F465483

General Info

Members Datasets Scaffolds Average Seq Length
576 279 1152 147

Family's Representative Sequence

Representative Sequence 3300005440|Ga0070705_100022317|Ga0070705_1000223172
Length 157
Sequence VEICGEKWFKTVFRGHEQARIDDKGRLKIPNVFRSLLESKYGRELFLTSLTGEYVRVYPMPVWMDKEEKLGQMPSTHPSRLRFLDRINFFGQVAELDTQGRVLVPVRLRETATMNGDVDVLGQYDYLEVWNHDRFLTKLQRDPYTDEDARALSEFGI

Samples

Sample ID Description Type Environment
1 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
2 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
13 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
14 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
15 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
16 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
17 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
18 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
19 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
20 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
21 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
22 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
23 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
24 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
25 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
26 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
27 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
28 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
29 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
30 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
31 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
32 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
33 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
34 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
35 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
36 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
37 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
38 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
39 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
40 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
41 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
42 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
43 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
44 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
45 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
46 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
47 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
48 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
49 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
50 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
51 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
52 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
53 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
54 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
55 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
56 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
57 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
58 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
59 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
60 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
61 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
62 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
63 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
64 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
65 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
66 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
67 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
68 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
69 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
70 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
71 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
72 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
73 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
74 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
75 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
76 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
77 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
78 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
79 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
80 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
81 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
82 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
83 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
84 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
85 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
86 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
87 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
88 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
89 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
90 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
91 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
92 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
93 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
94 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
95 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
96 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
97 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
98 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
99 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
100 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
101 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
102 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
103 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
104 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
105 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
106 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
107 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
108 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
109 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
110 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
111 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
112 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
113 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
114 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
115 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
116 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
117 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
170 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
174 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
175 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
176 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
177 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
178 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
179 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
180 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
181 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
182 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
183 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
184 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
185 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
186 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
187 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
188 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
189 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
190 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
191 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
192 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
193 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
194 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
195 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
196 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
197 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
198 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
199 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
200 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
201 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
202 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
203 3300042117 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0415F_E14_082316_1937 Metagenome Rhizosphere
204 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
205 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
206 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
207 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
208 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
209 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
210 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
211 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
212 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
213 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
214 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
215 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
216 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
217 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
218 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
219 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
220 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
221 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
222 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
223 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
224 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
225 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
226 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
227 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
228 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
229 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
230 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
231 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
232 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
233 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
234 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
235 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
236 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
237 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
238 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
239 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
240 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
241 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
242 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
243 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
244 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
245 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
246 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
247 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
248 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
249 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
250 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
251 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
252 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
253 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
254 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
255 3300049674 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought Metagenome Rhizosphere
256 3300049689 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_A_4_drought Metagenome Rhizosphere
257 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
258 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
259 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
260 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
261 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
262 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
263 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
264 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
265 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
266 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
267 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
268 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
269 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
270 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
271 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
272 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
273 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
274 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
275 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
276 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
277 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
278 3300059623 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
279 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.83
Metatranscriptomes 0.17
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.43
Nodule 0
Rhizoplane 6.94
Rhizosphere 90.45
Stem 0
Stem Tuber 0
Unclassified 19.97

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070705_100022317 3300005440 Bacteria 3381
2 Ga0065714_10084017 3300005288 Bacteria 2219
3 Ga0065712_10000308 3300005290 Bacteria 14971
4 Ga0065715_10000213 3300005293 Bacteria 23521
5 Ga0065715_10081286 3300005293 Unclassified 574
6 Ga0065715_10330405 3300005293 Bacteria 985
7 Ga0065715_10395229 3300005293 Unclassified 889
8 Ga0065707_10127578 3300005295 Bacteria 1981
9 Ga0065707_10152749 3300005295 Unclassified 1629
10 Ga0065707_10952107 3300005295 Unclassified 550
11 Ga0070676_10000699 3300005328 Bacteria 16384
12 Ga0070676_10595743 3300005328 Bacteria 796
13 Ga0070683_101154167 3300005329 Unclassified 744
14 Ga0070690_100050487 3300005330 Bacteria 2654
15 Ga0070690_101391753 3300005330 Unclassified 564
16 Ga0070670_100002445 3300005331 Bacteria 15313
17 Ga0070670_100747239 3300005331 Bacteria 881
18 Ga0070677_10078024 3300005333 Bacteria 1410
19 Ga0068869_100395948 3300005334 Bacteria 1135
20 Ga0068869_101065336 3300005334 Unclassified 706
21 Ga0070666_10004957 3300005335 Bacteria 8142
22 Ga0070666_10389702 3300005335 Unclassified 1001
23 Ga0070666_10601665 3300005335 Unclassified 802
24 Ga0070666_10931542 3300005335 Unclassified 643
25 Ga0070680_100391897 3300005336 Bacteria 1183
26 Ga0070682_100735524 3300005337 Unclassified 795
27 Ga0070682_101603318 3300005337 Bacteria 563
28 Ga0068868_100105624 3300005338 Bacteria 2284
29 Ga0068868_100510153 3300005338 Bacteria 1054
30 Ga0068868_100703765 3300005338 Unclassified 904
31 Ga0070660_100316084 3300005339 Bacteria 1282
32 Ga0070660_100355341 3300005339 Bacteria 1207
33 Ga0070689_101482743 3300005340 Bacteria 614
34 Ga0070691_10003375 3300005341 Bacteria 7177
35 Ga0070691_10535949 3300005341 Unclassified 682
36 Ga0070687_100012231 3300005343 Bacteria 3783
37 Ga0070661_100518241 3300005344 Unclassified 956
38 Ga0070692_10697561 3300005345 Unclassified 683
39 Ga0070692_10726110 3300005345 Unclassified 671
40 Ga0070668_100032293 3300005347 Bacteria 3984
41 Ga0070668_100079510 3300005347 Bacteria 2568
42 Ga0070668_100116114 3300005347 Unclassified 2134
43 Ga0070669_100063996 3300005353 Bacteria 2708
44 Ga0070669_100077946 3300005353 Unclassified 2462
45 Ga0070669_100083070 3300005353 Bacteria 2388
46 Ga0070669_100407409 3300005353 Bacteria 1114
47 Ga0070669_100933910 3300005353 Unclassified 742
48 Ga0070675_100006452 3300005354 Bacteria 9004
49 Ga0070675_100090381 3300005354 Bacteria 2564
50 Ga0070671_100084472 3300005355 Bacteria 2655
51 Ga0070674_100001022 3300005356 Bacteria 14594
52 Ga0070674_100577636 3300005356 Bacteria 947
53 Ga0070674_101095813 3300005356 Bacteria 703
54 Ga0070673_100085186 3300005364 Bacteria 2572
55 Ga0070673_100998841 3300005364 Unclassified 779
56 Ga0070673_101079243 3300005364 Bacteria 749
57 Ga0070688_100002479 3300005365 Bacteria 9336
58 Ga0070688_100193708 3300005365 Bacteria 1418
59 Ga0070688_100477171 3300005365 Unclassified 937
60 Ga0070659_100067976 3300005366 Bacteria 2826
61 Ga0070659_100263656 3300005366 Bacteria 1430
62 Ga0070659_100884924 3300005366 Bacteria 780
63 Ga0070667_100329243 3300005367 Bacteria 1380
64 Ga0070709_10617657 3300005434 Bacteria 836
65 Ga0070714_100054657 3300005435 Bacteria 3411
66 Ga0070713_100069420 3300005436 Unclassified 2971
67 Ga0070711_100439882 3300005439 Bacteria 1066
68 Ga0070705_100670725 3300005440 Bacteria 811
69 Ga0070700_100512886 3300005441 Bacteria 925
70 Ga0070694_100118502 3300005444 Bacteria 1896
71 Ga0070694_100168923 3300005444 Unclassified 1610
72 Ga0070694_100173150 3300005444 Bacteria 1591
73 Ga0070694_100377367 3300005444 Unclassified 1105
74 Ga0070708_100125466 3300005445 Bacteria 2372
75 Ga0070678_100543290 3300005456 Bacteria 1031
76 Ga0070678_100554136 3300005456 Bacteria 1021
77 Ga0070678_100807861 3300005456 Unclassified 852
78 Ga0070662_100225497 3300005457 Unclassified 1497
79 Ga0070662_100246524 3300005457 Bacteria 1434
80 Ga0070681_10001687 3300005458 Bacteria 19755
81 Ga0070681_10100393 3300005458 Bacteria 2840
82 Ga0068867_100006297 3300005459 Bacteria 8396
83 Ga0068867_100114752 3300005459 Bacteria 2074
84 Ga0068867_101476047 3300005459 Unclassified 632
85 Ga0070685_10426362 3300005466 Bacteria 924
86 Ga0070706_100194505 3300005467 Bacteria 1895
87 Ga0070706_100255748 3300005467 Bacteria 1635
88 Ga0070706_101186014 3300005467 Bacteria 702
89 Ga0070698_100019157 3300005471 Bacteria 7194
90 Ga0070698_100179963 3300005471 Bacteria 2053
91 Ga0070699_100001478 3300005518 Bacteria 21521
92 Ga0070699_100765976 3300005518 Unclassified 883
93 Ga0070699_101041988 3300005518 Bacteria 750
94 Ga0070699_101155666 3300005518 Unclassified 710
95 Ga0070679_100066335 3300005530 Unclassified 3598
96 Ga0070684_100043012 3300005535 Bacteria 3901
97 Ga0070684_100461261 3300005535 Bacteria 1175
98 Ga0070697_100062858 3300005536 Bacteria 3031
99 Ga0068853_100068677 3300005539 Bacteria 3081
100 Ga0068853_100284770 3300005539 Bacteria 1524
101 Ga0070672_100011942 3300005543 Bacteria 6071
102 Ga0070672_100108530 3300005543 Bacteria 2260
103 Ga0070686_100000389 3300005544 Bacteria 28031
104 Ga0070686_100039941 3300005544 Bacteria 2926
105 Ga0070686_100651508 3300005544 Unclassified 835
106 Ga0070686_101206669 3300005544 Unclassified 629
107 Ga0070686_101311377 3300005544 Unclassified 605
108 Ga0070695_100009348 3300005545 Bacteria 5832
109 Ga0070696_100040535 3300005546 Bacteria 3215
110 Ga0070696_100074021 3300005546 Bacteria 2401
111 Ga0070665_100126918 3300005548 Bacteria 2553
112 Ga0070665_100962200 3300005548 Bacteria 866
113 Ga0070704_100003916 3300005549 Bacteria 8569
114 Ga0070704_100465674 3300005549 Bacteria 1091
115 Ga0070704_100661690 3300005549 Bacteria 923
116 Ga0068855_100326094 3300005563 Bacteria 1696
117 Ga0068855_102119385 3300005563 Unclassified 566
118 Ga0070664_100030942 3300005564 Bacteria 4468
119 Ga0070664_100538416 3300005564 Bacteria 1079
120 Ga0070664_101388126 3300005564 Bacteria 664
121 Ga0070664_101504689 3300005564 Bacteria 637
122 Ga0068857_100453550 3300005577 Bacteria 1199
123 Ga0068854_100046445 3300005578 Bacteria 3091
124 Ga0068854_100060858 3300005578 Bacteria 2733
125 Ga0068854_100410962 3300005578 Bacteria 1122
126 Ga0070702_100002900 3300005615 Bacteria 7548
127 Ga0070702_100198972 3300005615 Bacteria 1325
128 Ga0070702_100660367 3300005615 Unclassified 792
129 Ga0068852_100528707 3300005616 Bacteria 1177
130 Ga0068852_100685203 3300005616 Bacteria 1034
131 Ga0068859_100106503 3300005617 Bacteria 2863
132 Ga0068864_100013922 3300005618 Bacteria 6667
133 Ga0068864_100017239 3300005618 Bacteria 6022
134 Ga0068864_100282412 3300005618 Bacteria 1550
135 Ga0068864_100365671 3300005618 Bacteria 1364
136 Ga0068864_101033686 3300005618 Bacteria 816
137 Ga0068864_101468075 3300005618 Unclassified 685
138 Ga0068866_10033184 3300005718 Bacteria 2502
139 Ga0068866_10058776 3300005718 Bacteria 1987
140 Ga0068866_10071608 3300005718 Unclassified 1834
141 Ga0068861_100009190 3300005719 Bacteria 6816
142 Ga0068861_100097507 3300005719 Bacteria 2332
143 Ga0068861_100174117 3300005719 Bacteria 1786
144 Ga0068861_100320647 3300005719 Bacteria 1349
145 Ga0068861_100570637 3300005719 Bacteria 1034
146 Ga0068861_101225821 3300005719 Bacteria 726
147 Ga0068861_101301000 3300005719 Unclassified 707
148 Ga0068851_10689483 3300005834 Bacteria 628
149 Ga0068870_10073047 3300005840 Bacteria 1876
150 Ga0068863_100067273 3300005841 Bacteria 3388
151 Ga0068863_100223645 3300005841 Bacteria 1814
152 Ga0068863_100717128 3300005841 Unclassified 995
153 Ga0068863_101910082 3300005841 Unclassified 604
154 Ga0068858_100172397 3300005842 Bacteria 2040
155 Ga0068858_100205387 3300005842 Unclassified 1864
156 Ga0068858_100624426 3300005842 Bacteria 1046
157 Ga0068858_101872050 3300005842 Unclassified 593
158 Ga0068860_100315367 3300005843 Bacteria 1534
159 Ga0068860_101500126 3300005843 Bacteria 696
160 Ga0068860_101560368 3300005843 Bacteria 682
161 Ga0068862_100053930 3300005844 Bacteria 3442
162 Ga0068862_100234202 3300005844 Bacteria 1667
163 Ga0068862_101457104 3300005844 Unclassified 689
164 Ga0081539_10018173 3300005985 Bacteria 4893
165 Ga0075365_10093141 3300006038 Bacteria 2055
166 Ga0075368_10023607 3300006042 Bacteria 2350
167 Ga0075364_10154510 3300006051 Bacteria 1547
168 Ga0070716_100641505 3300006173 Bacteria 804
169 Ga0075367_10009336 3300006178 Bacteria 5122
170 Ga0075366_10158996 3300006195 Unclassified 1369
171 Ga0097621_100473105 3300006237 Unclassified 1132
172 Ga0075370_10036457 3300006353 Bacteria 2762
173 Ga0075370_10556074 3300006353 Bacteria 694
174 Ga0068871_100053765 3300006358 Bacteria 3265
175 Ga0068871_100196345 3300006358 Bacteria 1741
176 Ga0068871_101698669 3300006358 Unclassified 599
177 Ga0075428_100022358 3300006844 Bacteria 7000
178 Ga0075428_100153012 3300006844 Bacteria 2506
179 Ga0075430_100035308 3300006846 Bacteria 4241
180 Ga0075430_100781401 3300006846 Bacteria 787
181 Ga0075431_100197362 3300006847 Bacteria 2060
182 Ga0075431_100487967 3300006847 Unclassified 1224
183 Ga0075433_10039282 3300006852 Bacteria 4091
184 Ga0075433_10486346 3300006852 Bacteria 1087
185 Ga0075433_10885958 3300006852 Bacteria 779
186 Ga0075434_100000731 3300006871 Bacteria 25794
187 Ga0075434_100018881 3300006871 Bacteria 6665
188 Ga0075434_100244350 3300006871 Bacteria 1815
189 Ga0075434_100287857 3300006871 Bacteria 1663
190 Ga0075434_100413416 3300006871 Bacteria 1370
191 Ga0068865_100080456 3300006881 Bacteria 2337
192 Ga0068865_100158523 3300006881 Bacteria 1724
193 Ga0068865_100381477 3300006881 Bacteria 1150
194 Ga0068865_101147293 3300006881 Unclassified 686
195 Ga0075436_100009966 3300006914 Bacteria 6501
196 Ga0075436_100022746 3300006914 Bacteria 4306
197 Ga0075436_100060104 3300006914 Bacteria 2625
198 Ga0097620_100106506 3300006931 Bacteria 2863
199 Ga0075435_100000404 3300007076 Bacteria 26487
200 Ga0075435_100009739 3300007076 Bacteria 6984
201 Ga0075435_100281052 3300007076 Bacteria 1421
202 Ga0099794_10097048 3300007265 Bacteria 1468
203 Ga0099794_10238596 3300007265 Bacteria 936
204 Ga0105240_10080775 3300009093 Bacteria 3997
205 Ga0105240_10093777 3300009093 Bacteria 3663
206 Ga0105240_10184078 3300009093 Bacteria 2462
207 Ga0105240_11527064 3300009093 Bacteria 700
208 Ga0111539_10005052 3300009094 Bacteria 17138
209 Ga0111539_11233185 3300009094 Bacteria 868
210 Ga0111539_11303543 3300009094 Viruses 843
211 Ga0105245_10776175 3300009098 Unclassified 995
212 Ga0105247_10009155 3300009101 Bacteria 6027
213 Ga0105247_10346093 3300009101 Unclassified 1044
214 Ga0114129_10000307 3300009147 Bacteria 57086
215 Ga0114129_10010344 3300009147 Bacteria 13304
216 Ga0114129_10140289 3300009147 Bacteria 3314
217 Ga0114129_10160737 3300009147 Bacteria 3069
218 Ga0114129_11291800 3300009147 Unclassified 905
219 Ga0114129_11540003 3300009147 Bacteria 816
220 Ga0105243_10061780 3300009148 Bacteria 2997
221 Ga0105243_10374497 3300009148 Bacteria 1315
222 Ga0105243_10686863 3300009148 Unclassified 996
223 Ga0105243_11205281 3300009148 Bacteria 770
224 Ga0105241_10097160 3300009174 Bacteria 2334
225 Ga0105242_10838739 3300009176 Bacteria 913
226 Ga0105248_10000664 3300009177 Bacteria 39095
227 Ga0105248_10040293 3300009177 Bacteria 5236
228 Ga0105248_10114714 3300009177 Bacteria 3039
229 Ga0105248_10491820 3300009177 Bacteria 1383
230 Ga0105248_10685640 3300009177 Bacteria 1156
231 Ga0105248_11603895 3300009177 Bacteria 737
232 Ga0105237_10925407 3300009545 Unclassified 879
233 Ga0105238_10290847 3300009551 Bacteria 1616
234 Ga0105238_10417001 3300009551 Unclassified 1337
235 Ga0105238_10642855 3300009551 Unclassified 1070
236 Ga0105238_11039961 3300009551 Bacteria 840
237 Ga0105249_10115323 3300009553 Bacteria 2545
238 Ga0105249_10261357 3300009553 Bacteria 1720
239 Ga0105249_10643114 3300009553 Bacteria 1118
240 Ga0105249_11367191 3300009553 Bacteria 780
241 Ga0105239_11566235 3300010375 Bacteria 762
242 Ga0105246_10091824 3300011119 Unclassified 2190
243 Ga0157374_10056074 3300013296 Bacteria 3678
244 Ga0157374_10162926 3300013296 Bacteria 2173
245 Ga0157374_10331843 3300013296 Bacteria 1509
246 Ga0157378_10278705 3300013297 Bacteria 1611
247 Ga0157378_10388130 3300013297 Bacteria 1373
248 Ga0157378_10944550 3300013297 Bacteria 895
249 Ga0163162_10148156 3300013306 Bacteria 2464
250 Ga0163162_11978185 3300013306 Unclassified 668
251 Ga0157375_10093208 3300013308 Bacteria 3077
252 Ga0157375_10106098 3300013308 Bacteria 2901
253 Ga0157375_10214328 3300013308 Bacteria 2083
254 Ga0163163_10160703 3300014325 Bacteria 2292
255 Ga0163163_11339028 3300014325 Unclassified 778
256 Ga0157380_10174980 3300014326 Bacteria 1879
257 Ga0157380_10207326 3300014326 Bacteria 1744
258 Ga0157380_10707860 3300014326 Bacteria 1013
259 Ga0182008_10626681 3300014497 Unclassified 606
260 Ga0157377_10283510 3300014745 Bacteria 1087
261 Ga0157379_10125289 3300014968 Bacteria 2312
262 Ga0157379_10245791 3300014968 Bacteria 1623
263 Ga0157376_10031004 3300014969 Bacteria 4276
264 Ga0157376_10040361 3300014969 Bacteria 3814
265 Ga0157376_10378264 3300014969 Unclassified 1363
266 Ga0157376_10989953 3300014969 Bacteria 863
267 Ga0157376_11049309 3300014969 Unclassified 839
268 Ga0157376_11369006 3300014969 Bacteria 739
269 Ga0157376_11401217 3300014969 Unclassified 731
270 Ga0163161_10009495 3300017792 Bacteria 6732
271 Ga0163161_10048184 3300017792 Bacteria 3077
272 Ga0163161_11068629 3300017792 Bacteria 692
273 Ga0207697_10096910 3300025315 Bacteria 1254
274 Ga0207697_10122552 3300025315 Bacteria 1120
275 Ga0207697_10123201 3300025315 Bacteria 1117
276 Ga0207682_10047425 3300025893 Bacteria 1769
277 Ga0207682_10095544 3300025893 Bacteria 1294
278 Ga0207642_10027345 3300025899 Bacteria 2333
279 Ga0207642_10246078 3300025899 Bacteria 1012
280 Ga0207710_10056671 3300025900 Bacteria 1769
281 Ga0207688_10033298 3300025901 Bacteria 2849
282 Ga0207688_10221295 3300025901 Bacteria 1140
283 Ga0207680_10044528 3300025903 Bacteria 2611
284 Ga0207680_10124271 3300025903 Bacteria 1692
285 Ga0207680_10231729 3300025903 Bacteria 1270
286 Ga0207645_10000703 3300025907 Bacteria 27863
287 Ga0207645_10053454 3300025907 Bacteria 2581
288 Ga0207643_10174739 3300025908 Bacteria 1298
289 Ga0207684_10719514 3300025910 Unclassified 847
290 Ga0207654_10247610 3300025911 Bacteria 1193
291 Ga0207707_10047226 3300025912 Bacteria 3750
292 Ga0207695_10177778 3300025913 Bacteria 2050
293 Ga0207695_10865882 3300025913 Bacteria 783
294 Ga0207662_10005881 3300025918 Bacteria 6580
295 Ga0207657_10116869 3300025919 Bacteria 2197
296 Ga0207649_10419814 3300025920 Bacteria 1004
297 Ga0207646_10701242 3300025922 Unclassified 905
298 Ga0207681_10018796 3300025923 Bacteria 4359
299 Ga0207681_10061229 3300025923 Bacteria 2586
300 Ga0207681_10353803 3300025923 Bacteria 1176
301 Ga0207681_10779392 3300025923 Bacteria 798
302 Ga0207681_11138621 3300025923 Unclassified 655
303 Ga0207694_10308123 3300025924 Unclassified 1305
304 Ga0207650_10011471 3300025925 Bacteria 6101
305 Ga0207650_10578452 3300025925 Unclassified 943
306 Ga0207650_11152582 3300025925 Archaea 660
307 Ga0207659_10034003 3300025926 Bacteria 3512
308 Ga0207659_10224402 3300025926 Bacteria 1512
309 Ga0207687_10047165 3300025927 Bacteria 2986
310 Ga0207687_10169124 3300025927 Bacteria 1684
311 Ga0207687_10653541 3300025927 Bacteria 889
312 Ga0207700_10036920 3300025928 Bacteria 3534
313 Ga0207664_10086604 3300025929 Bacteria 2559
314 Ga0207644_10307513 3300025931 Bacteria 1279
315 Ga0207644_10450681 3300025931 Bacteria 1057
316 Ga0207644_10453305 3300025931 Bacteria 1054
317 Ga0207644_10810407 3300025931 Bacteria 783
318 Ga0207644_10920502 3300025931 Unclassified 733
319 Ga0207690_10017551 3300025932 Bacteria 4372
320 Ga0207690_10107342 3300025932 Bacteria 2005
321 Ga0207690_10454590 3300025932 Bacteria 1030
322 Ga0207706_10153607 3300025933 Unclassified 2025
323 Ga0207706_10356489 3300025933 Bacteria 1271
324 Ga0207686_10093618 3300025934 Bacteria 1990
325 Ga0207686_10558666 3300025934 Bacteria 896
326 Ga0207686_11071800 3300025934 Unclassified 656
327 Ga0207709_10028376 3300025935 Bacteria 3235
328 Ga0207709_11111656 3300025935 Bacteria 649
329 Ga0207709_11195522 3300025935 Bacteria 626
330 Ga0207709_11509323 3300025935 Unclassified 557
331 Ga0207669_10004404 3300025937 Bacteria 6195
332 Ga0207669_10027504 3300025937 Bacteria 3115
333 Ga0207669_11076099 3300025937 Bacteria 678
334 Ga0207704_10066157 3300025938 Bacteria 2267
335 Ga0207704_10173760 3300025938 Bacteria 1549
336 Ga0207704_10395816 3300025938 Bacteria 1088
337 Ga0207665_10672201 3300025939 Unclassified 813
338 Ga0207665_11088405 3300025939 Bacteria 637
339 Ga0207691_10021553 3300025940 Bacteria 6084
340 Ga0207691_10108416 3300025940 Bacteria 2472
341 Ga0207691_10809321 3300025940 Bacteria 787
342 Ga0207711_10027244 3300025941 Bacteria 4800
343 Ga0207711_10147925 3300025941 Bacteria 2117
344 Ga0207711_10848011 3300025941 Unclassified 850
345 Ga0207689_10518773 3300025942 Bacteria 999
346 Ga0207661_10028352 3300025944 Bacteria 4287
347 Ga0207679_10330538 3300025945 Bacteria 1323
348 Ga0207679_10676240 3300025945 Bacteria 935
349 Ga0207667_10068933 3300025949 Bacteria 3682
350 Ga0207667_11271177 3300025949 Unclassified 713
351 Ga0207651_10060013 3300025960 Bacteria 2638
352 Ga0207651_10447559 3300025960 Bacteria 1108
353 Ga0207651_10734660 3300025960 Bacteria 872
354 Ga0207712_10028301 3300025961 Bacteria 3747
355 Ga0207712_10237104 3300025961 Bacteria 1468
356 Ga0207712_11668621 3300025961 Bacteria 571
357 Ga0207668_10091048 3300025972 Bacteria 2240
358 Ga0207668_10107422 3300025972 Bacteria 2087
359 Ga0207668_10163938 3300025972 Bacteria 1735
360 Ga0207668_10665868 3300025972 Bacteria 912
361 Ga0207668_11830060 3300025972 Unclassified 548
362 Ga0207640_10033706 3300025981 Bacteria 3189
363 Ga0207640_10083365 3300025981 Bacteria 2192
364 Ga0207640_10583820 3300025981 Unclassified 944
365 Ga0207677_10048352 3300026023 Bacteria 2864
366 Ga0207677_10058590 3300026023 Bacteria 2653
367 Ga0207677_10240778 3300026023 Bacteria 1463
368 Ga0207677_10871782 3300026023 Bacteria 810
369 Ga0207703_10013022 3300026035 Bacteria 6482
370 Ga0207678_10197480 3300026067 Bacteria 1720
371 Ga0207708_10015259 3300026075 Bacteria 5760
372 Ga0207708_10053476 3300026075 Bacteria 3077
373 Ga0207708_10495698 3300026075 Unclassified 1023
374 Ga0207708_11706099 3300026075 Unclassified 553
375 Ga0207641_10006726 3300026088 Bacteria 9634
376 Ga0207641_10530254 3300026088 Unclassified 1146
377 Ga0207641_10611997 3300026088 Bacteria 1067
378 Ga0207641_11118822 3300026088 Bacteria 786
379 Ga0207648_10016750 3300026089 Bacteria 6686
380 Ga0207648_10125798 3300026089 Bacteria 2255
381 Ga0207676_10014449 3300026095 Bacteria 5681
382 Ga0207676_10039385 3300026095 Bacteria 3615
383 Ga0207676_10042991 3300026095 Bacteria 3476
384 Ga0207676_10073265 3300026095 Bacteria 2756
385 Ga0207676_10130677 3300026095 Bacteria 2134
386 Ga0207674_11229034 3300026116 Bacteria 719
387 Ga0207675_100012476 3300026118 Bacteria 7937
388 Ga0207675_100030057 3300026118 Bacteria 5058
389 Ga0207675_100066838 3300026118 Bacteria 3360
390 Ga0207675_100094524 3300026118 Bacteria 2812
391 Ga0207675_100331540 3300026118 Bacteria 1488
392 Ga0207675_100349778 3300026118 Bacteria 1448
393 Ga0207675_100492576 3300026118 Bacteria 1219
394 Ga0207675_101145830 3300026118 Bacteria 798
395 Ga0207675_102596728 3300026118 Unclassified 516
396 Ga0207683_10197240 3300026121 Bacteria 1829
397 Ga0207683_10205411 3300026121 Bacteria 1792
398 Ga0207683_10879850 3300026121 Unclassified 832
399 Ga0207698_10237868 3300026142 Bacteria 1657
400 Ga0207698_11950167 3300026142 Bacteria 602
401 Ga0207428_10004284 3300027907 Bacteria 13648
402 Ga0207428_10154901 3300027907 Unclassified 1743
403 Ga0268266_10053457 3300028379 Bacteria 3470
404 Ga0268266_10886342 3300028379 Bacteria 863
405 Ga0268265_10065474 3300028380 Bacteria 2805
406 Ga0268265_10133272 3300028380 Bacteria 2068
407 Ga0268265_10166716 3300028380 Bacteria 1878
408 Ga0268264_10220004 3300028381 Bacteria 1748
409 Ga0268264_11000532 3300028381 Bacteria 843
410 Ga0307408_100506786 3300031548 Unclassified 1057
411 Ga0307408_101512341 3300031548 Unclassified 635
412 Ga0307416_100055900 3300032002 Unclassified 3181
413 Ga0373930_0000070 3300034816 Bacteria 9941
414 Ga0373950_0001096 3300034818 Bacteria 3459
415 Ga0373958_0000542 3300034819 Bacteria 4712
416 Ga0373959_0002564 3300034820 Bacteria 2882
417 Ga0373938_0004732 3300034957 Bacteria 2283
418 Ga0373928_0007055 3300035084 Bacteria 2165
419 Ga0373929_0001130 3300035085 Bacteria 5171
420 Ga0373940_0000640 3300035088 Bacteria 5594
421 Ga0373949_0000540 3300035090 Bacteria 12471
422 Ga0373951_0000475 3300035091 Bacteria 11487
423 Ga0373952_0011316 3300035092 Bacteria 1738
424 Ga0373932_0080570 3300035112 Bacteria 1027
425 Ga0373939_0001422 3300035114 Bacteria 5810
426 Ga0373941_0113832 3300035115 Bacteria 956
427 Ga0373960_0012496 3300035121 Bacteria 2111
428 Ga0373946_0064007 3300035171 Bacteria 1572
429 Ga0373955_0229478 3300035172 Bacteria 1110
430 Ga0373942_0000397 3300035207 Bacteria 12081
431 Ga0373961_0001526 3300035241 Bacteria 6709
432 Ga0373962_0000747 3300035242 Bacteria 7374
433 Ga0373924_0073396 3300035410 Bacteria 1446
434 Ga0373931_0000745 3300035691 Bacteria 13573
435 Ga0373931_0139481 3300035691 Bacteria 1403
436 Ga0373931_0668481 3300035691 Bacteria 684
437 Ga0373927_0340396 3300035695 Bacteria 988
438 Ga0373933_0723364 3300035724 Bacteria 655
439 Ga0373933_1132521 3300035724 Bacteria 516
440 Ga0373947_0752907 3300035725 Unclassified 665
441 Ga0373937_0098989 3300036401 Bacteria 2705
442 Ga0373937_0168150 3300036401 Bacteria 2057
443 Ga0373937_0174918 3300036401 Bacteria 2015
444 Ga0373937_0230973 3300036401 Unclassified 1742
445 Ga0395905_1181923 3300037471 Bacteria 668
446 Ga0451851_0845718 3300041507 Unclassified 665
447 Ga0450913_019588 3300042117 Unclassified 613
448 Ga0450923_093267 3300042125 Bacteria 688
449 Ga0439444_0022185 3300042437 Bacteria 1130
450 Ga0439464_0051815 3300042439 Bacteria 1188
451 Ga0439440_0137723 3300042993 Unclassified 691
452 Ga0451576_0017034 3300045051 Bacteria 7998
453 Ga0466967_0481467 3300045976 Bacteria 1216
454 Ga0495580_0441581 3300046472 Unclassified 874
455 Ga0495582_0023304 3300046473 Bacteria 3388
456 Ga0495582_0091774 3300046473 Bacteria 1694
457 Ga0495608_0802930 3300046511 Unclassified 555
458 Ga0495628_0083906 3300046516 Bacteria 2473
459 Ga0495630_0287152 3300046517 Bacteria 1257
460 Ga0495630_0369317 3300046517 Bacteria 1099
461 Ga0495642_0510473 3300046528 Unclassified 532
462 Ga0495640_0284943 3300046533 Bacteria 1028
463 Ga0495586_0293422 3300046535 Unclassified 931
464 Ga0495587_0268923 3300046536 Bacteria 957
465 Ga0495621_0397969 3300046539 Bacteria 584
466 Ga0495645_0075633 3300046543 Bacteria 2424
467 Ga0495656_0529315 3300046615 Unclassified 627
468 Ga0495635_0560420 3300046663 Unclassified 748
469 Ga0495657_0245175 3300046675 Bacteria 1080
470 Ga0495647_0014219 3300046681 Bacteria 2770
471 Ga0495658_0004399 3300046683 Bacteria 6939
472 Ga0495658_0037209 3300046683 Bacteria 2689
473 Ga0495613_0388589 3300046689 Bacteria 953
474 Ga0495613_0471699 3300046689 Bacteria 848
475 Ga0495600_0237175 3300046809 Bacteria 1163
476 Ga0495600_0356425 3300046809 Bacteria 916
477 Ga0495674_0086270 3300047319 Bacteria 2688
478 Ga0495674_0091514 3300047319 Bacteria 2598
479 Ga0495676_0606910 3300047321 Unclassified 712
480 Ga0495680_0641583 3300047322 Unclassified 707
481 Ga0495614_0464740 3300048089 Unclassified 600
482 Ga0496100_0224277 3300048903 Bacteria 1380
483 Ga0496100_0239510 3300048903 Unclassified 1338
484 Ga0496101_0020491 3300048904 Bacteria 4529
485 Ga0496101_0061037 3300048904 Bacteria 2737
486 Ga0496101_0079766 3300048904 Bacteria 2417
487 Ga0496102_0022264 3300048905 Bacteria 5615
488 Ga0496102_0388139 3300048905 Bacteria 1314
489 Ga0496102_0473273 3300048905 Bacteria 1174
490 Ga0496103_0494671 3300048906 Bacteria 783
491 Ga0496103_0518616 3300048906 Bacteria 762
492 Ga0496104_0007403 3300048907 Bacteria 9698
493 Ga0496104_0008117 3300048907 Bacteria 9316
494 Ga0496104_0139782 3300048907 Bacteria 2327
495 Ga0496105_0030342 3300048908 Bacteria 4430
496 Ga0496105_0125176 3300048908 Bacteria 2119
497 Ga0496105_0130869 3300048908 Bacteria 2068
498 Ga0496106_0033242 3300048909 Bacteria 3848
499 Ga0496106_0522321 3300048909 Bacteria 953
500 Ga0496106_0927742 3300048909 Bacteria 687
501 Ga0496107_0095832 3300048910 Bacteria 2171
502 Ga0496107_0134872 3300048910 Unclassified 1824
503 Ga0496107_0619818 3300048910 Unclassified 799
504 Ga0496108_0054351 3300048911 Bacteria 3360
505 Ga0496109_0026013 3300048912 Bacteria 5216
506 Ga0496109_0182072 3300048912 Bacteria 1974
507 Ga0496109_0317088 3300048912 Bacteria 1471
508 Ga0496109_0703270 3300048912 Bacteria 948
509 Ga0496110_0020500 3300048913 Bacteria 5582
510 Ga0496110_0059756 3300048913 Bacteria 3361
511 Ga0496111_0722140 3300048914 Unclassified 724
512 Ga0496112_0041600 3300048915 Bacteria 4496
513 Ga0496112_0355783 3300048915 Bacteria 1406
514 Ga0496112_0484405 3300048915 Bacteria 1173
515 Ga0496112_0645511 3300048915 Bacteria 988
516 Ga0496113_0007690 3300048916 Bacteria 6955
517 Ga0496113_0091376 3300048916 Bacteria 2346
518 Ga0496113_0835174 3300048916 Bacteria 731
519 Ga0496114_0003826 3300048917 Bacteria 11610
520 Ga0496114_0074604 3300048917 Bacteria 2855
521 Ga0496115_0023559 3300048918 Bacteria 4777
522 Ga0501036_0523811 3300049572 Unclassified 986
523 Ga0501038_0801467 3300049574 Bacteria 700
524 Ga0501042_0460074 3300049578 Bacteria 923
525 Ga0501042_0684811 3300049578 Bacteria 745
526 Ga0501071_0285687 3300049587 Unclassified 1249
527 Ga0501075_0128962 3300049591 Bacteria 1926
528 Ga0501076_0031563 3300049592 Bacteria 4133
529 Ga0501076_1179439 3300049592 Bacteria 630
530 Ga0501077_1088630 3300049593 Unclassified 514
531 Ga0501242_073099 3300049674 Unclassified 540
532 Ga0501260_017526 3300049689 Unclassified 759
533 Ga0501079_0098938 3300049741 Bacteria 2261
534 Ga0501045_0618507 3300049824 Bacteria 801
535 nmdc:mga00v17_164014_c1 3300050491 Bacteria 1432
536 nmdc:mga0yw44_216321_c1 3300050492 Bacteria 1269
537 nmdc:mga0k408_184517_c1 3300050493 Unclassified 1244
538 nmdc:mga06z11_11570_c1 3300050494 Bacteria 3810
539 nmdc:mga04h51_413127_c1 3300050495 Bacteria 567
540 nmdc:mga07m45_23086_c1 3300050496 Bacteria 3399
541 nmdc:mga07m45_591015_c1 3300050496 Bacteria 641
542 nmdc:mga05p37_1194597_c1 3300050507 Unclassified 786
543 nmdc:mga05p37_1634769_c1 3300050507 Bacteria 632
544 nmdc:mga05p37_19709_c1 3300050507 Bacteria 8160
545 nmdc:mga05p37_71921_c1 3300050507 Bacteria 4255
546 nmdc:mga05p37_84582_c1 3300050507 Bacteria 3908
547 nmdc:mga05p37_9445_c1 3300050507 Bacteria 11548
548 nmdc:mga09592_1370494_c1 3300050508 Bacteria 579
549 nmdc:mga09592_948_c1 3300050508 Bacteria 7578
550 nmdc:mga0qj67_1410694_c1 3300050509 Unclassified 537
551 nmdc:mga0qj67_334716_c1 3300050509 Bacteria 1225
552 nmdc:mga0qj67_37077_c1 3300050509 Bacteria 3818
553 nmdc:mga06r32_1407_c1 3300050510 Bacteria 21715
554 nmdc:mga08y16_3210_c1 3300050511 Bacteria 16913
555 nmdc:mga0n895_11401_c1 3300050512 Bacteria 7930
556 nmdc:mga0n895_257512_c1 3300050512 Bacteria 1771
557 nmdc:mga0n895_85835_c1 3300050512 Bacteria 3143
558 nmdc:mga0rr50_1320971_c1 3300050513 Unclassified 611
559 nmdc:mga0rr50_25968_c1 3300050513 Bacteria 4080
560 nmdc:mga0rr50_618_c1 3300050513 Bacteria 19051
561 nmdc:mga0rr50_95822_c1 3300050513 Bacteria 2320
562 nmdc:mga08x19_32616_c1 3300050514 Bacteria 3284
563 nmdc:mga08x19_36708_c1 3300050514 Bacteria 3105
564 nmdc:mga08x19_50465_c1 3300050514 Bacteria 2670
565 nmdc:mga0a205_1118197_c1 3300050515 Unclassified 635
566 nmdc:mga0a205_17108_c1 3300050515 Bacteria 6789
567 nmdc:mga0a205_760917_c1 3300050515 Bacteria 817
568 Ga0495601_0038208 3300053077 Bacteria 3001
569 Ga0495601_0124710 3300053077 Bacteria 1675
570 Ga0495595_0003243 3300053084 Bacteria 6464
571 Ga0495619_0027354 3300053085 Bacteria 3672
572 Ga0495619_0068740 3300053085 Bacteria 2367
573 Ga0495619_0228322 3300053085 Bacteria 1289
574 Ga0590071_151768 3300059421 Bacteria 601
575 Ga0587101_131940 3300059623 Unclassified 526
576 Ga0530510_0200537 3300061734 Unclassified 1482
577 Ga0070705_100022317
578 Ga0065714_10084017
579 Ga0065712_10000308
580 Ga0065715_10000213
581 Ga0065715_10081286
582 Ga0065715_10330405
583 Ga0065715_10395229
584 Ga0065707_10127578
585 Ga0065707_10152749
586 Ga0065707_10952107
587 Ga0070676_10000699
588 Ga0070676_10595743
589 Ga0070683_101154167
590 Ga0070690_100050487
591 Ga0070690_101391753
592 Ga0070670_100002445
593 Ga0070670_100747239
594 Ga0070677_10078024
595 Ga0068869_100395948
596 Ga0068869_101065336
597 Ga0070666_10004957
598 Ga0070666_10389702
599 Ga0070666_10601665
600 Ga0070666_10931542
601 Ga0070680_100391897
602 Ga0070682_100735524
603 Ga0070682_101603318
604 Ga0068868_100105624
605 Ga0068868_100510153
606 Ga0068868_100703765
607 Ga0070660_100316084
608 Ga0070660_100355341
609 Ga0070689_101482743
610 Ga0070691_10003375
611 Ga0070691_10535949
612 Ga0070687_100012231
613 Ga0070661_100518241
614 Ga0070692_10697561
615 Ga0070692_10726110
616 Ga0070668_100032293
617 Ga0070668_100079510
618 Ga0070668_100116114
619 Ga0070669_100063996
620 Ga0070669_100077946
621 Ga0070669_100083070
622 Ga0070669_100407409
623 Ga0070669_100933910
624 Ga0070675_100006452
625 Ga0070675_100090381
626 Ga0070671_100084472
627 Ga0070674_100001022
628 Ga0070674_100577636
629 Ga0070674_101095813
630 Ga0070673_100085186
631 Ga0070673_100998841
632 Ga0070673_101079243
633 Ga0070688_100002479
634 Ga0070688_100193708
635 Ga0070688_100477171
636 Ga0070659_100067976
637 Ga0070659_100263656
638 Ga0070659_100884924
639 Ga0070667_100329243
640 Ga0070709_10617657
641 Ga0070714_100054657
642 Ga0070713_100069420
643 Ga0070711_100439882
644 Ga0070705_100670725
645 Ga0070700_100512886
646 Ga0070694_100118502
647 Ga0070694_100168923
648 Ga0070694_100173150
649 Ga0070694_100377367
650 Ga0070708_100125466
651 Ga0070678_100543290
652 Ga0070678_100554136
653 Ga0070678_100807861
654 Ga0070662_100225497
655 Ga0070662_100246524
656 Ga0070681_10001687
657 Ga0070681_10100393
658 Ga0068867_100006297
659 Ga0068867_100114752
660 Ga0068867_101476047
661 Ga0070685_10426362
662 Ga0070706_100194505
663 Ga0070706_100255748
664 Ga0070706_101186014
665 Ga0070698_100019157
666 Ga0070698_100179963
667 Ga0070699_100001478
668 Ga0070699_100765976
669 Ga0070699_101041988
670 Ga0070699_101155666
671 Ga0070679_100066335
672 Ga0070684_100043012
673 Ga0070684_100461261
674 Ga0070697_100062858
675 Ga0068853_100068677
676 Ga0068853_100284770
677 Ga0070672_100011942
678 Ga0070672_100108530
679 Ga0070686_100000389
680 Ga0070686_100039941
681 Ga0070686_100651508
682 Ga0070686_101206669
683 Ga0070686_101311377
684 Ga0070695_100009348
685 Ga0070696_100040535
686 Ga0070696_100074021
687 Ga0070665_100126918
688 Ga0070665_100962200
689 Ga0070704_100003916
690 Ga0070704_100465674
691 Ga0070704_100661690
692 Ga0068855_100326094
693 Ga0068855_102119385
694 Ga0070664_100030942
695 Ga0070664_100538416
696 Ga0070664_101388126
697 Ga0070664_101504689
698 Ga0068857_100453550
699 Ga0068854_100046445
700 Ga0068854_100060858
701 Ga0068854_100410962
702 Ga0070702_100002900
703 Ga0070702_100198972
704 Ga0070702_100660367
705 Ga0068852_100528707
706 Ga0068852_100685203
707 Ga0068859_100106503
708 Ga0068864_100013922
709 Ga0068864_100017239
710 Ga0068864_100282412
711 Ga0068864_100365671
712 Ga0068864_101033686
713 Ga0068864_101468075
714 Ga0068866_10033184
715 Ga0068866_10058776
716 Ga0068866_10071608
717 Ga0068861_100009190
718 Ga0068861_100097507
719 Ga0068861_100174117
720 Ga0068861_100320647
721 Ga0068861_100570637
722 Ga0068861_101225821
723 Ga0068861_101301000
724 Ga0068851_10689483
725 Ga0068870_10073047
726 Ga0068863_100067273
727 Ga0068863_100223645
728 Ga0068863_100717128
729 Ga0068863_101910082
730 Ga0068858_100172397
731 Ga0068858_100205387
732 Ga0068858_100624426
733 Ga0068858_101872050
734 Ga0068860_100315367
735 Ga0068860_101500126
736 Ga0068860_101560368
737 Ga0068862_100053930
738 Ga0068862_100234202
739 Ga0068862_101457104
740 Ga0081539_10018173
741 Ga0075365_10093141
742 Ga0075368_10023607
743 Ga0075364_10154510
744 Ga0070716_100641505
745 Ga0075367_10009336
746 Ga0075366_10158996
747 Ga0097621_100473105
748 Ga0075370_10036457
749 Ga0075370_10556074
750 Ga0068871_100053765
751 Ga0068871_100196345
752 Ga0068871_101698669
753 Ga0075428_100022358
754 Ga0075428_100153012
755 Ga0075430_100035308
756 Ga0075430_100781401
757 Ga0075431_100197362
758 Ga0075431_100487967
759 Ga0075433_10039282
760 Ga0075433_10486346
761 Ga0075433_10885958
762 Ga0075434_100000731
763 Ga0075434_100018881
764 Ga0075434_100244350
765 Ga0075434_100287857
766 Ga0075434_100413416
767 Ga0068865_100080456
768 Ga0068865_100158523
769 Ga0068865_100381477
770 Ga0068865_101147293
771 Ga0075436_100009966
772 Ga0075436_100022746
773 Ga0075436_100060104
774 Ga0097620_100106506
775 Ga0075435_100000404
776 Ga0075435_100009739
777 Ga0075435_100281052
778 Ga0099794_10097048
779 Ga0099794_10238596
780 Ga0105240_10080775
781 Ga0105240_10093777
782 Ga0105240_10184078
783 Ga0105240_11527064
784 Ga0111539_10005052
785 Ga0111539_11233185
786 Ga0111539_11303543
787 Ga0105245_10776175
788 Ga0105247_10009155
789 Ga0105247_10346093
790 Ga0114129_10000307
791 Ga0114129_10010344
792 Ga0114129_10140289
793 Ga0114129_10160737
794 Ga0114129_11291800
795 Ga0114129_11540003
796 Ga0105243_10061780
797 Ga0105243_10374497
798 Ga0105243_10686863
799 Ga0105243_11205281
800 Ga0105241_10097160
801 Ga0105242_10838739
802 Ga0105248_10000664
803 Ga0105248_10040293
804 Ga0105248_10114714
805 Ga0105248_10491820
806 Ga0105248_10685640
807 Ga0105248_11603895
808 Ga0105237_10925407
809 Ga0105238_10290847
810 Ga0105238_10417001
811 Ga0105238_10642855
812 Ga0105238_11039961
813 Ga0105249_10115323
814 Ga0105249_10261357
815 Ga0105249_10643114
816 Ga0105249_11367191
817 Ga0105239_11566235
818 Ga0105246_10091824
819 Ga0157374_10056074
820 Ga0157374_10162926
821 Ga0157374_10331843
822 Ga0157378_10278705
823 Ga0157378_10388130
824 Ga0157378_10944550
825 Ga0163162_10148156
826 Ga0163162_11978185
827 Ga0157375_10093208
828 Ga0157375_10106098
829 Ga0157375_10214328
830 Ga0163163_10160703
831 Ga0163163_11339028
832 Ga0157380_10174980
833 Ga0157380_10207326
834 Ga0157380_10707860
835 Ga0182008_10626681
836 Ga0157377_10283510
837 Ga0157379_10125289
838 Ga0157379_10245791
839 Ga0157376_10031004
840 Ga0157376_10040361
841 Ga0157376_10378264
842 Ga0157376_10989953
843 Ga0157376_11049309
844 Ga0157376_11369006
845 Ga0157376_11401217
846 Ga0163161_10009495
847 Ga0163161_10048184
848 Ga0163161_11068629
849 Ga0207697_10096910
850 Ga0207697_10122552
851 Ga0207697_10123201
852 Ga0207682_10047425
853 Ga0207682_10095544
854 Ga0207642_10027345
855 Ga0207642_10246078
856 Ga0207710_10056671
857 Ga0207688_10033298
858 Ga0207688_10221295
859 Ga0207680_10044528
860 Ga0207680_10124271
861 Ga0207680_10231729
862 Ga0207645_10000703
863 Ga0207645_10053454
864 Ga0207643_10174739
865 Ga0207684_10719514
866 Ga0207654_10247610
867 Ga0207707_10047226
868 Ga0207695_10177778
869 Ga0207695_10865882
870 Ga0207662_10005881
871 Ga0207657_10116869
872 Ga0207649_10419814
873 Ga0207646_10701242
874 Ga0207681_10018796
875 Ga0207681_10061229
876 Ga0207681_10353803
877 Ga0207681_10779392
878 Ga0207681_11138621
879 Ga0207694_10308123
880 Ga0207650_10011471
881 Ga0207650_10578452
882 Ga0207650_11152582
883 Ga0207659_10034003
884 Ga0207659_10224402
885 Ga0207687_10047165
886 Ga0207687_10169124
887 Ga0207687_10653541
888 Ga0207700_10036920
889 Ga0207664_10086604
890 Ga0207644_10307513
891 Ga0207644_10450681
892 Ga0207644_10453305
893 Ga0207644_10810407
894 Ga0207644_10920502
895 Ga0207690_10017551
896 Ga0207690_10107342
897 Ga0207690_10454590
898 Ga0207706_10153607
899 Ga0207706_10356489
900 Ga0207686_10093618
901 Ga0207686_10558666
902 Ga0207686_11071800
903 Ga0207709_10028376
904 Ga0207709_11111656
905 Ga0207709_11195522
906 Ga0207709_11509323
907 Ga0207669_10004404
908 Ga0207669_10027504
909 Ga0207669_11076099
910 Ga0207704_10066157
911 Ga0207704_10173760
912 Ga0207704_10395816
913 Ga0207665_10672201
914 Ga0207665_11088405
915 Ga0207691_10021553
916 Ga0207691_10108416
917 Ga0207691_10809321
918 Ga0207711_10027244
919 Ga0207711_10147925
920 Ga0207711_10848011
921 Ga0207689_10518773
922 Ga0207661_10028352
923 Ga0207679_10330538
924 Ga0207679_10676240
925 Ga0207667_10068933
926 Ga0207667_11271177
927 Ga0207651_10060013
928 Ga0207651_10447559
929 Ga0207651_10734660
930 Ga0207712_10028301
931 Ga0207712_10237104
932 Ga0207712_11668621
933 Ga0207668_10091048
934 Ga0207668_10107422
935 Ga0207668_10163938
936 Ga0207668_10665868
937 Ga0207668_11830060
938 Ga0207640_10033706
939 Ga0207640_10083365
940 Ga0207640_10583820
941 Ga0207677_10048352
942 Ga0207677_10058590
943 Ga0207677_10240778
944 Ga0207677_10871782
945 Ga0207703_10013022
946 Ga0207678_10197480
947 Ga0207708_10015259
948 Ga0207708_10053476
949 Ga0207708_10495698
950 Ga0207708_11706099
951 Ga0207641_10006726
952 Ga0207641_10530254
953 Ga0207641_10611997
954 Ga0207641_11118822
955 Ga0207648_10016750
956 Ga0207648_10125798
957 Ga0207676_10014449
958 Ga0207676_10039385
959 Ga0207676_10042991
960 Ga0207676_10073265
961 Ga0207676_10130677
962 Ga0207674_11229034
963 Ga0207675_100012476
964 Ga0207675_100030057
965 Ga0207675_100066838
966 Ga0207675_100094524
967 Ga0207675_100331540
968 Ga0207675_100349778
969 Ga0207675_100492576
970 Ga0207675_101145830
971 Ga0207675_102596728
972 Ga0207683_10197240
973 Ga0207683_10205411
974 Ga0207683_10879850
975 Ga0207698_10237868
976 Ga0207698_11950167
977 Ga0207428_10004284
978 Ga0207428_10154901
979 Ga0268266_10053457
980 Ga0268266_10886342
981 Ga0268265_10065474
982 Ga0268265_10133272
983 Ga0268265_10166716
984 Ga0268264_10220004
985 Ga0268264_11000532
986 Ga0307408_100506786
987 Ga0307408_101512341
988 Ga0307416_100055900
989 Ga0373930_0000070
990 Ga0373950_0001096
991 Ga0373958_0000542
992 Ga0373959_0002564
993 Ga0373938_0004732
994 Ga0373928_0007055
995 Ga0373929_0001130
996 Ga0373940_0000640
997 Ga0373949_0000540
998 Ga0373951_0000475
999 Ga0373952_0011316
1000 Ga0373932_0080570
1001 Ga0373939_0001422
1002 Ga0373941_0113832
1003 Ga0373960_0012496
1004 Ga0373946_0064007
1005 Ga0373955_0229478
1006 Ga0373942_0000397
1007 Ga0373961_0001526
1008 Ga0373962_0000747
1009 Ga0373924_0073396
1010 Ga0373931_0000745
1011 Ga0373931_0139481
1012 Ga0373931_0668481
1013 Ga0373927_0340396
1014 Ga0373933_0723364
1015 Ga0373933_1132521
1016 Ga0373947_0752907
1017 Ga0373937_0098989
1018 Ga0373937_0168150
1019 Ga0373937_0174918
1020 Ga0373937_0230973
1021 Ga0395905_1181923
1022 Ga0451851_0845718
1023 Ga0450913_019588
1024 Ga0450923_093267
1025 Ga0439444_0022185
1026 Ga0439464_0051815
1027 Ga0439440_0137723
1028 Ga0451576_0017034
1029 Ga0466967_0481467
1030 Ga0495580_0441581
1031 Ga0495582_0023304
1032 Ga0495582_0091774
1033 Ga0495608_0802930
1034 Ga0495628_0083906
1035 Ga0495630_0287152
1036 Ga0495630_0369317
1037 Ga0495642_0510473
1038 Ga0495640_0284943
1039 Ga0495586_0293422
1040 Ga0495587_0268923
1041 Ga0495621_0397969
1042 Ga0495645_0075633
1043 Ga0495656_0529315
1044 Ga0495635_0560420
1045 Ga0495657_0245175
1046 Ga0495647_0014219
1047 Ga0495658_0004399
1048 Ga0495658_0037209
1049 Ga0495613_0388589
1050 Ga0495613_0471699
1051 Ga0495600_0237175
1052 Ga0495600_0356425
1053 Ga0495674_0086270
1054 Ga0495674_0091514
1055 Ga0495676_0606910
1056 Ga0495680_0641583
1057 Ga0495614_0464740
1058 Ga0496100_0224277
1059 Ga0496100_0239510
1060 Ga0496101_0020491
1061 Ga0496101_0061037
1062 Ga0496101_0079766
1063 Ga0496102_0022264
1064 Ga0496102_0388139
1065 Ga0496102_0473273
1066 Ga0496103_0494671
1067 Ga0496103_0518616
1068 Ga0496104_0007403
1069 Ga0496104_0008117
1070 Ga0496104_0139782
1071 Ga0496105_0030342
1072 Ga0496105_0125176
1073 Ga0496105_0130869
1074 Ga0496106_0033242
1075 Ga0496106_0522321
1076 Ga0496106_0927742
1077 Ga0496107_0095832
1078 Ga0496107_0134872
1079 Ga0496107_0619818
1080 Ga0496108_0054351
1081 Ga0496109_0026013
1082 Ga0496109_0182072
1083 Ga0496109_0317088
1084 Ga0496109_0703270
1085 Ga0496110_0020500
1086 Ga0496110_0059756
1087 Ga0496111_0722140
1088 Ga0496112_0041600
1089 Ga0496112_0355783
1090 Ga0496112_0484405
1091 Ga0496112_0645511
1092 Ga0496113_0007690
1093 Ga0496113_0091376
1094 Ga0496113_0835174
1095 Ga0496114_0003826
1096 Ga0496114_0074604
1097 Ga0496115_0023559
1098 Ga0501036_0523811
1099 Ga0501038_0801467
1100 Ga0501042_0460074
1101 Ga0501042_0684811
1102 Ga0501071_0285687
1103 Ga0501075_0128962
1104 Ga0501076_0031563
1105 Ga0501076_1179439
1106 Ga0501077_1088630
1107 Ga0501242_073099
1108 Ga0501260_017526
1109 Ga0501079_0098938
1110 Ga0501045_0618507
1111 nmdc:mga00v17_164014_c1
1112 nmdc:mga0yw44_216321_c1
1113 nmdc:mga0k408_184517_c1
1114 nmdc:mga06z11_11570_c1
1115 nmdc:mga04h51_413127_c1
1116 nmdc:mga07m45_23086_c1
1117 nmdc:mga07m45_591015_c1
1118 nmdc:mga05p37_1194597_c1
1119 nmdc:mga05p37_1634769_c1
1120 nmdc:mga05p37_19709_c1
1121 nmdc:mga05p37_71921_c1
1122 nmdc:mga05p37_84582_c1
1123 nmdc:mga05p37_9445_c1
1124 nmdc:mga09592_1370494_c1
1125 nmdc:mga09592_948_c1
1126 nmdc:mga0qj67_1410694_c1
1127 nmdc:mga0qj67_334716_c1
1128 nmdc:mga0qj67_37077_c1
1129 nmdc:mga06r32_1407_c1
1130 nmdc:mga08y16_3210_c1
1131 nmdc:mga0n895_11401_c1
1132 nmdc:mga0n895_257512_c1
1133 nmdc:mga0n895_85835_c1
1134 nmdc:mga0rr50_1320971_c1
1135 nmdc:mga0rr50_25968_c1
1136 nmdc:mga0rr50_618_c1
1137 nmdc:mga0rr50_95822_c1
1138 nmdc:mga08x19_32616_c1
1139 nmdc:mga08x19_36708_c1
1140 nmdc:mga08x19_50465_c1
1141 nmdc:mga0a205_1118197_c1
1142 nmdc:mga0a205_17108_c1
1143 nmdc:mga0a205_760917_c1
1144 Ga0495601_0038208
1145 Ga0495601_0124710
1146 Ga0495595_0003243
1147 Ga0495619_0027354
1148 Ga0495619_0068740
1149 Ga0495619_0228322
1150 Ga0590071_151768
1151 Ga0587101_131940
1152 Ga0530510_0200537

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02381

MraZ

MraZ protein, putative antitoxin-like

12

86

0.9

PF02381

MraZ

MraZ protein, putative antitoxin-like

91

155

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
1n0g-assembly1.cif.gz_A crystal structure of a cell division and cell wall biosynthesis protein upf0040 from mycoplasma pneumoniae: indication of a novel fold with a possible new conserved sequence motif 0.9046 5 145
1n0g-assembly1.cif.gz_A crystal structure of a cell division and cell wall biosynthesis protein upf0040 from mycoplasma pneumoniae: indication of a novel fold with a possible new conserved sequence motif 0.8748 5 145
1jmx-assembly1.cif.gz_B crystal structure of a quinohemoprotein amine dehydrogenase from pseudomonas putida 0.5805 35 56
2glw-assembly1.cif.gz_A the solution structure of phs018 from pyrococcus horikoshii 0.5616 7 120
2glw-assembly1.cif.gz_A the solution structure of phs018 from pyrococcus horikoshii 0.529 7 120
ID Description Score Start End Superfamily
af_P9WJN9_1_138_3.40.1550.20 Alpha Beta;3-Layer(aba) Sandwich;Chemotaxis protein chec;Transcriptional regulator MraZ domain 0.9204 7 134 3.40.1550.20
af_Q2FZ97_1_142_3.40.1550.20 Alpha Beta;3-Layer(aba) Sandwich;Chemotaxis protein chec;Transcriptional regulator MraZ domain 0.8978 7 149 3.40.1550.20
af_Q2FZ97_1_142_3.40.1550.20 Alpha Beta;3-Layer(aba) Sandwich;Chemotaxis protein chec;Transcriptional regulator MraZ domain 0.8802 7 149 3.40.1550.20
af_P22186_1_143_3.40.1550.20 Alpha Beta;3-Layer(aba) Sandwich;Chemotaxis protein chec;Transcriptional regulator MraZ domain 0.8718 7 146 3.40.1550.20
1n0eB00 Alpha Beta;3-Layer(aba) Sandwich;Chemotaxis protein chec;Transcriptional regulator MraZ domain 0.853 4 148 3.40.1550.20
ID Description Score Start End GO Terms
AF-A0A2V8TFP5-F1-model_v4 Transcriptional regulator MraZ 0.9935 7 151 GO:0000976
GO:0003700
GO:0005737
GO:0009295
GO:2000143
AF-A0A2D9M2R2-F1-model_v4 Transcriptional regulator MraZ 0.9931 7 151 GO:0000976
GO:0003700
GO:0005737
GO:0009295
GO:2000143
AF-A0A2V8YFG5-F1-model_v4 Transcriptional regulator MraZ 0.9913 6 126 GO:0000976
GO:0003700
GO:0005737
GO:2000143
AF-A0A7C7WQJ3-F1-model_v4 Transcriptional regulator MraZ 0.9906 7 151 GO:0000976
GO:0003700
GO:0005737
GO:0009295
GO:2000143
AF-A0A7W1PAG8-F1-model_v4 Transcriptional regulator MraZ 0.9901 7 128 GO:0000976
GO:0003700
GO:0005737
GO:2000143

Map