteria | 9436 |
| 477 | Ga0496106_0069303 | 3300048909 | Bacteria | 2692 |
| 478 | Ga0496106_0173454 | 3300048909 | Bacteria | 1710 |
| 479 | Ga0496107_0038768 | 3300048910 | Bacteria | 3417 |
| 480 | Ga0496108_0213061 | 3300048911 | Bacteria | 1677 |
| 481 | Ga0496109_0101135 | 3300048912 | Bacteria | 2675 |
| 482 | Ga0496109_0316525 | 3300048912 | Bacteria | 1472 |
| 483 | Ga0496110_0034960 | 3300048913 | Bacteria | 4356 |
| 484 | Ga0496112_0018662 | 3300048915 | Bacteria | 6537 |
| 485 | Ga0496112_0124275 | 3300048915 | Bacteria | 2551 |
| 486 | Ga0501032_0240288 | 3300049569 | Bacteria | 1177 |
| 487 | Ga0501034_0207641 | 3300049571 | Bacteria | 1914 |
| 488 | Ga0501036_0364036 | 3300049572 | Bacteria | 1207 |
| 489 | Ga0501038_0176593 | 3300049574 | Bacteria | 1726 |
| 490 | Ga0501043_0000009 | 3300049579 | Bacteria | 214823 |
| 491 | Ga0501043_0020921 | 3300049579 | Bacteria | 5130 |
| 492 | Ga0501046_0000022 | 3300049580 | Bacteria | 215451 |
| 493 | Ga0501046_0044864 | 3300049580 | Bacteria | 3514 |
| 494 | Ga0501047_0000021 | 3300049581 | Bacteria | 254841 |
| 495 | Ga0501047_0020495 | 3300049581 | Bacteria | 6348 |
| 496 | Ga0501047_0023869 | 3300049581 | Bacteria | 5873 |
| 497 | Ga0501047_0067747 | 3300049581 | Bacteria | 3439 |
| 498 | Ga0501047_0104367 | 3300049581 | Bacteria | 2714 |
| 499 | Ga0501047_0242429 | 3300049581 | Bacteria | 1653 |
| 500 | Ga0501048_0003510 | 3300049582 | Bacteria | 11922 |
| 501 | Ga0501070_0000979 | 3300049586 | Bacteria | 25649 |
| 502 | Ga0501070_0031620 | 3300049586 | Bacteria | 4434 |
| 503 | Ga0501070_0069169 | 3300049586 | Bacteria | 2923 |
| 504 | Ga0501070_0158494 | 3300049586 | Bacteria | 1866 |
| 505 | Ga0501071_0145867 | 3300049587 | Bacteria | 1764 |
| 506 | Ga0501072_0004295 | 3300049588 | Bacteria | 10819 |
| 507 | Ga0501073_0042997 | 3300049589 | Bacteria | 3187 |
| 508 | Ga0501073_0054936 | 3300049589 | Bacteria | 2787 |
| 509 | Ga0501074_0006077 | 3300049590 | Bacteria | 8719 |
| 510 | Ga0501079_0008169 | 3300049741 | Bacteria | 7933 |
| 511 | Ga0501080_0010364 | 3300049742 | Bacteria | 8524 |
| 512 | Ga0501080_0022597 | 3300049742 | Bacteria | 5826 |
| 513 | Ga0501080_0109168 | 3300049742 | Bacteria | 2564 |
| 514 | Ga0501080_0285865 | 3300049742 | Bacteria | 1498 |
| 515 | Ga0501083_0112604 | 3300049744 | Bacteria | 1788 |
| 516 | Ga0501083_0158264 | 3300049744 | Bacteria | 1482 |
| 517 | Ga0501035_0060482 | 3300049822 | Bacteria | 3372 |
| 518 | Ga0501035_0068818 | 3300049822 | Bacteria | 3139 |
| 519 | Ga0501035_0147680 | 3300049822 | Bacteria | 2041 |
| 520 | Ga0501044_0055738 | 3300049823 | Bacteria | 4059 |
| 521 | Ga0501044_0076337 | 3300049823 | Bacteria | 3401 |
| 522 | Ga0501044_0129214 | 3300049823 | Bacteria | 2522 |
| 523 | Ga0501044_0257803 | 3300049823 | Bacteria | 1683 |
| 524 | Ga0501044_0298528 | 3300049823 | Bacteria | 1540 |
| 525 | nmdc:mga08y16_332360_c1 | 3300050511 | Bacteria | 1563 |
| 526 | nmdc:mga0n895_191062_c1 | 3300050512 | Bacteria | 2078 |
| 527 | nmdc:mga08x19_45651_c1 | 3300050514 | Bacteria | 2800 |
| 528 | Ga0495601_0004409 | 3300053077 | Bacteria | 8134 |
| 529 | Ga0495601_0023907 | 3300053077 | Bacteria | 3758 |
| 530 | Ga0495612_0002196 | 3300053078 | Bacteria | 8023 |
| 531 | Ga0495612_0102634 | 3300053078 | Bacteria | 1219 |
| 532 | Ga0495595_0001285 | 3300053084 | Bacteria | 9794 |
| 533 | Ga0495619_0007680 | 3300053085 | Bacteria | 6827 |
| 534 | Ga0495619_0008116 | 3300053085 | Bacteria | 6646 |
| 535 | Ga0495619_0012565 | 3300053085 | Bacteria | 5332 |
| 536 | Ga0495619_0017076 | 3300053085 | Bacteria | 4601 |
| 537 | Ga0495619_0042548 | 3300053085 | Bacteria | 2975 |
| 538 | Ga0495619_0070169 | 3300053085 | Bacteria | 2343 |
| 539 | Ga0501084_0253460 | 3300054114 | Bacteria | 1485 |
| 540 | Ga0501082_0077085 | 3300060353 | Bacteria | 2874 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300042005 | Ga0439448_0053765 | Ga0439448_0053765_23_991 | 270 |
| 2 | 3300026075 | Ga0207708_10351074 | Ga0207708_103510741 | 290 |
| 3 | 3300005937 | Ga0081455_10221121 | Ga0081455_102211212 | 299 |
| 4 | 3300035410 | Ga0373924_0016434 | Ga0373924_0016434_22_1110 | 302 |
| 5 | 3300049823 | Ga0501044_0129214 | Ga0501044_0129214_875_2008 | 306 |
| 6 | 3300005456 | Ga0070678_100003725 | Ga0070678_10000372510 | 307 |
| 7 | 3300005546 | Ga0070696_100016902 | Ga0070696_1000169022 | 307 |
| 8 | 3300005547 | Ga0070693_100002563 | Ga0070693_1000025635 | 307 |
| 9 | 3300005718 | Ga0068866_10001382 | Ga0068866_1000138213 | 307 |
| 10 | 3300005985 | Ga0081539_10006541 | Ga0081539_100065415 | 307 |
| 11 | 3300006881 | Ga0068865_100180912 | Ga0068865_1001809122 | 307 |
| 12 | 3300009098 | Ga0105245_10004874 | Ga0105245_1000487414 | 307 |
| 13 | 3300009174 | Ga0105241_10128560 | Ga0105241_101285602 | 307 |
| 14 | 3300009176 | Ga0105242_10007936 | Ga0105242_100079368 | 307 |
| 15 | 3300013297 | Ga0157378_10011028 | Ga0157378_100110282 | 307 |
| 16 | 3300013306 | Ga0163162_10019620 | Ga0163162_100196208 | 307 |
| 17 | 3300017792 | Ga0163161_10025411 | Ga0163161_100254114 | 307 |
| 18 | 3300025899 | Ga0207642_10001187 | Ga0207642_100011873 | 307 |
| 19 | 3300025903 | Ga0207680_10074458 | Ga0207680_100744582 | 307 |
| 20 | 3300025927 | Ga0207687_10014035 | Ga0207687_100140352 | 307 |
| 21 | 3300025931 | Ga0207644_10092409 | Ga0207644_100924092 | 307 |
| 22 | 3300025934 | Ga0207686_10002716 | Ga0207686_100027163 | 307 |
| 23 | 3300025942 | Ga0207689_10021399 | Ga0207689_100213992 | 307 |
| 24 | 3300026121 | Ga0207683_10001007 | Ga0207683_1000100711 | 307 |
| 25 | 3300049569 | Ga0501032_0240288 | Ga0501032_0240288_62_1132 | 307 |
| 26 | iso_pu_bacteria | 2885326080 | 2885332234 | 307 |
| 27 | 3300046462 | Ga0495651_0125247 | Ga0495651_0125247_493_1638 | 312 |
| 28 | 3300025949 | Ga0207667_10184620 | Ga0207667_101846202 | 313 |
| 29 | 3300035111 | Ga0373923_0006384 | Ga0373923_0006384_2848_3969 | 313 |
| 30 | 3300035113 | Ga0373936_0018609 | Ga0373936_0018609_965_2086 | 313 |
| 31 | 3300035119 | Ga0373956_0010448 | Ga0373956_0010448_738_1859 | 313 |
| 32 | 3300035172 | Ga0373955_0017595 | Ga0373955_0017595_104_1225 | 313 |
| 33 | 3300035724 | Ga0373933_0037569 | Ga0373933_0037569_1671_2792 | 313 |
| 34 | 3300046462 | Ga0495651_0002598 | Ga0495651_0002598_1595_2716 | 313 |
| 35 | 3300046472 | Ga0495580_0012254 | Ga0495580_0012254_2274_3395 | 313 |
| 36 | 3300046477 | Ga0495664_0002776 | Ga0495664_0002776_4734_5855 | 313 |
| 37 | 3300046499 | Ga0495594_0050909 | Ga0495594_0050909_841_1962 | 313 |
| 38 | 3300046516 | Ga0495628_0033001 | Ga0495628_0033001_200_1321 | 313 |
| 39 | 3300046526 | Ga0495666_0041781 | Ga0495666_0041781_192_1313 | 313 |
| 40 | 3300046529 | Ga0495652_0134326 | Ga0495652_0134326_338_1459 | 313 |
| 41 | 3300046531 | Ga0495665_0105710 | Ga0495665_0105710_323_1444 | 313 |
| 42 | 3300046533 | Ga0495640_0015001 | Ga0495640_0015001_2624_3745 | 313 |
| 43 | 3300046642 | Ga0495634_0069400 | Ga0495634_0069400_1004_2125 | 313 |
| 44 | 3300046675 | Ga0495657_0041951 | Ga0495657_0041951_1572_2693 | 313 |
| 45 | 3300046678 | Ga0495599_0029876 | Ga0495599_0029876_812_1933 | 313 |
| 46 | 3300046683 | Ga0495658_0012866 | Ga0495658_0012866_2833_3954 | 313 |
| 47 | 3300046809 | Ga0495600_0010886 | Ga0495600_0010886_1832_2953 | 313 |
| 48 | 3300047317 | Ga0495604_0089663 | Ga0495604_0089663_1100_2221 | 313 |
| 49 | 3300047319 | Ga0495674_0001667 | Ga0495674_0001667_1602_2723 | 313 |
| 50 | 3300047322 | Ga0495680_0026771 | Ga0495680_0026771_2986_4107 | 313 |
| 51 | 3300047444 | Ga0495675_0021285 | Ga0495675_0021285_1730_2851 | 313 |
| 52 | 3300047471 | Ga0495684_0177721 | Ga0495684_0177721_105_1226 | 313 |
| 53 | 3300048907 | Ga0496104_0285634 | Ga0496104_0285634_35_1144 | 313 |
| 54 | 3300053085 | Ga0495619_0012565 | Ga0495619_0012565_1675_2796 | 313 |
| 55 | 3300035118 | Ga0373954_0005441 | Ga0373954_0005441_2872_3990 | 315 |
| 56 | 3300005336 | Ga0070680_100094594 | Ga0070680_1000945942 | 316 |
| 57 | 3300005344 | Ga0070661_100007865 | Ga0070661_1000078655 | 316 |
| 58 | 3300005458 | Ga0070681_10002559 | Ga0070681_1000255911 | 316 |
| 59 | 3300005530 | Ga0070679_100002918 | Ga0070679_1000029183 | 316 |
| 60 | 3300005539 | Ga0068853_100109606 | Ga0068853_1001096062 | 316 |
| 61 | 3300005577 | Ga0068857_100122249 | Ga0068857_1001222492 | 316 |
| 62 | 3300013100 | Ga0157373_10010452 | Ga0157373_100104522 | 316 |
| 63 | 3300013104 | Ga0157370_10030822 | Ga0157370_100308223 | 316 |
| 64 | 3300013307 | Ga0157372_10202722 | Ga0157372_102027222 | 316 |
| 65 | 3300025912 | Ga0207707_10005932 | Ga0207707_100059328 | 316 |
| 66 | 3300025920 | Ga0207649_10118456 | Ga0207649_101184562 | 316 |
| 67 | 3300025921 | Ga0207652_10046377 | Ga0207652_100463772 | 316 |
| 68 | 3300026041 | Ga0207639_10069988 | Ga0207639_100699882 | 316 |
| 69 | 3300026116 | Ga0207674_10105737 | Ga0207674_101057372 | 316 |
| 70 | 3300031548 | Ga0307408_100187220 | Ga0307408_1001872202 | 317 |
| 71 | 3300036401 | Ga0373937_0227667 | Ga0373937_0227667_234_1346 | 317 |
| 72 | 3300013104 | Ga0157370_10021260 | Ga0157370_100212602 | 318 |
| 73 | 3300005330 | Ga0070690_100128128 | Ga0070690_1001281282 | 319 |
| 74 | 3300009093 | Ga0105240_10075677 | Ga0105240_100756771 | 319 |
| 75 | 3300028381 | Ga0268264_10053425 | Ga0268264_100534252 | 319 |
| 76 | 3300049587 | Ga0501071_0145867 | Ga0501071_0145867_161_1261 | 319 |
| 77 | 3300005327 | Ga0070658_10009579 | Ga0070658_100095795 | 320 |
| 78 | 3300005329 | Ga0070683_100022132 | Ga0070683_1000221325 | 320 |
| 79 | 3300005330 | Ga0070690_100010980 | Ga0070690_1000109806 | 320 |
| 80 | 3300005334 | Ga0068869_100106122 | Ga0068869_1001061222 | 320 |
| 81 | 3300005335 | Ga0070666_10006712 | Ga0070666_100067123 | 320 |
| 82 | 3300005336 | Ga0070680_100010191 | Ga0070680_1000101915 | 320 |
| 83 | 3300005337 | Ga0070682_100141373 | Ga0070682_1001413732 | 320 |
| 84 | 3300005339 | Ga0070660_100006417 | Ga0070660_1000064175 | 320 |
| 85 | 3300005340 | Ga0070689_100070388 | Ga0070689_1000703882 | 320 |
| 86 | 3300005344 | Ga0070661_100012354 | Ga0070661_1000123544 | 320 |
| 87 | 3300005355 | Ga0070671_100016774 | Ga0070671_1000167742 | 320 |
| 88 | 3300005364 | Ga0070673_100040597 | Ga0070673_1000405972 | 320 |
| 89 | 3300005365 | Ga0070688_100014952 | Ga0070688_1000149526 | 320 |
| 90 | 3300005366 | Ga0070659_100023995 | Ga0070659_1000239952 | 320 |
| 91 | 3300005367 | Ga0070667_100028398 | Ga0070667_1000283982 | 320 |
| 92 | 3300005435 | Ga0070714_100013550 | Ga0070714_1000135506 | 320 |
| 93 | 3300005455 | Ga0070663_100014024 | Ga0070663_1000140245 | 320 |
| 94 | 3300005458 | Ga0070681_10047687 | Ga0070681_100476872 | 320 |
| 95 | 3300005466 | Ga0070685_10001663 | Ga0070685_1000166313 | 320 |
| 96 | 3300005530 | Ga0070679_100025151 | Ga0070679_1000251515 | 320 |
| 97 | 3300005535 | Ga0070684_100010852 | Ga0070684_1000108525 | 320 |
| 98 | 3300005539 | Ga0068853_100013069 | Ga0068853_1000130695 | 320 |
| 99 | 3300005548 | Ga0070665_100082387 | Ga0070665_1000823872 | 320 |
| 100 | 3300005563 | Ga0068855_100059960 | Ga0068855_1000599603 | 320 |
| 101 | 3300005564 | Ga0070664_100008394 | Ga0070664_1000083945 | 320 |
| 102 | 3300005577 | Ga0068857_100004656 | Ga0068857_1000046563 | 320 |
| 103 | 3300005578 | Ga0068854_100003076 | Ga0068854_10000307610 | 320 |
| 104 | 3300005614 | Ga0068856_100265146 | Ga0068856_1002651462 | 320 |
| 105 | 3300005616 | Ga0068852_100008311 | Ga0068852_1000083118 | 320 |
| 106 | 3300005617 | Ga0068859_100006388 | Ga0068859_1000063889 | 320 |
| 107 | 3300005618 | Ga0068864_100023643 | Ga0068864_1000236432 | 320 |
| 108 | 3300005841 | Ga0068863_100000521 | Ga0068863_1000005213 | 320 |
| 109 | 3300005842 | Ga0068858_100002595 | Ga0068858_1000025956 | 320 |
| 110 | 3300005843 | Ga0068860_100165232 | Ga0068860_1001652322 | 320 |
| 111 | 3300006358 | Ga0068871_100120521 | Ga0068871_1001205212 | 320 |
| 112 | 3300006931 | Ga0097620_100006387 | Ga0097620_1000063876 | 320 |
| 113 | 3300009093 | Ga0105240_10046619 | Ga0105240_100466192 | 320 |
| 114 | 3300009098 | Ga0105245_10004684 | Ga0105245_1000468414 | 320 |
| 115 | 3300009174 | Ga0105241_10005054 | Ga0105241_100050545 | 320 |
| 116 | 3300009177 | Ga0105248_10046839 | Ga0105248_100468392 | 320 |
| 117 | 3300009545 | Ga0105237_10252927 | Ga0105237_102529272 | 320 |
| 118 | 3300009551 | Ga0105238_10022863 | Ga0105238_100228634 | 320 |
| 119 | 3300013100 | Ga0157373_10005626 | Ga0157373_100056265 | 320 |
| 120 | 3300013102 | Ga0157371_10092963 | Ga0157371_100929632 | 320 |
| 121 | 3300013104 | Ga0157370_10024337 | Ga0157370_100243375 | 320 |
| 122 | 3300013296 | Ga0157374_10004205 | Ga0157374_1000420514 | 320 |
| 123 | 3300013297 | Ga0157378_10016424 | Ga0157378_100164248 | 320 |
| 124 | 3300013306 | Ga0163162_10005749 | Ga0163162_100057492 | 320 |
| 125 | 3300013307 | Ga0157372_10023388 | Ga0157372_100233883 | 320 |
| 126 | 3300013308 | Ga0157375_10219422 | Ga0157375_102194222 | 320 |
| 127 | 3300014325 | Ga0163163_10047688 | Ga0163163_100476882 | 320 |
| 128 | 3300014968 | Ga0157379_10002212 | Ga0157379_100022126 | 320 |
| 129 | 3300014969 | Ga0157376_10012087 | Ga0157376_100120872 | 320 |
| 130 | 3300025903 | Ga0207680_10056941 | Ga0207680_100569412 | 320 |
| 131 | 3300025909 | Ga0207705_10012215 | Ga0207705_100122155 | 320 |
| 132 | 3300025911 | Ga0207654_10008078 | Ga0207654_100080785 | 320 |
| 133 | 3300025912 | Ga0207707_10003585 | Ga0207707_100035858 | 320 |
| 134 | 3300025913 | Ga0207695_10014512 | Ga0207695_100145125 | 320 |
| 135 | 3300025916 | Ga0207663_10024134 | Ga0207663_100241343 | 320 |
| 136 | 3300025917 | Ga0207660_10002460 | Ga0207660_100024605 | 320 |
| 137 | 3300025919 | Ga0207657_10000297 | Ga0207657_1000029721 | 320 |
| 138 | 3300025920 | Ga0207649_10003651 | Ga0207649_100036518 | 320 |
| 139 | 3300025921 | Ga0207652_10011598 | Ga0207652_100115985 | 320 |
| 140 | 3300025924 | Ga0207694_10041058 | Ga0207694_100410584 | 320 |
| 141 | 3300025927 | Ga0207687_10011244 | Ga0207687_100112442 | 320 |
| 142 | 3300025929 | Ga0207664_10008715 | Ga0207664_100087155 | 320 |
| 143 | 3300025931 | Ga0207644_10007750 | Ga0207644_100077508 | 320 |
| 144 | 3300025932 | Ga0207690_10004753 | Ga0207690_100047535 | 320 |
| 145 | 3300025941 | Ga0207711_10000654 | Ga0207711_1000065438 | 320 |
| 146 | 3300025942 | Ga0207689_10133337 | Ga0207689_101333372 | 320 |
| 147 | 3300025944 | Ga0207661_10009378 | Ga0207661_100093784 | 320 |
| 148 | 3300025945 | Ga0207679_10011564 | Ga0207679_100115643 | 320 |
| 149 | 3300025949 | Ga0207667_10000695 | Ga0207667_1000069531 | 320 |
| 150 | 3300025960 | Ga0207651_10034709 | Ga0207651_100347092 | 320 |
| 151 | 3300025981 | Ga0207640_10005704 | Ga0207640_100057044 | 320 |
| 152 | 3300025986 | Ga0207658_10004210 | Ga0207658_100042103 | 320 |
| 153 | 3300026023 | Ga0207677_10000162 | Ga0207677_1000016258 | 320 |
| 154 | 3300026035 | Ga0207703_10010978 | Ga0207703_100109788 | 320 |
| 155 | 3300026041 | Ga0207639_10013780 | Ga0207639_100137804 | 320 |
| 156 | 3300026067 | Ga0207678_10011759 | Ga0207678_100117599 | 320 |
| 157 | 3300026078 | Ga0207702_10042852 | Ga0207702_100428524 | 320 |
| 158 | 3300026088 | Ga0207641_10002418 | Ga0207641_100024186 | 320 |
| 159 | 3300026095 | Ga0207676_10000845 | Ga0207676_100008455 | 320 |
| 160 | 3300026116 | Ga0207674_10000396 | Ga0207674_1000039615 | 320 |
| 161 | 3300026142 | Ga0207698_10000732 | Ga0207698_100007328 | 320 |
| 162 | 3300028381 | Ga0268264_10005787 | Ga0268264_100057878 | 320 |
| 163 | 3300035118 | Ga0373954_0018297 | Ga0373954_0018297_506_1651 | 320 |
| 164 | 3300036401 | Ga0373937_0047293 | Ga0373937_0047293_1366_2511 | 320 |
| 165 | 3300048911 | Ga0496108_0213061 | Ga0496108_0213061_369_1514 | 320 |
| 166 | 3300048915 | Ga0496112_0018662 | Ga0496112_0018662_3824_4969 | 320 |
| 167 | 3300049571 | Ga0501034_0207641 | Ga0501034_0207641_122_1216 | 321 |
| 168 | 3300049580 | Ga0501046_0044864 | Ga0501046_0044864_1137_2231 | 321 |
| 169 | 3300049742 | Ga0501080_0109168 | Ga0501080_0109168_1119_2213 | 321 |
| 170 | 3300049822 | Ga0501035_0147680 | Ga0501035_0147680_223_1317 | 321 |
| 171 | 3300049823 | Ga0501044_0055738 | Ga0501044_0055738_2112_3206 | 321 |
| 172 | 3300037466 | Ga0395898_0053882 | Ga0395898_0053882_839_1963 | 322 |
| 173 | 3300005539 | Ga0068853_100104695 | Ga0068853_1001046952 | 326 |
| 174 | 3300005564 | Ga0070664_100065826 | Ga0070664_1000658262 | 326 |
| 175 | 3300005616 | Ga0068852_100119015 | Ga0068852_1001190152 | 326 |
| 176 | 3300013102 | Ga0157371_10109427 | Ga0157371_101094272 | 326 |
| 177 | 3300013105 | Ga0157369_10105364 | Ga0157369_101053642 | 326 |
| 178 | 3300025919 | Ga0207657_10015368 | Ga0207657_100153682 | 326 |
| 179 | 3300026041 | Ga0207639_10423179 | Ga0207639_104231791 | 326 |
| 180 | 3300026067 | Ga0207678_10294787 | Ga0207678_102947871 | 326 |
| 181 | 3300031903 | Ga0307407_10015800 | Ga0307407_100158003 | 326 |
| 182 | 3300031911 | Ga0307412_10010002 | Ga0307412_100100023 | 326 |
| 183 | 3300031995 | Ga0307409_100000903 | Ga0307409_1000009032 | 326 |
| 184 | 3300032126 | Ga0307415_100004603 | Ga0307415_1000046031 | 326 |
| 185 | 3300046472 | Ga0495580_0023199 | Ga0495580_0023199_1095_2240 | 327 |
| 186 | 3300046473 | Ga0495582_0015855 | Ga0495582_0015855_2543_3688 | 327 |
| 187 | 3300046475 | Ga0495639_0024590 | Ga0495639_0024590_92_1237 | 327 |
| 188 | 3300046531 | Ga0495665_0010123 | Ga0495665_0010123_1432_2577 | 327 |
| 189 | 3300046539 | Ga0495621_0005862 | Ga0495621_0005862_1583_2728 | 327 |
| 190 | 3300046675 | Ga0495657_0214335 | Ga0495657_0214335_30_1079 | 327 |
| 191 | 3300046681 | Ga0495647_0014894 | Ga0495647_0014894_602_1747 | 327 |
| 192 | 3300046683 | Ga0495658_0003919 | Ga0495658_0003919_1831_2976 | 327 |
| 193 | 3300053085 | Ga0495619_0070169 | Ga0495619_0070169_234_1379 | 327 |
| 194 | 3300049572 | Ga0501036_0364036 | Ga0501036_0364036_20_1072 | 328 |
| 195 | 3300049581 | Ga0501047_0020495 | Ga0501047_0020495_189_1331 | 328 |
| 196 | 3300049586 | Ga0501070_0158494 | Ga0501070_0158494_381_1523 | 328 |
| 197 | 3300049744 | Ga0501083_0158264 | Ga0501083_0158264_62_1216 | 330 |
| 198 | 3300049574 | Ga0501038_0176593 | Ga0501038_0176593_35_1177 | 331 |
| 199 | 3300049822 | Ga0501035_0060482 | Ga0501035_0060482_1811_2953 | 331 |
| 200 | 3300049823 | Ga0501044_0076337 | Ga0501044_0076337_494_1636 | 331 |
| 201 | 3300005329 | Ga0070683_100036908 | Ga0070683_1000369083 | 333 |
| 202 | 3300005338 | Ga0068868_100033960 | Ga0068868_1000339602 | 333 |
| 203 | 3300005339 | Ga0070660_100033991 | Ga0070660_1000339912 | 333 |
| 204 | 3300005344 | Ga0070661_100009438 | Ga0070661_1000094383 | 333 |
| 205 | 3300005345 | Ga0070692_10026720 | Ga0070692_100267202 | 333 |
| 206 | 3300005366 | Ga0070659_100020158 | Ga0070659_1000201585 | 333 |
| 207 | 3300005434 | Ga0070709_10061870 | Ga0070709_100618702 | 333 |
| 208 | 3300005440 | Ga0070705_100010953 | Ga0070705_1000109532 | 333 |
| 209 | 3300005444 | Ga0070694_100015830 | Ga0070694_1000158303 | 333 |
| 210 | 3300005518 | Ga0070699_100022222 | Ga0070699_1000222223 | 333 |
| 211 | 3300005530 | Ga0070679_100038208 | Ga0070679_1000382083 | 333 |
| 212 | 3300005535 | Ga0070684_100017058 | Ga0070684_1000170583 | 333 |
| 213 | 3300005536 | Ga0070697_100016546 | Ga0070697_1000165463 | 333 |
| 214 | 3300005545 | Ga0070695_100005747 | Ga0070695_1000057472 | 333 |
| 215 | 3300005546 | Ga0070696_100023628 | Ga0070696_1000236283 | 333 |
| 216 | 3300005549 | Ga0070704_100189886 | Ga0070704_1001898862 | 333 |
| 217 | 3300005578 | Ga0068854_100025183 | Ga0068854_1000251833 | 333 |
| 218 | 3300005616 | Ga0068852_100030078 | Ga0068852_1000300782 | 333 |
| 219 | 3300009093 | Ga0105240_10135227 | Ga0105240_101352272 | 333 |
| 220 | 3300009551 | Ga0105238_10121488 | Ga0105238_101214882 | 333 |
| 221 | 3300013102 | Ga0157371_10110555 | Ga0157371_101105552 | 333 |
| 222 | 3300013104 | Ga0157370_10026655 | Ga0157370_100266555 | 333 |
| 223 | 3300025906 | Ga0207699_10108194 | Ga0207699_101081942 | 333 |
| 224 | 3300025910 | Ga0207684_10033492 | Ga0207684_100334922 | 333 |
| 225 | 3300025911 | Ga0207654_10004312 | Ga0207654_100043124 | 333 |
| 226 | 3300025917 | Ga0207660_10123786 | Ga0207660_101237861 | 333 |
| 227 | 3300025919 | Ga0207657_10004018 | Ga0207657_100040184 | 333 |
| 228 | 3300025921 | Ga0207652_10015423 | Ga0207652_100154235 | 333 |
| 229 | 3300026023 | Ga0207677_10029584 | Ga0207677_100295844 | 333 |
| 230 | 3300026116 | Ga0207674_10014843 | Ga0207674_100148436 | 333 |
| 231 | 3300035170 | Ga0373943_0033098 | Ga0373943_0033098_457_1584 | 333 |
| 232 | 3300048905 | Ga0496102_0011937 | Ga0496102_0011937_1382_2527 | 333 |
| 233 | 3300048909 | Ga0496106_0069303 | Ga0496106_0069303_922_2067 | 333 |
| 234 | 3300048915 | Ga0496112_0124275 | Ga0496112_0124275_1366_2511 | 333 |
| 235 | 3300050512 | nmdc:mga0n895_191062_c1 | nmdc:mga0n895_191062_c1_256_1401 | 333 |
| 236 | 3300005468 | Ga0070707_100031265 | Ga0070707_1000312653 | 334 |
| 237 | 3300006914 | Ga0075436_100019016 | Ga0075436_1000190164 | 334 |
| 238 | 3300037418 | Ga0395900_0262605 | Ga0395900_0262605_188_1342 | 334 |
| 239 | 3300037471 | Ga0395905_0005168 | Ga0395905_0005168_11969_13024 | 334 |
| 240 | 3300049581 | Ga0501047_0242429 | Ga0501047_0242429_11_1105 | 334 |
| 241 | 3300050514 | nmdc:mga08x19_45651_c1 | nmdc:mga08x19_45651_c1_758_1867 | 334 |
| 242 | 3300005327 | Ga0070658_10068697 | Ga0070658_100686972 | 336 |
| 243 | 3300011119 | Ga0105246_10097819 | Ga0105246_100978192 | 336 |
| 244 | 3300035111 | Ga0373923_0021739 | Ga0373923_0021739_1284_2450 | 336 |
| 245 | 3300035117 | Ga0373953_0002065 | Ga0373953_0002065_1434_2600 | 336 |
| 246 | 3300035118 | Ga0373954_0009183 | Ga0373954_0009183_1624_2790 | 336 |
| 247 | 3300035119 | Ga0373956_0006326 | Ga0373956_0006326_2094_3260 | 336 |
| 248 | 3300035172 | Ga0373955_0008460 | Ga0373955_0008460_1293_2459 | 336 |
| 249 | 3300035724 | Ga0373933_0012221 | Ga0373933_0012221_1484_2650 | 336 |
| 250 | 3300036401 | Ga0373937_0028653 | Ga0373937_0028653_1568_2734 | 336 |
| 251 | 3300037068 | Ga0373925_0218660 | Ga0373925_0218660_398_1501 | 336 |
| 252 | 3300046511 | Ga0495608_0010400 | Ga0495608_0010400_2094_3260 | 336 |
| 253 | 3300046514 | Ga0495618_0011734 | Ga0495618_0011734_1847_3013 | 336 |
| 254 | 3300046517 | Ga0495630_0025880 | Ga0495630_0025880_1560_2726 | 336 |
| 255 | 3300046535 | Ga0495586_0006225 | Ga0495586_0006225_3119_4285 | 336 |
| 256 | 3300046559 | Ga0495667_0016751 | Ga0495667_0016751_2094_3260 | 336 |
| 257 | 3300047317 | Ga0495604_0022595 | Ga0495604_0022595_2094_3260 | 336 |
| 258 | 3300047322 | Ga0495680_0044134 | Ga0495680_0044134_1431_2597 | 336 |
| 259 | 3300047471 | Ga0495684_0020748 | Ga0495684_0020748_1658_2824 | 336 |
| 260 | 3300048905 | Ga0496102_0166516 | Ga0496102_0166516_206_1333 | 336 |
| 261 | 3300048912 | Ga0496109_0316525 | Ga0496109_0316525_132_1259 | 336 |
| 262 | 3300049579 | Ga0501043_0000009 | Ga0501043_0000009_206578_207639 | 336 |
| 263 | 3300049580 | Ga0501046_0000022 | Ga0501046_0000022_206567_207628 | 336 |
| 264 | 3300049581 | Ga0501047_0000021 | Ga0501047_0000021_206625_207686 | 336 |
| 265 | 3300049582 | Ga0501048_0003510 | Ga0501048_0003510_3034_4095 | 336 |
| 266 | 3300053085 | Ga0495619_0042548 | Ga0495619_0042548_1492_2658 | 336 |
| 267 | 3300005344 | Ga0070661_100036305 | Ga0070661_1000363052 | 337 |
| 268 | 3300005564 | Ga0070664_100028464 | Ga0070664_1000284643 | 337 |
| 269 | 3300005616 | Ga0068852_100137041 | Ga0068852_1001370411 | 337 |
| 270 | 3300005834 | Ga0068851_10049004 | Ga0068851_100490042 | 337 |
| 271 | 3300013105 | Ga0157369_10052019 | Ga0157369_100520193 | 337 |
| 272 | 3300013307 | Ga0157372_10243311 | Ga0157372_102433112 | 337 |
| 273 | 3300025920 | Ga0207649_10039934 | Ga0207649_100399342 | 337 |
| 274 | 3300060353 | Ga0501082_0077085 | Ga0501082_0077085_490_1644 | 337 |
| 275 | 3300035172 | Ga0373955_0026361 | Ga0373955_0026361_757_1884 | 338 |
| 276 | 3300035410 | Ga0373924_0006601 | Ga0373924_0006601_583_1728 | 338 |
| 277 | 3300036401 | Ga0373937_0032018 | Ga0373937_0032018_1040_2167 | 338 |
| 278 | 3300037068 | Ga0373925_0233943 | Ga0373925_0233943_214_1341 | 338 |
| 279 | 3300046454 | Ga0495592_0063538 | Ga0495592_0063538_381_1508 | 338 |
| 280 | 3300046462 | Ga0495651_0007571 | Ga0495651_0007571_4389_5516 | 338 |
| 281 | 3300046463 | Ga0495653_0007240 | Ga0495653_0007240_2158_3285 | 338 |
| 282 | 3300046477 | Ga0495664_0033125 | Ga0495664_0033125_1726_2853 | 338 |
| 283 | 3300046511 | Ga0495608_0016080 | Ga0495608_0016080_1517_2644 | 338 |
| 284 | 3300046516 | Ga0495628_0023409 | Ga0495628_0023409_1582_2709 | 338 |
| 285 | 3300046517 | Ga0495630_0018764 | Ga0495630_0018764_1550_2677 | 338 |
| 286 | 3300046529 | Ga0495652_0036330 | Ga0495652_0036330_2802_3929 | 338 |
| 287 | 3300046533 | Ga0495640_0014254 | Ga0495640_0014254_2940_4067 | 338 |
| 288 | 3300046536 | Ga0495587_0002421 | Ga0495587_0002421_4993_6120 | 338 |
| 289 | 3300046543 | Ga0495645_0005680 | Ga0495645_0005680_2590_3717 | 338 |
| 290 | 3300046559 | Ga0495667_0000293 | Ga0495667_0000293_13491_14618 | 338 |
| 291 | 3300046642 | Ga0495634_0026307 | Ga0495634_0026307_2012_3139 | 338 |
| 292 | 3300046663 | Ga0495635_0037690 | Ga0495635_0037690_1614_2741 | 338 |
| 293 | 3300046679 | Ga0495623_0018229 | Ga0495623_0018229_1738_2865 | 338 |
| 294 | 3300046680 | Ga0495646_0001995 | Ga0495646_0001995_8551_9678 | 338 |
| 295 | 3300046689 | Ga0495613_0061734 | Ga0495613_0061734_1520_2647 | 338 |
| 296 | 3300046809 | Ga0495600_0032156 | Ga0495600_0032156_1427_2554 | 338 |
| 297 | 3300047317 | Ga0495604_0003730 | Ga0495604_0003730_2582_3709 | 338 |
| 298 | 3300047319 | Ga0495674_0001748 | Ga0495674_0001748_17675_18802 | 338 |
| 299 | 3300047322 | Ga0495680_0003160 | Ga0495680_0003160_11121_12248 | 338 |
| 300 | 3300047444 | Ga0495675_0013454 | Ga0495675_0013454_2625_3752 | 338 |
| 301 | 3300048088 | Ga0495602_0003569 | Ga0495602_0003569_2600_3727 | 338 |
| 302 | 3300049581 | Ga0501047_0067747 | Ga0501047_0067747_101_1222 | 338 |
| 303 | 3300049586 | Ga0501070_0031620 | Ga0501070_0031620_1155_2276 | 338 |
| 304 | 3300049589 | Ga0501073_0042997 | Ga0501073_0042997_636_1757 | 338 |
| 305 | 3300049742 | Ga0501080_0010364 | Ga0501080_0010364_4912_6033 | 338 |
| 306 | 3300049742 | Ga0501080_0285865 | Ga0501080_0285865_306_1451 | 338 |
| 307 | 3300049744 | Ga0501083_0112604 | Ga0501083_0112604_551_1672 | 338 |
| 308 | 3300049822 | Ga0501035_0068818 | Ga0501035_0068818_37_1158 | 338 |
| 309 | 3300053077 | Ga0495601_0023907 | Ga0495601_0023907_2605_3732 | 338 |
| 310 | 3300053078 | Ga0495612_0002196 | Ga0495612_0002196_5849_6976 | 338 |
| 311 | 3300053084 | Ga0495595_0001285 | Ga0495595_0001285_1623_2750 | 338 |
| 312 | 3300053085 | Ga0495619_0008116 | Ga0495619_0008116_5163_6290 | 338 |
| 313 | 3300005983 | Ga0081540_1009885 | Ga0081540_10098855 | 339 |
| 314 | 3300005564 | Ga0070664_100016817 | Ga0070664_1000168172 | 340 |
| 315 | iso_pu_bacteria | 8004445564 | 8004451291 | 340 |
| 316 | 3300005334 | Ga0068869_100269756 | Ga0068869_1002697562 | 341 |
| 317 | 3300006237 | Ga0097621_100035711 | Ga0097621_1000357112 | 341 |
| 318 | 3300006358 | Ga0068871_100021589 | Ga0068871_1000215892 | 341 |
| 319 | 3300046454 | Ga0495592_0066301 | Ga0495592_0066301_1254_2378 | 341 |
| 320 | 3300046516 | Ga0495628_0227203 | Ga0495628_0227203_136_1260 | 341 |
| 321 | 3300046536 | Ga0495587_0034279 | Ga0495587_0034279_1798_2922 | 341 |
| 322 | 3300046543 | Ga0495645_0004831 | Ga0495645_0004831_5916_7040 | 341 |
| 323 | 3300046663 | Ga0495635_0063114 | Ga0495635_0063114_1179_2303 | 341 |
| 324 | 3300046675 | Ga0495657_0027802 | Ga0495657_0027802_723_1847 | 341 |
| 325 | 3300046679 | Ga0495623_0073494 | Ga0495623_0073494_65_1189 | 341 |
| 326 | 3300049588 | Ga0501072_0004295 | Ga0501072_0004295_5747_6877 | 341 |
| 327 | 3300053077 | Ga0495601_0004409 | Ga0495601_0004409_5004_6128 | 341 |
| 328 | 3300053085 | Ga0495619_0017076 | Ga0495619_0017076_3213_4337 | 341 |
| 329 | 3300054114 | Ga0501084_0253460 | Ga0501084_0253460_220_1350 | 341 |
| 330 | iso_pu_bacteria | 2847670302 | 2847675386 | 342 |
| 331 | iso_pu_bacteria | 2878035449 | 2878042617 | 342 |
| 332 | 3300026078 | Ga0207702_10181386 | Ga0207702_101813861 | 343 |
| 333 | 3300035118 | Ga0373954_0000001 | Ga0373954_0000001_125007_126149 | 343 |
| 334 | 3300035172 | Ga0373955_0018192 | Ga0373955_0018192_1703_2845 | 343 |
| 335 | 3300036401 | Ga0373937_0005181 | Ga0373937_0005181_7346_8488 | 343 |
| 336 | 3300037312 | Ga0395899_0001564 | Ga0395899_0001564_14984_16078 | 343 |
| 337 | 3300037418 | Ga0395900_0018529 | Ga0395900_0018529_3375_4469 | 343 |
| 338 | 3300037466 | Ga0395898_0003262 | Ga0395898_0003262_2435_3529 | 343 |
| 339 | 3300037471 | Ga0395905_0000126 | Ga0395905_0000126_18281_19375 | 343 |
| 340 | 3300037471 | Ga0395905_0017017 | Ga0395905_0017017_156_1250 | 343 |
| 341 | 3300037471 | Ga0395905_0041120 | Ga0395905_0041120_2076_3170 | 343 |
| 342 | 3300038443 | Ga0395901_0069291 | Ga0395901_0069291_1773_2867 | 343 |
| 343 | 3300049586 | Ga0501070_0069169 | Ga0501070_0069169_15_1157 | 344 |
| 344 | 3300005614 | Ga0068856_100058259 | Ga0068856_1000582592 | 345 |
| 345 | 3300025949 | Ga0207667_10286994 | Ga0207667_102869942 | 345 |
| 346 | 3300049590 | Ga0501074_0006077 | Ga0501074_0006077_2046_3179 | 345 |
| 347 | 3300005331 | Ga0070670_100040336 | Ga0070670_1000403363 | 346 |
| 348 | 3300005338 | Ga0068868_100208250 | Ga0068868_1002082501 | 346 |
| 349 | 3300005344 | Ga0070661_100001831 | Ga0070661_1000018317 | 346 |
| 350 | 3300005456 | Ga0070678_100208449 | Ga0070678_1002084491 | 346 |
| 351 | 3300005564 | Ga0070664_100009647 | Ga0070664_1000096472 | 346 |
| 352 | 3300005616 | Ga0068852_100002065 | Ga0068852_1000020651 | 346 |
| 353 | 3300005834 | Ga0068851_10002317 | Ga0068851_100023179 | 346 |
| 354 | 3300006237 | Ga0097621_100303583 | Ga0097621_1003035832 | 346 |
| 355 | 3300013105 | Ga0157369_10111519 | Ga0157369_101115192 | 346 |
| 356 | 3300013307 | Ga0157372_10133216 | Ga0157372_101332162 | 346 |
| 357 | 3300025321 | Ga0207656_10014690 | Ga0207656_100146902 | 346 |
| 358 | 3300025903 | Ga0207680_10048735 | Ga0207680_100487352 | 346 |
| 359 | 3300025909 | Ga0207705_10118089 | Ga0207705_101180892 | 346 |
| 360 | 3300025920 | Ga0207649_10117885 | Ga0207649_101178852 | 346 |
| 361 | 3300025932 | Ga0207690_10090755 | Ga0207690_100907551 | 346 |
| 362 | 3300025945 | Ga0207679_10009854 | Ga0207679_100098541 | 346 |
| 363 | 3300025981 | Ga0207640_10082952 | Ga0207640_100829521 | 346 |
| 364 | 3300026142 | Ga0207698_10095682 | Ga0207698_100956822 | 346 |
| 365 | 3300049823 | Ga0501044_0257803 | Ga0501044_0257803_561_1655 | 346 |
| 366 | iso_pu_bacteria | 2513237094 | 2513643176 | 346 |
| 367 | iso_pu_bacteria | 2643221651 | 2644287152 | 346 |
| 368 | 3300046543 | Ga0495645_0010684 | Ga0495645_0010684_3149_4249 | 347 |
| 369 | iso_pu_bacteria | 2599185301 | 2599940885 | 348 |
| 370 | iso_pu_bacteria | 2847686936 | 2847692002 | 348 |
| 371 | iso_pu_bacteria | 2856314179 | 2856320307 | 348 |
| 372 | iso_pu_bacteria | 2871444079 | 2871446624 | 348 |
| 373 | iso_pu_bacteria | 2874102143 | 2874103760 | 348 |
| 374 | iso_pu_bacteria | 2874123672 | 2874127119 | 348 |
| 375 | iso_pu_bacteria | 2876369609 | 2876371127 | 348 |
| 376 | iso_pu_bacteria | 2881147464 | 2881149372 | 348 |
| 377 | iso_pu_bacteria | 2888350351 | 2888354510 | 348 |
| 378 | iso_pu_bacteria | 2906328253 | 2906330261 | 348 |
| 379 | iso_pu_bacteria | 2906414383 | 2906420913 | 348 |
| 380 | iso_pu_bacteria | 2906626472 | 2906634842 | 348 |
| 381 | iso_pu_bacteria | 2922130491 | 2922132073 | 348 |
| 382 | iso_pu_bacteria | 2922158528 | 2922165267 | 348 |
| 383 | iso_pu_bacteria | 2924726620 | 2924727541 | 348 |
| 384 | iso_pu_bacteria | 2937891427 | 2937893881 | 348 |
| 385 | iso_pu_bacteria | 2958115193 | 2958118208 | 348 |
| 386 | iso_pu_bacteria | 2965062239 | 2965066409 | 348 |
| 387 | iso_pu_bacteria | 2968091066 | 2968092112 | 348 |
| 388 | iso_pu_bacteria | 2968097103 | 2968098614 | 348 |
| 389 | iso_pu_bacteria | 2968128360 | 2968130766 | 348 |
| 390 | iso_pu_bacteria | 2977858184 | 2977860599 | 348 |
| 391 | iso_pu_bacteria | 2979742915 | 2979750839 | 348 |
| 392 | iso_pu_bacteria | 2979779861 | 2979782498 | 348 |
| 393 | iso_pu_bacteria | 2996341866 | 2996346521 | 348 |
| 394 | iso_pu_bacteria | 8004703790 | 8004709111 | 348 |
| 395 | 3300005366 | Ga0070659_100168536 | Ga0070659_1001685362 | 349 |
| 396 | 3300005539 | Ga0068853_100183987 | Ga0068853_1001839872 | 349 |
| 397 | 3300013105 | Ga0157369_10013944 | Ga0157369_100139449 | 349 |
| 398 | 3300025919 | Ga0207657_10193448 | Ga0207657_101934482 | 349 |
| 399 | 3300025949 | Ga0207667_10274172 | Ga0207667_102741722 | 349 |
| 400 | 3300026142 | Ga0207698_10294985 | Ga0207698_102949852 | 349 |
| 401 | iso_pu_bacteria | 2791355082 | 2792584770 | 349 |
| 402 | iso_pu_bacteria | 2802429268 | 2804755278 | 349 |
| 403 | iso_pu_bacteria | 2913295892 | 2913296021 | 349 |
| 404 | iso_pu_bacteria | 8049293176 | 8049297900 | 349 |
| 405 | 3300005327 | Ga0070658_10080380 | Ga0070658_100803802 | 350 |
| 406 | 3300005366 | Ga0070659_100115143 | Ga0070659_1001151432 | 350 |
| 407 | 3300005563 | Ga0068855_100022311 | Ga0068855_1000223114 | 350 |
| 408 | 3300005616 | Ga0068852_100007728 | Ga0068852_1000077283 | 350 |
| 409 | 3300009551 | Ga0105238_10016630 | Ga0105238_100166303 | 350 |
| 410 | 3300013104 | Ga0157370_10153070 | Ga0157370_101530702 | 350 |
| 411 | 3300013105 | Ga0157369_10002022 | Ga0157369_100020227 | 350 |
| 412 | 3300013296 | Ga0157374_10104198 | Ga0157374_101041982 | 350 |
| 413 | 3300013307 | Ga0157372_10009509 | Ga0157372_100095099 | 350 |
| 414 | 3300013307 | Ga0157372_10298891 | Ga0157372_102988912 | 350 |
| 415 | 3300025909 | Ga0207705_10138788 | Ga0207705_101387882 | 350 |
| 416 | 3300025913 | Ga0207695_10038581 | Ga0207695_100385814 | 350 |
| 417 | 3300025932 | Ga0207690_10032515 | Ga0207690_100325152 | 350 |
| 418 | 3300025932 | Ga0207690_10151460 | Ga0207690_101514602 | 350 |
| 419 | 3300025949 | Ga0207667_10203916 | Ga0207667_102039162 | 350 |
| 420 | 3300026142 | Ga0207698_10021638 | Ga0207698_100216384 | 350 |
| 421 | 3300035724 | Ga0373933_0186966 | Ga0373933_0186966_34_1155 | 351 |
| 422 | 3300046454 | Ga0495592_0165457 | Ga0495592_0165457_343_1464 | 351 |
| 423 | 3300046529 | Ga0495652_0016901 | Ga0495652_0016901_1456_2592 | 351 |
| 424 | 3300046543 | Ga0495645_0000056 | Ga0495645_0000056_38835_39971 | 351 |
| 425 | 3300046559 | Ga0495667_0135517 | Ga0495667_0135517_447_1568 | 351 |
| 426 | 3300046678 | Ga0495599_0016654 | Ga0495599_0016654_1388_2524 | 351 |
| 427 | 3300047471 | Ga0495684_0055876 | Ga0495684_0055876_240_1361 | 351 |
| 428 | 3300035695 | Ga0373927_0010594 | Ga0373927_0010594_412_1539 | 352 |
| 429 | 3300035725 | Ga0373947_0039702 | Ga0373947_0039702_275_1402 | 352 |
| 430 | 3300047321 | Ga0495676_0059396 | Ga0495676_0059396_316_1443 | 352 |
| 431 | 3300049579 | Ga0501043_0020921 | Ga0501043_0020921_2568_3692 | 352 |
| 432 | 3300049581 | Ga0501047_0023869 | Ga0501047_0023869_701_1825 | 352 |
| 433 | iso_pu_bacteria | 2965119406 | 2965123502 | 352 |
| 434 | 3300005336 | Ga0070680_100034827 | Ga0070680_1000348272 | 353 |
| 435 | 3300005530 | Ga0070679_100035826 | Ga0070679_1000358263 | 353 |
| 436 | 3300025917 | Ga0207660_10118138 | Ga0207660_101181381 | 353 |
| 437 | 3300025921 | Ga0207652_10023700 | Ga0207652_100237006 | 353 |
| 438 | 3300036712 | Ga0316584_0010926 | Ga0316584_0010926_1806_2945 | 353 |
| 439 | 3300049581 | Ga0501047_0104367 | Ga0501047_0104367_1371_2504 | 353 |
| 440 | 3300049586 | Ga0501070_0000979 | Ga0501070_0000979_22802_23935 | 353 |
| 441 | 3300049589 | Ga0501073_0054936 | Ga0501073_0054936_1585_2718 | 353 |
| 442 | 3300049741 | Ga0501079_0008169 | Ga0501079_0008169_1399_2532 | 353 |
| 443 | 3300049742 | Ga0501080_0022597 | Ga0501080_0022597_2800_3933 | 353 |
| 444 | 3300049823 | Ga0501044_0298528 | Ga0501044_0298528_341_1474 | 353 |
| 445 | 3300005339 | Ga0070660_100017014 | Ga0070660_1000170142 | 354 |
| 446 | 3300005458 | Ga0070681_10089843 | Ga0070681_100898432 | 354 |
| 447 | 3300005564 | Ga0070664_100094650 | Ga0070664_1000946502 | 354 |
| 448 | 3300013307 | Ga0157372_10043976 | Ga0157372_100439762 | 354 |
| 449 | 3300025912 | Ga0207707_10033524 | Ga0207707_100335243 | 354 |
| 450 | 3300025918 | Ga0207662_10111683 | Ga0207662_101116832 | 354 |
| 451 | 3300025919 | Ga0207657_10005722 | Ga0207657_1000572214 | 354 |
| 452 | 3300025921 | Ga0207652_10184286 | Ga0207652_101842862 | 354 |
| 453 | 3300025945 | Ga0207679_10026327 | Ga0207679_100263273 | 354 |
| 454 | 3300031852 | Ga0307410_10015234 | Ga0307410_100152344 | 354 |
| 455 | 3300035116 | Ga0373945_0034565 | Ga0373945_0034565_624_1745 | 354 |
| 456 | 3300035170 | Ga0373943_0036182 | Ga0373943_0036182_320_1441 | 354 |
| 457 | 3300035692 | Ga0373935_0031819 | Ga0373935_0031819_1594_2715 | 354 |
| 458 | 3300035695 | Ga0373927_0127253 | Ga0373927_0127253_29_1150 | 354 |
| 459 | 3300035725 | Ga0373947_0041584 | Ga0373947_0041584_1028_2149 | 354 |
| 460 | 3300036401 | Ga0373937_0020151 | Ga0373937_0020151_3381_4502 | 354 |
| 461 | 3300037068 | Ga0373925_0010065 | Ga0373925_0010065_3396_4517 | 354 |
| 462 | 3300037068 | Ga0373925_0033237 | Ga0373925_0033237_1981_3123 | 354 |
| 463 | 3300037068 | Ga0373925_0149014 | Ga0373925_0149014_169_1293 | 354 |
| 464 | 3300046459 | Ga0495629_0020556 | Ga0495629_0020556_3066_4187 | 354 |
| 465 | 3300046463 | Ga0495653_0203989 | Ga0495653_0203989_76_1197 | 354 |
| 466 | 3300046473 | Ga0495582_0003184 | Ga0495582_0003184_2585_3706 | 354 |
| 467 | 3300046531 | Ga0495665_0011441 | Ga0495665_0011441_859_1980 | 354 |
| 468 | 3300046663 | Ga0495635_0168396 | Ga0495635_0168396_268_1389 | 354 |
| 469 | 3300046681 | Ga0495647_0002608 | Ga0495647_0002608_3033_4154 | 354 |
| 470 | 3300046683 | Ga0495658_0013527 | Ga0495658_0013527_1848_2969 | 354 |
| 471 | 3300046689 | Ga0495613_0078920 | Ga0495613_0078920_55_1176 | 354 |
| 472 | 3300047315 | Ga0495581_0001661 | Ga0495581_0001661_5208_6329 | 354 |
| 473 | 3300047471 | Ga0495684_0002788 | Ga0495684_0002788_2584_3705 | 354 |
| 474 | 3300053078 | Ga0495612_0102634 | Ga0495612_0102634_52_1194 | 354 |
| 475 | 3300053085 | Ga0495619_0007680 | Ga0495619_0007680_1271_2392 | 354 |
| 476 | 3300005290 | Ga0065712_10074754 | Ga0065712_100747543 | 355 |
| 477 | 3300005293 | Ga0065715_10097391 | Ga0065715_100973912 | 355 |
| 478 | 3300005328 | Ga0070676_10060667 | Ga0070676_100606672 | 355 |
| 479 | 3300005329 | Ga0070683_100005874 | Ga0070683_1000058747 | 355 |
| 480 | 3300005331 | Ga0070670_100083451 | Ga0070670_1000834512 | 355 |
| 481 | 3300005333 | Ga0070677_10024137 | Ga0070677_100241372 | 355 |
| 482 | 3300005334 | Ga0068869_100001503 | Ga0068869_1000015035 | 355 |
| 483 | 3300005339 | Ga0070660_100001424 | Ga0070660_1000014245 | 355 |
| 484 | 3300005340 | Ga0070689_100011227 | Ga0070689_1000112272 | 355 |
| 485 | 3300005344 | Ga0070661_100003536 | Ga0070661_1000035368 | 355 |
| 486 | 3300005344 | Ga0070661_100054690 | Ga0070661_1000546902 | 355 |
| 487 | 3300005353 | Ga0070669_100054090 | Ga0070669_1000540902 | 355 |
| 488 | 3300005353 | Ga0070669_100094003 | Ga0070669_1000940031 | 355 |
| 489 | 3300005354 | Ga0070675_100059524 | Ga0070675_1000595242 | 355 |
| 490 | 3300005354 | Ga0070675_100061771 | Ga0070675_1000617712 | 355 |
| 491 | 3300005355 | Ga0070671_100337845 | Ga0070671_1003378451 | 355 |
| 492 | 3300005364 | Ga0070673_100017633 | Ga0070673_1000176332 | 355 |
| 493 | 3300005366 | Ga0070659_100028613 | Ga0070659_1000286133 | 355 |
| 494 | 3300005367 | Ga0070667_100044467 | Ga0070667_1000444674 | 355 |
| 495 | 3300005441 | Ga0070700_100055462 | Ga0070700_1000554621 | 355 |
| 496 | 3300005455 | Ga0070663_100121082 | Ga0070663_1001210822 | 355 |
| 497 | 3300005457 | Ga0070662_100000836 | Ga0070662_1000008364 | 355 |
| 498 | 3300005466 | Ga0070685_10001881 | Ga0070685_100018815 | 355 |
| 499 | 3300005543 | Ga0070672_100034784 | Ga0070672_1000347842 | 355 |
| 500 | 3300005563 | Ga0068855_100002546 | Ga0068855_1000025463 | 355 |
| 501 | 3300005563 | Ga0068855_100341898 | Ga0068855_1003418982 | 355 |
| 502 | 3300005564 | Ga0070664_100151243 | Ga0070664_1001512432 | 355 |
| 503 | 3300005578 | Ga0068854_100100417 | Ga0068854_1001004172 | 355 |
| 504 | 3300005614 | Ga0068856_100001602 | Ga0068856_1000016025 | 355 |
| 505 | 3300005616 | Ga0068852_100028380 | Ga0068852_1000283803 | 355 |
| 506 | 3300005617 | Ga0068859_100043553 | Ga0068859_1000435535 | 355 |
| 507 | 3300005719 | Ga0068861_100064739 | Ga0068861_1000647392 | 355 |
| 508 | 3300005834 | Ga0068851_10010765 | Ga0068851_100107652 | 355 |
| 509 | 3300005841 | Ga0068863_100010980 | Ga0068863_1000109808 | 355 |
| 510 | 3300005842 | Ga0068858_100062480 | Ga0068858_1000624802 | 355 |
| 511 | 3300005844 | Ga0068862_100013593 | Ga0068862_1000135936 | 355 |
| 512 | 3300006358 | Ga0068871_100192063 | Ga0068871_1001920632 | 355 |
| 513 | 3300006881 | Ga0068865_100005114 | Ga0068865_1000051145 | 355 |
| 514 | 3300006931 | Ga0097620_100043554 | Ga0097620_1000435545 | 355 |
| 515 | 3300009093 | Ga0105240_10170468 | Ga0105240_101704682 | 355 |
| 516 | 3300009094 | Ga0111539_10022960 | Ga0111539_100229606 | 355 |
| 517 | 3300009148 | Ga0105243_10240364 | Ga0105243_102403641 | 355 |
| 518 | 3300013100 | Ga0157373_10000924 | Ga0157373_100009243 | 355 |
| 519 | 3300013102 | Ga0157371_10000522 | Ga0157371_1000052220 | 355 |
| 520 | 3300013104 | Ga0157370_10019308 | Ga0157370_100193088 | 355 |
| 521 | 3300013297 | Ga0157378_10157456 | Ga0157378_101574562 | 355 |
| 522 | 3300013306 | Ga0163162_10048954 | Ga0163162_100489542 | 355 |
| 523 | 3300013307 | Ga0157372_10000791 | Ga0157372_100007917 | 355 |
| 524 | 3300013307 | Ga0157372_10212922 | Ga0157372_102129221 | 355 |
| 525 | 3300014968 | Ga0157379_10009512 | Ga0157379_100095125 | 355 |
| 526 | 3300025315 | Ga0207697_10000450 | Ga0207697_1000045014 | 355 |
| 527 | 3300025321 | Ga0207656_10005762 | Ga0207656_100057622 | 355 |
| 528 | 3300025901 | Ga0207688_10010358 | Ga0207688_100103584 | 355 |
| 529 | 3300025907 | Ga0207645_10001587 | Ga0207645_100015879 | 355 |
| 530 | 3300025908 | Ga0207643_10000429 | Ga0207643_1000042914 | 355 |
| 531 | 3300025913 | Ga0207695_10070564 | Ga0207695_100705642 | 355 |
| 532 | 3300025918 | Ga0207662_10022596 | Ga0207662_100225962 | 355 |
| 533 | 3300025919 | Ga0207657_10000657 | Ga0207657_1000065730 | 355 |
| 534 | 3300025920 | Ga0207649_10007402 | Ga0207649_100074026 | 355 |
| 535 | 3300025920 | Ga0207649_10032774 | Ga0207649_100327742 | 355 |
| 536 | 3300025923 | Ga0207681_10016827 | Ga0207681_100168272 | 355 |
| 537 | 3300025925 | Ga0207650_10000503 | Ga0207650_1000050313 | 355 |
| 538 | 3300025926 | Ga0207659_10001307 | Ga0207659_1000130710 | 355 |
| 539 | 3300025932 | Ga0207690_10000412 | Ga0207690_1000041226 | 355 |
| 540 | 3300025933 | Ga0207706_10000164 | Ga0207706_1000016430 | 355 |
| 541 | 3300025933 | Ga0207706_10066056 | Ga0207706_100660562 | 355 |
| 542 | 3300025936 | Ga0207670_10003032 | Ga0207670_100030328 | 355 |
| 543 | 3300025940 | Ga0207691_10071179 | Ga0207691_100711792 | 355 |
| 544 | 3300025942 | Ga0207689_10003889 | Ga0207689_100038892 | 355 |
| 545 | 3300025944 | Ga0207661_10157323 | Ga0207661_101573231 | 355 |
| 546 | 3300025945 | Ga0207679_10000601 | Ga0207679_1000060118 | 355 |
| 547 | 3300025945 | Ga0207679_10052132 | Ga0207679_100521322 | 355 |
| 548 | 3300025949 | Ga0207667_10003052 | Ga0207667_100030525 | 355 |
| 549 | 3300025949 | Ga0207667_10250929 | Ga0207667_102509292 | 355 |
| 550 | 3300025960 | Ga0207651_10052331 | Ga0207651_100523312 | 355 |
| 551 | 3300025986 | Ga0207658_10045089 | Ga0207658_100450892 | 355 |
| 552 | 3300025986 | Ga0207658_10064037 | Ga0207658_100640372 | 355 |
| 553 | 3300026067 | Ga0207678_10148156 | Ga0207678_101481562 | 355 |
| 554 | 3300026067 | Ga0207678_10163519 | Ga0207678_101635192 | 355 |
| 555 | 3300026075 | Ga0207708_10057134 | Ga0207708_100571342 | 355 |
| 556 | 3300026078 | Ga0207702_10001837 | Ga0207702_1000183711 | 355 |
| 557 | 3300026089 | Ga0207648_10068279 | Ga0207648_100682791 | 355 |
| 558 | 3300026095 | Ga0207676_10049890 | Ga0207676_100498902 | 355 |
| 559 | 3300026118 | Ga0207675_100004233 | Ga0207675_10000423311 | 355 |
| 560 | 3300026142 | Ga0207698_10007413 | Ga0207698_100074135 | 355 |
| 561 | 3300026142 | Ga0207698_10027156 | Ga0207698_100271562 | 355 |
| 562 | 3300027876 | Ga0209974_10004530 | Ga0209974_100045306 | 355 |
| 563 | 3300028381 | Ga0268264_10162997 | Ga0268264_101629972 | 355 |
| 564 | 3300035116 | Ga0373945_0043741 | Ga0373945_0043741_195_1322 | 355 |
| 565 | 3300035410 | Ga0373924_0000883 | Ga0373924_0000883_3344_4468 | 355 |
| 566 | 3300035725 | Ga0373947_0015771 | Ga0373947_0015771_126_1253 | 355 |
| 567 | 3300037068 | Ga0373925_0025023 | Ga0373925_0025023_2064_3191 | 355 |
| 568 | 3300048904 | Ga0496101_0009607 | Ga0496101_0009607_1027_2154 | 355 |
| 569 | 3300048905 | Ga0496102_0028354 | Ga0496102_0028354_890_2011 | 355 |
| 570 | 3300048907 | Ga0496104_0091398 | Ga0496104_0091398_930_2057 | 355 |
| 571 | 3300048908 | Ga0496105_0062729 | Ga0496105_0062729_552_1679 | 355 |
| 572 | 3300048909 | Ga0496106_0005422 | Ga0496106_0005422_1425_2546 | 355 |
| 573 | 3300048909 | Ga0496106_0173454 | Ga0496106_0173454_492_1619 | 355 |
| 574 | 3300048910 | Ga0496107_0038768 | Ga0496107_0038768_1136_2257 | 355 |
| 575 | 3300048912 | Ga0496109_0101135 | Ga0496109_0101135_666_1793 | 355 |
| 576 | 3300048913 | Ga0496110_0034960 | Ga0496110_0034960_236_1363 | 355 |
| 577 | 3300050511 | nmdc:mga08y16_332360_c1 | nmdc:mga08y16_332360_c1_423_1550 | 355 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2rmk-assembly1.cif.gz_B | rac1/prk1 complex | 0.8047 | 79 | 152 |
| 4i9q-assembly2.cif.gz_B | crystal structure of the ternary complex of the d714a mutant of rb69 dna polymerase | 0.7244 | 82 | 154 |
| 2rmk-assembly1.cif.gz_B | rac1/prk1 complex | 0.7025 | 79 | 152 |
| 2zdi-assembly1.cif.gz_B-2 | crystal structure of prefoldin from pyrococcus horikoshii ot3 | 0.6725 | 72 | 160 |
| 6vjf-assembly2.cif.gz_C | the p-loop k to a mutation of c. therm vps1 gtpase-bse | 0.6412 | 67 | 142 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 2rmkB00 | Mainly Alpha;Orthogonal Bundle;Helix Hairpins;HR1 repeat | 0.8047 | 79 | 152 | 1.10.287.160 |
| 5x60A03 | Mainly Alpha;Orthogonal Bundle;Helix Hairpins;ATP synthase, gamma subunit, helix hairpin domain | 0.7718 | 71 | 156 | 1.10.287.80 |
| 2x0lA03 | Mainly Alpha;Orthogonal Bundle;Helix Hairpins;ATP synthase, gamma subunit, helix hairpin domain | 0.7662 | 71 | 156 | 1.10.287.80 |
| 5h6rA03 | Mainly Alpha;Orthogonal Bundle;Helix Hairpins;ATP synthase, gamma subunit, helix hairpin domain | 0.7638 | 71 | 156 | 1.10.287.80 |
| 5lhhA03 | Mainly Alpha;Orthogonal Bundle;Helix Hairpins;ATP synthase, gamma subunit, helix hairpin domain | 0.7614 | 71 | 156 | 1.10.287.80 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-H9ZS63-F1-model_v4 | TRAP-type mannitol/chloroaromatic compound transport system, small permease component | 0.896 | 193 | 355 |
GO:0005886
|
| AF-A0A1V5DVT7-F1-model_v4 | 2,3-diketo-L-gulonate TRAP transporter small permease protein YiaM | 0.8918 | 193 | 354 |
GO:0005886
|
| AF-A0A661RPS1-F1-model_v4 | Transporter | 0.8907 | 193 | 350 |
GO:0005886
|
| AF-A0A1J5DU15-F1-model_v4 | C4-dicarboxylate ABC transporter substrate-binding protein | 0.8905 | 193 | 350 |
GO:0005886
|
| AF-A0A1H0SP04-F1-model_v4 | TRAP-type mannitol/chloroaromatic compound transport system, small permease component | 0.887 | 193 | 354 |
GO:0005886
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar