F465403

General Info

Members Datasets Scaffolds Average Seq Length
575 228 1150 271

Family's Representative Sequence

Representative Sequence 3300025910|Ga0207684_10000756|Ga0207684_1000075627
Length 312
Sequence LASSVAGSVVIWPIPADLSGGTLALNSGGGTGRKADPMAGEWGHEVTASRGEPVPFDTSVAHVARVYDYWLGGKDNSAADRAAGDQAIKAFPNIVLSARANRAFLARAVRFLAGEAGIRQFLDIGTGIPTGNNTHQVAQSVAPEARVVYVDNDPIVLAHARALLATHPEGATDYIDADLRDPRTILDAAARLLDFRRPVAIMLMAILQHINDEHDPYQVVATLVGAMQPGSYLALSHPAKDIDAESMAKMADSLNQMMAEKVTFRARPAVARFFDGLELVEPGMVQASKWRPASEAEAASPAALWAGVARKH

Samples

Sample ID Description Type Environment
1 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
8 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
9 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
10 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
11 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
12 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
13 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
14 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
15 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
16 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
17 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
18 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
19 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
20 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
21 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
22 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
23 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
24 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
25 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
26 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
27 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
28 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
29 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
30 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
31 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
32 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
33 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
34 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
35 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
36 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
37 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
38 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
39 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
40 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
41 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
42 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
43 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
44 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
45 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
46 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
47 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
48 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
49 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
50 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
51 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
52 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
53 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
54 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
55 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
56 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
77 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
78 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
79 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
80 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
81 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
82 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
83 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
84 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
85 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
86 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
87 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
88 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
89 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
90 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
91 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
92 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
93 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
94 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
95 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
96 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
97 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
98 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
99 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
100 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
101 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
102 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
103 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
104 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
105 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
106 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
107 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
108 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
109 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
110 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
111 3300036459 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
112 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
113 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
114 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
115 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
116 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
117 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
118 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
119 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
120 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
121 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
122 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
123 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
124 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
125 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
126 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
127 3300042136 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 Metagenome Rhizosphere
128 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
129 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
130 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
131 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
132 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
133 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
134 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
135 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
136 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
137 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
138 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
139 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
140 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
141 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
142 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
143 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
144 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
145 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
146 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
147 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
148 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
149 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
150 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
151 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
152 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
153 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
154 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
155 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
156 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
157 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
158 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
159 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
160 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
161 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
162 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
163 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
164 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
165 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
166 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
167 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
168 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
169 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
170 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
171 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
172 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
173 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
174 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
175 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
176 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
177 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
178 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
179 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
180 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
181 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
182 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
183 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
184 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
185 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
186 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
187 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
188 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
189 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
190 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
191 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
192 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
193 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
194 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
195 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
196 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
197 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
198 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
199 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
200 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
201 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
202 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
203 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
204 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
205 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
206 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
207 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
208 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
209 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
210 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
211 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
212 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
213 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
214 2643221578 Streptomyces sp. Root63 Isolate Unclassified
215 2643221647 Streptomyces sp. Root369 Isolate Unclassified
216 2643221673 Streptomyces sp. Root1295 Isolate Unclassified
217 2751185782 Actinoplanes subtropicus NRRL B-24665 Isolate Rhizosphere
218 2946045630 Streptomyces sp. W4I9-2 Isolate Rhizosphere
219 2954691527 Streptomyces sp. SAI-127 Isolate Rhizosphere
220 2954701450 Streptomyces sp. SAI-144 Isolate Rhizosphere
221 2954711539 Streptomyces sp. SAI-090 Isolate Rhizosphere
222 2954721474 Streptomyces sp. SAI-117 Isolate Rhizosphere
223 2954731030 Streptomyces sp. SAI-133 Isolate Rhizosphere
224 2954740390 Streptomyces sp. SAI-041 Isolate Rhizosphere
225 2954749733 Streptomyces sp. SAI-135 Isolate Rhizosphere
226 2954759201 Streptomyces sp. SAI-208 Isolate Rhizosphere
227 8055066027 Sphaerisporangium corydalis NEAU-YHS15 Isolate Unclassified
228 8055172936 Sphaerisporangium perillae NEAU-ZS1 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 96.7
Metatranscriptomes 0.7
Isolates 2.61

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.17
Nodule 0
Rhizoplane 3.3
Rhizosphere 90.09
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207684_10000756 3300025910 Bacteria 37726
2 JGI25406J46586_10008984 3300003203 Bacteria 4494
3 JGI25406J46586_10026423 3300003203 Bacteria 2237
4 JGI25407J50210_10028405 3300003373 Bacteria 1451
5 Ga0070683_100386646 3300005329 Bacteria 1333
6 Ga0070690_100336546 3300005330 Bacteria 1092
7 Ga0070682_100079034 3300005337 Bacteria 2123
8 Ga0070709_10003584 3300005434 Bacteria 8336
9 Ga0070709_10011275 3300005434 Bacteria 4975
10 Ga0070709_10018782 3300005434 Bacteria 3989
11 Ga0070709_10048739 3300005434 Bacteria 2645
12 Ga0070714_100016143 3300005435 Bacteria 6023
13 Ga0070714_100022897 3300005435 Bacteria 5126
14 Ga0070714_100024927 3300005435 Bacteria 4932
15 Ga0070714_100026743 3300005435 Bacteria 4770
16 Ga0070714_100033820 3300005435 Bacteria 4277
17 Ga0070714_100038056 3300005435 Bacteria 4045
18 Ga0070714_100059204 3300005435 Bacteria 3283
19 Ga0070714_100061222 3300005435 Bacteria 3232
20 Ga0070714_100179460 3300005435 Bacteria 1926
21 Ga0070714_100234570 3300005435 Bacteria 1691
22 Ga0070714_100235340 3300005435 Bacteria 1689
23 Ga0070714_100316897 3300005435 Bacteria 1457
24 Ga0070713_100007039 3300005436 Bacteria 7856
25 Ga0070713_100020907 3300005436 Bacteria 5025
26 Ga0070713_100048628 3300005436 Bacteria 3494
27 Ga0070713_100051445 3300005436 Bacteria 3406
28 Ga0070713_100099851 3300005436 Bacteria 2511
29 Ga0070713_100162305 3300005436 Bacteria 1996
30 Ga0070710_10000765 3300005437 Bacteria 15336
31 Ga0070710_10002346 3300005437 Bacteria 8956
32 Ga0070710_10006743 3300005437 Bacteria 5534
33 Ga0070710_10014035 3300005437 Bacteria 4024
34 Ga0070710_10016459 3300005437 Bacteria 3764
35 Ga0070710_10040972 3300005437 Bacteria 2554
36 Ga0070710_10257684 3300005437 Bacteria 1124
37 Ga0070710_10329164 3300005437 Bacteria 1005
38 Ga0070711_100015423 3300005439 Bacteria 4836
39 Ga0070711_100023838 3300005439 Bacteria 3986
40 Ga0070711_100060644 3300005439 Bacteria 2630
41 Ga0070700_100291144 3300005441 Bacteria 1188
42 Ga0070708_100078964 3300005445 Bacteria 2976
43 Ga0070708_100108815 3300005445 Bacteria 2546
44 Ga0070663_100279792 3300005455 Bacteria 1329
45 Ga0070706_100000348 3300005467 Bacteria 55783
46 Ga0070706_100003716 3300005467 Bacteria 14920
47 Ga0070706_100005264 3300005467 Bacteria 12345
48 Ga0070706_100013350 3300005467 Bacteria 7595
49 Ga0070706_100047623 3300005467 Bacteria 3956
50 Ga0070706_100141237 3300005467 Bacteria 2248
51 Ga0070706_100293717 3300005467 Bacteria 1516
52 Ga0070707_100000012 3300005468 Bacteria 157939
53 Ga0070707_100026971 3300005468 Bacteria 5461
54 Ga0070707_100049752 3300005468 Bacteria 4018
55 Ga0070707_100282028 3300005468 Bacteria 1614
56 Ga0070707_100382276 3300005468 Bacteria 1368
57 Ga0070707_100611268 3300005468 Bacteria 1052
58 Ga0070698_100000437 3300005471 Bacteria 44204
59 Ga0070698_100001956 3300005471 Bacteria 22880
60 Ga0070698_100005713 3300005471 Bacteria 13619
61 Ga0070698_100024777 3300005471 Bacteria 6256
62 Ga0070698_100151978 3300005471 Bacteria 2262
63 Ga0070698_100275695 3300005471 Bacteria 1613
64 Ga0070698_100391628 3300005471 Bacteria 1322
65 Ga0070699_100001249 3300005518 Bacteria 23432
66 Ga0070699_100026636 3300005518 Bacteria 4985
67 Ga0070679_100079216 3300005530 Bacteria 3275
68 Ga0070684_100002426 3300005535 Bacteria 13741
69 Ga0070684_100017491 3300005535 Bacteria 5887
70 Ga0070684_100277019 3300005535 Bacteria 1536
71 Ga0070697_100022418 3300005536 Bacteria 5012
72 Ga0070697_100059838 3300005536 Bacteria 3103
73 Ga0070697_100214337 3300005536 Bacteria 1640
74 Ga0070697_100241515 3300005536 Bacteria 1543
75 Ga0070697_100250755 3300005536 Bacteria 1513
76 Ga0070695_100242737 3300005545 Bacteria 1307
77 Ga0070693_100023731 3300005547 Bacteria 3282
78 Ga0070665_100134461 3300005548 Bacteria 2475
79 Ga0070664_100290851 3300005564 Bacteria 1475
80 Ga0070702_100065226 3300005615 Bacteria 2132
81 Ga0068859_100050571 3300005617 Bacteria 4174
82 Ga0068863_100647923 3300005841 Bacteria 1047
83 Ga0081538_10013926 3300005981 Bacteria 6336
84 Ga0081539_10000194 3300005985 Bacteria 141263
85 Ga0081539_10005220 3300005985 Bacteria 13450
86 Ga0070717_10008244 3300006028 Bacteria 7779
87 Ga0070717_10017635 3300006028 Bacteria 5558
88 Ga0070717_10055668 3300006028 Bacteria 3264
89 Ga0070717_10064515 3300006028 Bacteria 3042
90 Ga0070717_10083918 3300006028 Bacteria 2680
91 Ga0070717_10089426 3300006028 Bacteria 2597
92 Ga0070717_10099039 3300006028 Bacteria 2472
93 Ga0070717_10122015 3300006028 Bacteria 2233
94 Ga0070717_10124094 3300006028 Bacteria 2215
95 Ga0070717_10170331 3300006028 Bacteria 1893
96 Ga0070717_10171577 3300006028 Bacteria 1887
97 Ga0070717_10200316 3300006028 Bacteria 1748
98 Ga0070717_10245399 3300006028 Bacteria 1580
99 Ga0070717_10346009 3300006028 Bacteria 1328
100 Ga0070717_10464959 3300006028 Bacteria 1141
101 Ga0070717_10507216 3300006028 Bacteria 1090
102 Ga0070715_10001982 3300006163 Bacteria 6171
103 Ga0070715_10002015 3300006163 Bacteria 6128
104 Ga0070715_10032895 3300006163 Bacteria 2116
105 Ga0070715_10178386 3300006163 Bacteria 1063
106 Ga0070716_100002711 3300006173 Bacteria 8207
107 Ga0070716_100002750 3300006173 Bacteria 8161
108 Ga0070716_100005696 3300006173 Bacteria 6050
109 Ga0070716_100064402 3300006173 Bacteria 2131
110 Ga0070716_100113482 3300006173 Bacteria 1683
111 Ga0070716_100247775 3300006173 Bacteria 1212
112 Ga0070712_100001641 3300006175 Bacteria 13683
113 Ga0070712_100019088 3300006175 Bacteria 4464
114 Ga0070712_100055989 3300006175 Bacteria 2764
115 Ga0070712_100227431 3300006175 Bacteria 1480
116 Ga0075433_10042930 3300006852 Bacteria 3924
117 Ga0075434_100017893 3300006871 Bacteria 6836
118 Ga0075436_100048977 3300006914 Bacteria 2916
119 Ga0075436_100087244 3300006914 Bacteria 2167
120 Ga0075436_100139960 3300006914 Bacteria 1700
121 Ga0075436_100340467 3300006914 Bacteria 1080
122 Ga0097620_100050575 3300006931 Bacteria 4174
123 Ga0075435_100000179 3300007076 Bacteria 37419
124 Ga0075435_100197715 3300007076 Bacteria 1703
125 Ga0075435_100342201 3300007076 Bacteria 1281
126 Ga0111539_10193490 3300009094 Bacteria 2373
127 Ga0105245_10191072 3300009098 Bacteria 1961
128 Ga0114129_10003733 3300009147 Bacteria 21463
129 Ga0105243_10300801 3300009148 Bacteria 1454
130 Ga0105249_10068359 3300009553 Bacteria 3276
131 Ga0105246_10249795 3300011119 Bacteria 1407
132 Ga0157373_10071641 3300013100 Bacteria 2447
133 Ga0157369_10158166 3300013105 Bacteria 2393
134 Ga0157374_10662213 3300013296 Bacteria 1056
135 Ga0157375_10244674 3300013308 Bacteria 1954
136 Ga0163163_10262183 3300014325 Bacteria 1779
137 Ga0157379_10249147 3300014968 Bacteria 1612
138 Ga0213875_10000629 3300021388 Bacteria 28138
139 Ga0213875_10003898 3300021388 Bacteria 8347
140 Ga0213875_10025604 3300021388 Bacteria 2811
141 Ga0213875_10043426 3300021388 Bacteria 2111
142 Ga0224712_10072815 3300022467 Bacteria 1400
143 Ga0224572_1000326 3300024225 Bacteria 5145
144 Ga0228598_1035657 3300024227 Bacteria 981
145 Ga0207692_10005080 3300025898 Bacteria 5244
146 Ga0207692_10008310 3300025898 Bacteria 4293
147 Ga0207692_10010202 3300025898 Bacteria 3950
148 Ga0207692_10018630 3300025898 Bacteria 3120
149 Ga0207692_10050698 3300025898 Bacteria 2100
150 Ga0207688_10031079 3300025901 Bacteria 2947
151 Ga0207685_10033710 3300025905 Bacteria 1853
152 Ga0207699_10001560 3300025906 Bacteria 10861
153 Ga0207699_10001591 3300025906 Bacteria 10776
154 Ga0207699_10005744 3300025906 Bacteria 5968
155 Ga0207699_10062662 3300025906 Bacteria 2243
156 Ga0207699_10154597 3300025906 Bacteria 1521
157 Ga0207699_10158333 3300025906 Bacteria 1505
158 Ga0207645_10086316 3300025907 Bacteria 2016
159 Ga0207684_10000631 3300025910 Bacteria 42003
160 Ga0207684_10011833 3300025910 Bacteria 7606
161 Ga0207684_10022904 3300025910 Bacteria 5334
162 Ga0207684_10043456 3300025910 Bacteria 3810
163 Ga0207684_10071069 3300025910 Bacteria 2958
164 Ga0207693_10025005 3300025915 Bacteria 4737
165 Ga0207693_10032552 3300025915 Bacteria 4114
166 Ga0207693_10102355 3300025915 Bacteria 2246
167 Ga0207693_10159000 3300025915 Bacteria 1777
168 Ga0207663_10056753 3300025916 Bacteria 2464
169 Ga0207663_10062251 3300025916 Bacteria 2371
170 Ga0207663_10111843 3300025916 Bacteria 1854
171 Ga0207663_10122757 3300025916 Bacteria 1781
172 Ga0207646_10000058 3300025922 Bacteria 158096
173 Ga0207646_10065744 3300025922 Bacteria 3237
174 Ga0207646_10081674 3300025922 Bacteria 2890
175 Ga0207646_10193425 3300025922 Bacteria 1837
176 Ga0207646_10514628 3300025922 Bacteria 1078
177 Ga0207694_10454726 3300025924 Bacteria 1069
178 Ga0207700_10003189 3300025928 Bacteria 9471
179 Ga0207700_10003255 3300025928 Bacteria 9390
180 Ga0207700_10007565 3300025928 Bacteria 6655
181 Ga0207700_10014113 3300025928 Bacteria 5224
182 Ga0207700_10027370 3300025928 Bacteria 3991
183 Ga0207700_10029839 3300025928 Bacteria 3853
184 Ga0207700_10044324 3300025928 Bacteria 3273
185 Ga0207700_10047452 3300025928 Bacteria 3183
186 Ga0207700_10083278 3300025928 Bacteria 2504
187 Ga0207700_10104408 3300025928 Bacteria 2267
188 Ga0207700_10158846 3300025928 Bacteria 1876
189 Ga0207700_10186326 3300025928 Bacteria 1741
190 Ga0207700_10193025 3300025928 Bacteria 1712
191 Ga0207664_10005349 3300025929 Bacteria 8769
192 Ga0207664_10036446 3300025929 Bacteria 3802
193 Ga0207664_10038146 3300025929 Bacteria 3724
194 Ga0207664_10041749 3300025929 Bacteria 3575
195 Ga0207664_10047311 3300025929 Bacteria 3378
196 Ga0207664_10051172 3300025929 Bacteria 3260
197 Ga0207664_10067076 3300025929 Bacteria 2878
198 Ga0207664_10135200 3300025929 Bacteria 2080
199 Ga0207664_10140653 3300025929 Bacteria 2041
200 Ga0207664_10153263 3300025929 Bacteria 1959
201 Ga0207664_10169522 3300025929 Bacteria 1867
202 Ga0207664_10187546 3300025929 Bacteria 1779
203 Ga0207664_10237984 3300025929 Bacteria 1584
204 Ga0207664_10292219 3300025929 Bacteria 1432
205 Ga0207664_10379219 3300025929 Bacteria 1255
206 Ga0207670_10335069 3300025936 Bacteria 1194
207 Ga0207665_10000435 3300025939 Bacteria 28745
208 Ga0207665_10000613 3300025939 Bacteria 23964
209 Ga0207665_10002741 3300025939 Bacteria 11815
210 Ga0207665_10005902 3300025939 Bacteria 8149
211 Ga0207665_10055386 3300025939 Bacteria 2676
212 Ga0207665_10089763 3300025939 Bacteria 2129
213 Ga0207661_10152153 3300025944 Bacteria 2001
214 Ga0207661_10166258 3300025944 Bacteria 1917
215 Ga0207679_10177177 3300025945 Bacteria 1761
216 Ga0207640_10069887 3300025981 Bacteria 2359
217 Ga0207678_10015016 3300026067 Bacteria 6814
218 Ga0207676_10447787 3300026095 Bacteria 1217
219 Ga0207674_10086308 3300026116 Bacteria 3133
220 Ga0268266_10181273 3300028379 Bacteria 1918
221 Ga0307515_10000167 3300028794 Bacteria 160820
222 Ga0307515_10001685 3300028794 Bacteria 49281
223 Ga0307515_10027752 3300028794 Bacteria 9657
224 Ga0307515_10037606 3300028794 Bacteria 7777
225 Ga0307515_10081340 3300028794 Bacteria 4209
226 Ga0307515_10104340 3300028794 Bacteria 3388
227 Ga0265338_10234595 3300028800 Bacteria 1362
228 Ga0307511_10040437 3300030521 Bacteria 3960
229 Ga0307512_10005199 3300030522 Bacteria 13722
230 Ga0307512_10008808 3300030522 Bacteria 9792
231 Ga0307512_10168376 3300030522 Bacteria 1263
232 Ga0265760_10027727 3300031090 Bacteria 1660
233 Ga0265760_10072398 3300031090 Bacteria 1058
234 Ga0307513_10033912 3300031456 Bacteria 5734
235 Ga0307513_10330791 3300031456 Bacteria 1278
236 Ga0307509_10100245 3300031507 Bacteria 2935
237 Ga0307408_100030076 3300031548 Bacteria 3769
238 Ga0307408_100177922 3300031548 Bacteria 1703
239 Ga0307508_10013314 3300031616 Bacteria 7523
240 Ga0307516_10005181 3300031730 Bacteria 15706
241 Ga0307516_10007407 3300031730 Bacteria 12624
242 Ga0307516_10016354 3300031730 Bacteria 7763
243 Ga0307405_10191917 3300031731 Bacteria 1476
244 Ga0307413_10082323 3300031824 Bacteria 2067
245 Ga0307410_10020720 3300031852 Bacteria 4029
246 Ga0307410_10078614 3300031852 Bacteria 2309
247 Ga0307406_10010107 3300031901 Bacteria 5315
248 Ga0307406_10030272 3300031901 Bacteria 3285
249 Ga0307407_10034135 3300031903 Bacteria 2782
250 Ga0307407_10040001 3300031903 Bacteria 2611
251 Ga0307407_10052356 3300031903 Bacteria 2344
252 Ga0307407_10178746 3300031903 Bacteria 1404
253 Ga0307412_10572822 3300031911 Bacteria 952
254 Ga0307409_100008019 3300031995 Bacteria 6367
255 Ga0307409_100653076 3300031995 Bacteria 1046
256 Ga0307416_100005243 3300032002 Bacteria 7929
257 Ga0307416_100064393 3300032002 Bacteria 3007
258 Ga0307416_100111315 3300032002 Bacteria 2413
259 Ga0307416_100151009 3300032002 Bacteria 2130
260 Ga0307416_100243549 3300032002 Bacteria 1744
261 Ga0307411_10098339 3300032005 Bacteria 2062
262 Ga0307411_10649837 3300032005 Bacteria 913
263 Ga0307415_100031559 3300032126 Bacteria 3414
264 Ga0307415_100039548 3300032126 Bacteria 3118
265 Ga0307415_100267695 3300032126 Bacteria 1398
266 Ga0373934_0022726 3300035086 Bacteria 2419
267 Ga0373934_0051736 3300035086 Bacteria 1628
268 Ga0373934_0114832 3300035086 Bacteria 1094
269 Ga0373936_0013036 3300035113 Bacteria 3170
270 Ga0373936_0065782 3300035113 Bacteria 1487
271 Ga0373936_0098230 3300035113 Bacteria 1233
272 Ga0373945_0076282 3300035116 Bacteria 1277
273 Ga0373953_0067492 3300035117 Bacteria 1472
274 Ga0373956_0003022 3300035119 Bacteria 6812
275 Ga0373956_0028890 3300035119 Bacteria 2415
276 Ga0373956_0036363 3300035119 Bacteria 2173
277 Ga0373957_0020600 3300035120 Bacteria 2331
278 Ga0373943_0125770 3300035170 Bacteria 1367
279 Ga0373946_0075907 3300035171 Bacteria 1462
280 Ga0373955_0024376 3300035172 Bacteria 3094
281 Ga0373955_0089555 3300035172 Bacteria 1751
282 Ga0373924_0001732 3300035410 Bacteria 7206
283 Ga0373924_0036966 3300035410 Bacteria 1986
284 Ga0373924_0047358 3300035410 Bacteria 1773
285 Ga0373931_0067863 3300035691 Bacteria 1939
286 Ga0373935_0009336 3300035692 Bacteria 5874
287 Ga0373935_0056022 3300035692 Bacteria 2512
288 Ga0373935_0113517 3300035692 Bacteria 1801
289 Ga0373935_0202829 3300035692 Bacteria 1371
290 Ga0373927_0385736 3300035695 Bacteria 924
291 Ga0373933_0038238 3300035724 Bacteria 2819
292 Ga0373933_0081288 3300035724 Bacteria 1987
293 Ga0373933_0086576 3300035724 Bacteria 1928
294 Ga0373933_0137459 3300035724 Bacteria 1540
295 Ga0373937_0021722 3300036401 Bacteria 5761
296 Ga0373937_0023714 3300036401 Bacteria 5529
297 Ga0373937_0058049 3300036401 Bacteria 3555
298 Ga0373937_0070924 3300036401 Bacteria 3214
299 Ga0373937_0130870 3300036401 Bacteria 2343
300 Ga0373937_0278377 3300036401 Bacteria 1579
301 Ga0373937_0491731 3300036401 Bacteria 1165
302 Ga0373937_0571278 3300036401 Bacteria 1074
303 Ga0372808_000178 3300036459 Bacteria 3837
304 Ga0373925_0007508 3300037068 Bacteria 7949
305 Ga0373925_0033311 3300037068 Bacteria 3797
306 Ga0373925_0097844 3300037068 Bacteria 2251
307 Ga0373925_0119767 3300037068 Bacteria 2042
308 Ga0373925_0466947 3300037068 Bacteria 1034
309 Ga0373925_0609074 3300037068 Bacteria 899
310 Ga0395900_0008233 3300037418 Bacteria 10736
311 Ga0395900_0029611 3300037418 Bacteria 5617
312 Ga0395898_0044701 3300037466 Bacteria 4357
313 Ga0395898_0162490 3300037466 Bacteria 2136
314 Ga0395898_0405990 3300037466 Bacteria 1299
315 Ga0395905_0028601 3300037471 Bacteria 5254
316 Ga0395905_0229933 3300037471 Bacteria 1734
317 Ga0436364_0225421 3300037853 Bacteria 3165
318 Ga0436364_0727481 3300037853 Bacteria 4243
319 Ga0436364_1223233 3300037853 Bacteria 42179
320 Ga0436364_1244739 3300037853 Bacteria 6094
321 Ga0436364_1289113 3300037853 Bacteria 63139
322 Ga0395901_0075095 3300038443 Bacteria 3526
323 Ga0395901_0502970 3300038443 Bacteria 1233
324 Ga0436363_0448052 3300039450 Bacteria 1678
325 Ga0436363_1676442 3300039450 Bacteria 1210
326 Ga0436362_0641096 3300039453 Bacteria 996
327 Ga0451845_0131708 3300041501 Bacteria 1289
328 Ga0439443_000546 3300042003 Bacteria 3433
329 Ga0439448_0001131 3300042005 Bacteria 6731
330 Ga0439450_000652 3300042008 Bacteria 4629
331 Ga0439454_003423 3300042011 Bacteria 1764
332 Ga0439455_0000536 3300042012 Bacteria 5333
333 Ga0439463_000238 3300042016 Bacteria 15188
334 Ga0450900_002902 3300042136 Bacteria 1860
335 Ga0439444_0005583 3300042437 Bacteria 1873
336 Ga0439464_0000084 3300042439 Bacteria 13610
337 Ga0450916_007046 3300042530 Bacteria 1340
338 Ga0439440_0000100 3300042993 Bacteria 11397
339 Ga0466963_0088419 3300044694 Bacteria 2108
340 Ga0466967_0124182 3300045976 Bacteria 2389
341 Ga0495592_0037034 3300046454 Bacteria 3673
342 Ga0495592_0083053 3300046454 Bacteria 2313
343 Ga0495592_0109300 3300046454 Bacteria 1959
344 Ga0495592_0148014 3300046454 Bacteria 1626
345 Ga0495603_0036513 3300046455 Bacteria 2950
346 Ga0495629_0016069 3300046459 Bacteria 5377
347 Ga0495629_0036807 3300046459 Bacteria 3452
348 Ga0495629_0060518 3300046459 Bacteria 2646
349 Ga0495641_0018397 3300046461 Bacteria 3605
350 Ga0495641_0029684 3300046461 Bacteria 2632
351 Ga0495651_0025963 3300046462 Bacteria 4560
352 Ga0495651_0031451 3300046462 Bacteria 4138
353 Ga0495651_0052855 3300046462 Bacteria 3128
354 Ga0495651_0073838 3300046462 Bacteria 2588
355 Ga0495651_0098066 3300046462 Bacteria 2187
356 Ga0495653_0002410 3300046463 Bacteria 14882
357 Ga0495653_0026538 3300046463 Bacteria 4643
358 Ga0495653_0046989 3300046463 Bacteria 3340
359 Ga0495653_0136276 3300046463 Bacteria 1731
360 Ga0495653_0178258 3300046463 Bacteria 1461
361 Ga0495582_0012751 3300046473 Bacteria 4630
362 Ga0495582_0022356 3300046473 Bacteria 3461
363 Ga0495582_0090847 3300046473 Bacteria 1702
364 Ga0495639_0045627 3300046475 Bacteria 1983
365 Ga0495662_0065195 3300046476 Bacteria 1760
366 Ga0495664_0017619 3300046477 Bacteria 4085
367 Ga0495664_0018279 3300046477 Bacteria 4013
368 Ga0495664_0019700 3300046477 Bacteria 3883
369 Ga0495664_0027012 3300046477 Bacteria 3345
370 Ga0495664_0057391 3300046477 Bacteria 2316
371 Ga0495664_0175280 3300046477 Bacteria 1301
372 Ga0495664_0177750 3300046477 Bacteria 1291
373 Ga0495608_0000285 3300046511 Bacteria 35530
374 Ga0495608_0001639 3300046511 Bacteria 16079
375 Ga0495608_0013926 3300046511 Bacteria 5581
376 Ga0495608_0032421 3300046511 Bacteria 3531
377 Ga0495608_0137520 3300046511 Bacteria 1560
378 Ga0495618_0029558 3300046514 Bacteria 3419
379 Ga0495618_0031464 3300046514 Bacteria 3319
380 Ga0495618_0057462 3300046514 Bacteria 2463
381 Ga0495618_0077839 3300046514 Bacteria 2113
382 Ga0495618_0090824 3300046514 Bacteria 1952
383 Ga0495618_0099897 3300046514 Bacteria 1857
384 Ga0495618_0140355 3300046514 Bacteria 1546
385 Ga0495618_0146190 3300046514 Bacteria 1511
386 Ga0495628_0014784 3300046516 Bacteria 6529
387 Ga0495628_0028036 3300046516 Bacteria 4579
388 Ga0495628_0030140 3300046516 Bacteria 4393
389 Ga0495628_0087480 3300046516 Bacteria 2415
390 Ga0495628_0096684 3300046516 Bacteria 2281
391 Ga0495628_0129856 3300046516 Bacteria 1928
392 Ga0495630_0191288 3300046517 Bacteria 1561
393 Ga0495666_0028415 3300046526 Bacteria 2751
394 Ga0495666_0044211 3300046526 Bacteria 2151
395 Ga0495652_0001447 3300046529 Bacteria 26276
396 Ga0495652_0005070 3300046529 Bacteria 12468
397 Ga0495652_0039121 3300046529 Bacteria 4102
398 Ga0495652_0097701 3300046529 Bacteria 2388
399 Ga0495652_0214058 3300046529 Bacteria 1452
400 Ga0495665_0004589 3300046531 Bacteria 7458
401 Ga0495665_0008389 3300046531 Bacteria 5605
402 Ga0495665_0013784 3300046531 Bacteria 4366
403 Ga0495640_0011728 3300046533 Bacteria 6729
404 Ga0495640_0051661 3300046533 Bacteria 2825
405 Ga0495640_0062164 3300046533 Bacteria 2533
406 Ga0495640_0150205 3300046533 Bacteria 1497
407 Ga0495640_0167129 3300046533 Bacteria 1407
408 Ga0495640_0169452 3300046533 Bacteria 1395
409 Ga0495586_0000883 3300046535 Bacteria 17173
410 Ga0495586_0023317 3300046535 Bacteria 3305
411 Ga0495586_0132390 3300046535 Bacteria 1396
412 Ga0495587_0027663 3300046536 Bacteria 3452
413 Ga0495587_0041938 3300046536 Bacteria 2730
414 Ga0495587_0155531 3300046536 Bacteria 1302
415 Ga0495587_0156339 3300046536 Bacteria 1298
416 Ga0495645_0016740 3300046543 Bacteria 5244
417 Ga0495645_0021442 3300046543 Bacteria 4669
418 Ga0495645_0049279 3300046543 Bacteria 3067
419 Ga0495645_0054687 3300046543 Bacteria 2900
420 Ga0495645_0056908 3300046543 Bacteria 2839
421 Ga0495645_0068431 3300046543 Bacteria 2563
422 Ga0495645_0074925 3300046543 Bacteria 2436
423 Ga0495645_0083364 3300046543 Bacteria 2291
424 Ga0495645_0129008 3300046543 Bacteria 1774
425 Ga0495667_0000323 3300046559 Bacteria 30275
426 Ga0495667_0027748 3300046559 Bacteria 3812
427 Ga0495667_0034827 3300046559 Bacteria 3366
428 Ga0495667_0035386 3300046559 Bacteria 3337
429 Ga0495634_0029859 3300046642 Bacteria 3770
430 Ga0495634_0127695 3300046642 Bacteria 1623
431 Ga0495634_0162184 3300046642 Bacteria 1409
432 Ga0495635_0001065 3300046663 Bacteria 18167
433 Ga0495635_0012234 3300046663 Bacteria 6013
434 Ga0495635_0015650 3300046663 Bacteria 5298
435 Ga0495635_0047324 3300046663 Bacteria 2966
436 Ga0495635_0054510 3300046663 Bacteria 2754
437 Ga0495635_0155573 3300046663 Bacteria 1556
438 Ga0495635_0198186 3300046663 Bacteria 1362
439 Ga0495657_0000950 3300046675 Bacteria 25579
440 Ga0495657_0038798 3300046675 Bacteria 3275
441 Ga0495657_0060949 3300046675 Bacteria 2497
442 Ga0495599_0007717 3300046678 Bacteria 6534
443 Ga0495599_0031893 3300046678 Bacteria 3307
444 Ga0495599_0041892 3300046678 Bacteria 2874
445 Ga0495599_0073331 3300046678 Bacteria 2137
446 Ga0495599_0104089 3300046678 Bacteria 1768
447 Ga0495599_0209858 3300046678 Bacteria 1194
448 Ga0495623_0015990 3300046679 Bacteria 4849
449 Ga0495623_0126481 3300046679 Bacteria 1534
450 Ga0495623_0149046 3300046679 Bacteria 1384
451 Ga0495646_0028829 3300046680 Bacteria 3473
452 Ga0495647_0007641 3300046681 Bacteria 3629
453 Ga0495613_0056896 3300046689 Bacteria 2871
454 Ga0495613_0077151 3300046689 Bacteria 2424
455 Ga0495613_0276996 3300046689 Bacteria 1166
456 Ga0495600_0002680 3300046809 Bacteria 10292
457 Ga0495600_0089389 3300046809 Bacteria 2009
458 Ga0495600_0114695 3300046809 Bacteria 1754
459 Ga0495581_0005523 3300047315 Bacteria 7322
460 Ga0495581_0013975 3300047315 Bacteria 4656
461 Ga0495581_0025889 3300047315 Bacteria 3402
462 Ga0495581_0283890 3300047315 Bacteria 968
463 Ga0495604_0002820 3300047317 Bacteria 13953
464 Ga0495604_0035939 3300047317 Bacteria 3908
465 Ga0495604_0042055 3300047317 Bacteria 3582
466 Ga0495604_0121419 3300047317 Bacteria 1891
467 Ga0495604_0226363 3300047317 Bacteria 1285
468 Ga0495674_0002467 3300047319 Bacteria 18059
469 Ga0495674_0002503 3300047319 Bacteria 17909
470 Ga0495674_0019785 3300047319 Bacteria 6242
471 Ga0495674_0096799 3300047319 Bacteria 2515
472 Ga0495674_0206271 3300047319 Bacteria 1629
473 Ga0495674_0363784 3300047319 Bacteria 1172
474 Ga0495676_0293077 3300047321 Bacteria 1099
475 Ga0495676_0325445 3300047321 Bacteria 1032
476 Ga0495680_0003938 3300047322 Bacteria 14358
477 Ga0495680_0008151 3300047322 Bacteria 9549
478 Ga0495680_0015918 3300047322 Bacteria 6474
479 Ga0495680_0028098 3300047322 Bacteria 4614
480 Ga0495680_0071346 3300047322 Bacteria 2644
481 Ga0495675_0017817 3300047444 Bacteria 4503
482 Ga0495675_0047387 3300047444 Bacteria 2734
483 Ga0495675_0103968 3300047444 Bacteria 1775
484 Ga0495684_0015130 3300047471 Bacteria 5942
485 Ga0495684_0022783 3300047471 Bacteria 4816
486 Ga0495684_0046480 3300047471 Bacteria 3320
487 Ga0495684_0086273 3300047471 Bacteria 2379
488 Ga0495684_0273446 3300047471 Bacteria 1221
489 Ga0495593_0001814 3300047673 Bacteria 12695
490 Ga0495593_0012440 3300047673 Bacteria 4864
491 Ga0495593_0041593 3300047673 Bacteria 2470
492 Ga0495602_0036470 3300048088 Bacteria 4576
493 Ga0495602_0037961 3300048088 Bacteria 4460
494 Ga0495602_0040461 3300048088 Bacteria 4273
495 Ga0495602_0055675 3300048088 Bacteria 3482
496 Ga0495602_0086799 3300048088 Bacteria 2611
497 Ga0495602_0096911 3300048088 Bacteria 2431
498 Ga0495602_0157444 3300048088 Bacteria 1777
499 Ga0495614_0035844 3300048089 Bacteria 2131
500 Ga0495614_0049675 3300048089 Bacteria 1798
501 Ga0496101_0611464 3300048904 Bacteria 861
502 Ga0496103_0229917 3300048906 Bacteria 1193
503 Ga0496104_0060091 3300048907 Bacteria 3600
504 Ga0496104_0348549 3300048907 Bacteria 1393
505 Ga0496105_0001409 3300048908 Bacteria 16890
506 Ga0496105_0302861 3300048908 Bacteria 1284
507 Ga0496106_0020973 3300048909 Bacteria 4849
508 Ga0496106_0047776 3300048909 Bacteria 3222
509 Ga0496108_0017993 3300048911 Bacteria 5781
510 Ga0496109_0029911 3300048912 Bacteria 4881
511 Ga0496109_0233807 3300048912 Bacteria 1729
512 Ga0496110_0160580 3300048913 Bacteria 2037
513 Ga0496111_0011486 3300048914 Bacteria 5968
514 Ga0496112_0003460 3300048915 Bacteria 13048
515 Ga0496112_0121954 3300048915 Bacteria 2577
516 Ga0496112_0282085 3300048915 Bacteria 1608
517 Ga0496113_0012826 3300048916 Bacteria 5649
518 Ga0496114_0340994 3300048917 Bacteria 1325
519 Ga0496115_0008739 3300048918 Bacteria 7509
520 Ga0496126_0049082 3300048929 Bacteria 3855
521 Ga0496126_0138718 3300048929 Bacteria 2095
522 Ga0501031_0007555 3300049568 Bacteria 7081
523 Ga0501033_0188383 3300049570 Bacteria 1477
524 Ga0501036_0042828 3300049572 Bacteria 3833
525 Ga0501038_0012121 3300049574 Bacteria 7873
526 Ga0501041_0031090 3300049577 Bacteria 3223
527 Ga0501042_0073229 3300049578 Bacteria 2450
528 Ga0501048_0010399 3300049582 Bacteria 6948
529 Ga0501071_0020333 3300049587 Bacteria 4612
530 Ga0501074_0001994 3300049590 Bacteria 14060
531 Ga0501076_0011958 3300049592 Bacteria 6484
532 Ga0501081_0025368 3300049743 Bacteria 3987
533 Ga0501083_0056251 3300049744 Bacteria 2636
534 Ga0501045_0003848 3300049824 Bacteria 10330
535 nmdc:mga05p37_126909_c1 3300050507 Bacteria 3133
536 nmdc:mga05p37_265654_c1 3300050507 Bacteria 2052
537 nmdc:mga0n895_24930_c1 3300050512 Bacteria 5644
538 nmdc:mga0n895_8245_c1 3300050512 Bacteria 9010
539 nmdc:mga0rr50_148283_c1 3300050513 Bacteria 1893
540 nmdc:mga0rr50_45586_c1 3300050513 Bacteria 3224
541 nmdc:mga08x19_14128_c1 3300050514 Bacteria 4838
542 nmdc:mga08x19_207002_c1 3300050514 Bacteria 1346
543 nmdc:mga08x19_366219_c1 3300050514 Bacteria 1008
544 nmdc:mga08x19_93034_c1 3300050514 Bacteria 1992
545 nmdc:mga0a205_13285_c1 3300050515 Bacteria 7658
546 Ga0495601_0000569 3300053077 Bacteria 19584
547 Ga0495601_0035871 3300053077 Bacteria 3096
548 Ga0495601_0066123 3300053077 Bacteria 2301
549 Ga0495601_0129092 3300053077 Bacteria 1645
550 Ga0495601_0167367 3300053077 Bacteria 1436
551 Ga0495612_0005937 3300053078 Bacteria 5030
552 Ga0495595_0001227 3300053084 Bacteria 9986
553 Ga0495595_0002846 3300053084 Bacteria 6812
554 Ga0495619_0003101 3300053085 Bacteria 10784
555 Ga0495619_0052448 3300053085 Bacteria 2696
556 Ga0495619_0066040 3300053085 Bacteria 2414
557 Ga0495619_0077320 3300053085 Bacteria 2235
558 Ga0500651_0156337 3300053093 Bacteria 1366
559 Ga0501084_0000897 3300054114 Bacteria 23036
560 Ga0501082_0082907 3300060353 Bacteria 2766
561 2643902565 2643221578 Bacteria 9213798
562 2644264577 2643221647 Bacteria 10741251
563 2644404926 2643221673 Bacteria 9196637
564 2753268398 2751185782 Bacteria 11227053
565 2946048916 2946045630 Bacteria 8527308
566 2954697562 2954691527 Bacteria 10720516
567 2954704646 2954701450 Bacteria 10834262
568 2954716719 2954711539 Bacteria 10867210
569 2954726666 2954721474 Bacteria 10456478
570 2954735129 2954731030 Bacteria 10243860
571 2954745588 2954740390 Bacteria 10229294
572 2954754000 2954749733 Bacteria 10366972
573 2954764563 2954759201 Bacteria 9358192
574 8055069462 8055066027 Bacteria 9479577
575 8055180118 8055172936 Bacteria 9305943
576 Ga0207684_10000756
577 JGI25406J46586_10008984
578 JGI25406J46586_10026423
579 JGI25407J50210_10028405
580 Ga0070683_100386646
581 Ga0070690_100336546
582 Ga0070682_100079034
583 Ga0070709_10003584
584 Ga0070709_10011275
585 Ga0070709_10018782
586 Ga0070709_10048739
587 Ga0070714_100016143
588 Ga0070714_100022897
589 Ga0070714_100024927
590 Ga0070714_100026743
591 Ga0070714_100033820
592 Ga0070714_100038056
593 Ga0070714_100059204
594 Ga0070714_100061222
595 Ga0070714_100179460
596 Ga0070714_100234570
597 Ga0070714_100235340
598 Ga0070714_100316897
599 Ga0070713_100007039
600 Ga0070713_100020907
601 Ga0070713_100048628
602 Ga0070713_100051445
603 Ga0070713_100099851
604 Ga0070713_100162305
605 Ga0070710_10000765
606 Ga0070710_10002346
607 Ga0070710_10006743
608 Ga0070710_10014035
609 Ga0070710_10016459
610 Ga0070710_10040972
611 Ga0070710_10257684
612 Ga0070710_10329164
613 Ga0070711_100015423
614 Ga0070711_100023838
615 Ga0070711_100060644
616 Ga0070700_100291144
617 Ga0070708_100078964
618 Ga0070708_100108815
619 Ga0070663_100279792
620 Ga0070706_100000348
621 Ga0070706_100003716
622 Ga0070706_100005264
623 Ga0070706_100013350
624 Ga0070706_100047623
625 Ga0070706_100141237
626 Ga0070706_100293717
627 Ga0070707_100000012
628 Ga0070707_100026971
629 Ga0070707_100049752
630 Ga0070707_100282028
631 Ga0070707_100382276
632 Ga0070707_100611268
633 Ga0070698_100000437
634 Ga0070698_100001956
635 Ga0070698_100005713
636 Ga0070698_100024777
637 Ga0070698_100151978
638 Ga0070698_100275695
639 Ga0070698_100391628
640 Ga0070699_100001249
641 Ga0070699_100026636
642 Ga0070679_100079216
643 Ga0070684_100002426
644 Ga0070684_100017491
645 Ga0070684_100277019
646 Ga0070697_100022418
647 Ga0070697_100059838
648 Ga0070697_100214337
649 Ga0070697_100241515
650 Ga0070697_100250755
651 Ga0070695_100242737
652 Ga0070693_100023731
653 Ga0070665_100134461
654 Ga0070664_100290851
655 Ga0070702_100065226
656 Ga0068859_100050571
657 Ga0068863_100647923
658 Ga0081538_10013926
659 Ga0081539_10000194
660 Ga0081539_10005220
661 Ga0070717_10008244
662 Ga0070717_10017635
663 Ga0070717_10055668
664 Ga0070717_10064515
665 Ga0070717_10083918
666 Ga0070717_10089426
667 Ga0070717_10099039
668 Ga0070717_10122015
669 Ga0070717_10124094
670 Ga0070717_10170331
671 Ga0070717_10171577
672 Ga0070717_10200316
673 Ga0070717_10245399
674 Ga0070717_10346009
675 Ga0070717_10464959
676 Ga0070717_10507216
677 Ga0070715_10001982
678 Ga0070715_10002015
679 Ga0070715_10032895
680 Ga0070715_10178386
681 Ga0070716_100002711
682 Ga0070716_100002750
683 Ga0070716_100005696
684 Ga0070716_100064402
685 Ga0070716_100113482
686 Ga0070716_100247775
687 Ga0070712_100001641
688 Ga0070712_100019088
689 Ga0070712_100055989
690 Ga0070712_100227431
691 Ga0075433_10042930
692 Ga0075434_100017893
693 Ga0075436_100048977
694 Ga0075436_100087244
695 Ga0075436_100139960
696 Ga0075436_100340467
697 Ga0097620_100050575
698 Ga0075435_100000179
699 Ga0075435_100197715
700 Ga0075435_100342201
701 Ga0111539_10193490
702 Ga0105245_10191072
703 Ga0114129_10003733
704 Ga0105243_10300801
705 Ga0105249_10068359
706 Ga0105246_10249795
707 Ga0157373_10071641
708 Ga0157369_10158166
709 Ga0157374_10662213
710 Ga0157375_10244674
711 Ga0163163_10262183
712 Ga0157379_10249147
713 Ga0213875_10000629
714 Ga0213875_10003898
715 Ga0213875_10025604
716 Ga0213875_10043426
717 Ga0224712_10072815
718 Ga0224572_1000326
719 Ga0228598_1035657
720 Ga0207692_10005080
721 Ga0207692_10008310
722 Ga0207692_10010202
723 Ga0207692_10018630
724 Ga0207692_10050698
725 Ga0207688_10031079
726 Ga0207685_10033710
727 Ga0207699_10001560
728 Ga0207699_10001591
729 Ga0207699_10005744
730 Ga0207699_10062662
731 Ga0207699_10154597
732 Ga0207699_10158333
733 Ga0207645_10086316
734 Ga0207684_10000631
735 Ga0207684_10011833
736 Ga0207684_10022904
737 Ga0207684_10043456
738 Ga0207684_10071069
739 Ga0207693_10025005
740 Ga0207693_10032552
741 Ga0207693_10102355
742 Ga0207693_10159000
743 Ga0207663_10056753
744 Ga0207663_10062251
745 Ga0207663_10111843
746 Ga0207663_10122757
747 Ga0207646_10000058
748 Ga0207646_10065744
749 Ga0207646_10081674
750 Ga0207646_10193425
751 Ga0207646_10514628
752 Ga0207694_10454726
753 Ga0207700_10003189
754 Ga0207700_10003255
755 Ga0207700_10007565
756 Ga0207700_10014113
757 Ga0207700_10027370
758 Ga0207700_10029839
759 Ga0207700_10044324
760 Ga0207700_10047452
761 Ga0207700_10083278
762 Ga0207700_10104408
763 Ga0207700_10158846
764 Ga0207700_10186326
765 Ga0207700_10193025
766 Ga0207664_10005349
767 Ga0207664_10036446
768 Ga0207664_10038146
769 Ga0207664_10041749
770 Ga0207664_10047311
771 Ga0207664_10051172
772 Ga0207664_10067076
773 Ga0207664_10135200
774 Ga0207664_10140653
775 Ga0207664_10153263
776 Ga0207664_10169522
777 Ga0207664_10187546
778 Ga0207664_10237984
779 Ga0207664_10292219
780 Ga0207664_10379219
781 Ga0207670_10335069
782 Ga0207665_10000435
783 Ga0207665_10000613
784 Ga0207665_10002741
785 Ga0207665_10005902
786 Ga0207665_10055386
787 Ga0207665_10089763
788 Ga0207661_10152153
789 Ga0207661_10166258
790 Ga0207679_10177177
791 Ga0207640_10069887
792 Ga0207678_10015016
793 Ga0207676_10447787
794 Ga0207674_10086308
795 Ga0268266_10181273
796 Ga0307515_10000167
797 Ga0307515_10001685
798 Ga0307515_10027752
799 Ga0307515_10037606
800 Ga0307515_10081340
801 Ga0307515_10104340
802 Ga0265338_10234595
803 Ga0307511_10040437
804 Ga0307512_10005199
805 Ga0307512_10008808
806 Ga0307512_10168376
807 Ga0265760_10027727
808 Ga0265760_10072398
809 Ga0307513_10033912
810 Ga0307513_10330791
811 Ga0307509_10100245
812 Ga0307408_100030076
813 Ga0307408_100177922
814 Ga0307508_10013314
815 Ga0307516_10005181
816 Ga0307516_10007407
817 Ga0307516_10016354
818 Ga0307405_10191917
819 Ga0307413_10082323
820 Ga0307410_10020720
821 Ga0307410_10078614
822 Ga0307406_10010107
823 Ga0307406_10030272
824 Ga0307407_10034135
825 Ga0307407_10040001
826 Ga0307407_10052356
827 Ga0307407_10178746
828 Ga0307412_10572822
829 Ga0307409_100008019
830 Ga0307409_100653076
831 Ga0307416_100005243
832 Ga0307416_100064393
833 Ga0307416_100111315
834 Ga0307416_100151009
835 Ga0307416_100243549
836 Ga0307411_10098339
837 Ga0307411_10649837
838 Ga0307415_100031559
839 Ga0307415_100039548
840 Ga0307415_100267695
841 Ga0373934_0022726
842 Ga0373934_0051736
843 Ga0373934_0114832
844 Ga0373936_0013036
845 Ga0373936_0065782
846 Ga0373936_0098230
847 Ga0373945_0076282
848 Ga0373953_0067492
849 Ga0373956_0003022
850 Ga0373956_0028890
851 Ga0373956_0036363
852 Ga0373957_0020600
853 Ga0373943_0125770
854 Ga0373946_0075907
855 Ga0373955_0024376
856 Ga0373955_0089555
857 Ga0373924_0001732
858 Ga0373924_0036966
859 Ga0373924_0047358
860 Ga0373931_0067863
861 Ga0373935_0009336
862 Ga0373935_0056022
863 Ga0373935_0113517
864 Ga0373935_0202829
865 Ga0373927_0385736
866 Ga0373933_0038238
867 Ga0373933_0081288
868 Ga0373933_0086576
869 Ga0373933_0137459
870 Ga0373937_0021722
871 Ga0373937_0023714
872 Ga0373937_0058049
873 Ga0373937_0070924
874 Ga0373937_0130870
875 Ga0373937_0278377
876 Ga0373937_0491731
877 Ga0373937_0571278
878 Ga0372808_000178
879 Ga0373925_0007508
880 Ga0373925_0033311
881 Ga0373925_0097844
882 Ga0373925_0119767
883 Ga0373925_0466947
884 Ga0373925_0609074
885 Ga0395900_0008233
886 Ga0395900_0029611
887 Ga0395898_0044701
888 Ga0395898_0162490
889 Ga0395898_0405990
890 Ga0395905_0028601
891 Ga0395905_0229933
892 Ga0436364_0225421
893 Ga0436364_0727481
894 Ga0436364_1223233
895 Ga0436364_1244739
896 Ga0436364_1289113
897 Ga0395901_0075095
898 Ga0395901_0502970
899 Ga0436363_0448052
900 Ga0436363_1676442
901 Ga0436362_0641096
902 Ga0451845_0131708
903 Ga0439443_000546
904 Ga0439448_0001131
905 Ga0439450_000652
906 Ga0439454_003423
907 Ga0439455_0000536
908 Ga0439463_000238
909 Ga0450900_002902
910 Ga0439444_0005583
911 Ga0439464_0000084
912 Ga0450916_007046
913 Ga0439440_0000100
914 Ga0466963_0088419
915 Ga0466967_0124182
916 Ga0495592_0037034
917 Ga0495592_0083053
918 Ga0495592_0109300
919 Ga0495592_0148014
920 Ga0495603_0036513
921 Ga0495629_0016069
922 Ga0495629_0036807
923 Ga0495629_0060518
924 Ga0495641_0018397
925 Ga0495641_0029684
926 Ga0495651_0025963
927 Ga0495651_0031451
928 Ga0495651_0052855
929 Ga0495651_0073838
930 Ga0495651_0098066
931 Ga0495653_0002410
932 Ga0495653_0026538
933 Ga0495653_0046989
934 Ga0495653_0136276
935 Ga0495653_0178258
936 Ga0495582_0012751
937 Ga0495582_0022356
938 Ga0495582_0090847
939 Ga0495639_0045627
940 Ga0495662_0065195
941 Ga0495664_0017619
942 Ga0495664_0018279
943 Ga0495664_0019700
944 Ga0495664_0027012
945 Ga0495664_0057391
946 Ga0495664_0175280
947 Ga0495664_0177750
948 Ga0495608_0000285
949 Ga0495608_0001639
950 Ga0495608_0013926
951 Ga0495608_0032421
952 Ga0495608_0137520
953 Ga0495618_0029558
954 Ga0495618_0031464
955 Ga0495618_0057462
956 Ga0495618_0077839
957 Ga0495618_0090824
958 Ga0495618_0099897
959 Ga0495618_0140355
960 Ga0495618_0146190
961 Ga0495628_0014784
962 Ga0495628_0028036
963 Ga0495628_0030140
964 Ga0495628_0087480
965 Ga0495628_0096684
966 Ga0495628_0129856
967 Ga0495630_0191288
968 Ga0495666_0028415
969 Ga0495666_0044211
970 Ga0495652_0001447
971 Ga0495652_0005070
972 Ga0495652_0039121
973 Ga0495652_0097701
974 Ga0495652_0214058
975 Ga0495665_0004589
976 Ga0495665_0008389
977 Ga0495665_0013784
978 Ga0495640_0011728
979 Ga0495640_0051661
980 Ga0495640_0062164
981 Ga0495640_0150205
982 Ga0495640_0167129
983 Ga0495640_0169452
984 Ga0495586_0000883
985 Ga0495586_0023317
986 Ga0495586_0132390
987 Ga0495587_0027663
988 Ga0495587_0041938
989 Ga0495587_0155531
990 Ga0495587_0156339
991 Ga0495645_0016740
992 Ga0495645_0021442
993 Ga0495645_0049279
994 Ga0495645_0054687
995 Ga0495645_0056908
996 Ga0495645_0068431
997 Ga0495645_0074925
998 Ga0495645_0083364
999 Ga0495645_0129008
1000 Ga0495667_0000323
1001 Ga0495667_0027748
1002 Ga0495667_0034827
1003 Ga0495667_0035386
1004 Ga0495634_0029859
1005 Ga0495634_0127695
1006 Ga0495634_0162184
1007 Ga0495635_0001065
1008 Ga0495635_0012234
1009 Ga0495635_0015650
1010 Ga0495635_0047324
1011 Ga0495635_0054510
1012 Ga0495635_0155573
1013 Ga0495635_0198186
1014 Ga0495657_0000950
1015 Ga0495657_0038798
1016 Ga0495657_0060949
1017 Ga0495599_0007717
1018 Ga0495599_0031893
1019 Ga0495599_0041892
1020 Ga0495599_0073331
1021 Ga0495599_0104089
1022 Ga0495599_0209858
1023 Ga0495623_0015990
1024 Ga0495623_0126481
1025 Ga0495623_0149046
1026 Ga0495646_0028829
1027 Ga0495647_0007641
1028 Ga0495613_0056896
1029 Ga0495613_0077151
1030 Ga0495613_0276996
1031 Ga0495600_0002680
1032 Ga0495600_0089389
1033 Ga0495600_0114695
1034 Ga0495581_0005523
1035 Ga0495581_0013975
1036 Ga0495581_0025889
1037 Ga0495581_0283890
1038 Ga0495604_0002820
1039 Ga0495604_0035939
1040 Ga0495604_0042055
1041 Ga0495604_0121419
1042 Ga0495604_0226363
1043 Ga0495674_0002467
1044 Ga0495674_0002503
1045 Ga0495674_0019785
1046 Ga0495674_0096799
1047 Ga0495674_0206271
1048 Ga0495674_0363784
1049 Ga0495676_0293077
1050 Ga0495676_0325445
1051 Ga0495680_0003938
1052 Ga0495680_0008151
1053 Ga0495680_0015918
1054 Ga0495680_0028098
1055 Ga0495680_0071346
1056 Ga0495675_0017817
1057 Ga0495675_0047387
1058 Ga0495675_0103968
1059 Ga0495684_0015130
1060 Ga0495684_0022783
1061 Ga0495684_0046480
1062 Ga0495684_0086273
1063 Ga0495684_0273446
1064 Ga0495593_0001814
1065 Ga0495593_0012440
1066 Ga0495593_0041593
1067 Ga0495602_0036470
1068 Ga0495602_0037961
1069 Ga0495602_0040461
1070 Ga0495602_0055675
1071 Ga0495602_0086799
1072 Ga0495602_0096911
1073 Ga0495602_0157444
1074 Ga0495614_0035844
1075 Ga0495614_0049675
1076 Ga0496101_0611464
1077 Ga0496103_0229917
1078 Ga0496104_0060091
1079 Ga0496104_0348549
1080 Ga0496105_0001409
1081 Ga0496105_0302861
1082 Ga0496106_0020973
1083 Ga0496106_0047776
1084 Ga0496108_0017993
1085 Ga0496109_0029911
1086 Ga0496109_0233807
1087 Ga0496110_0160580
1088 Ga0496111_0011486
1089 Ga0496112_0003460
1090 Ga0496112_0121954
1091 Ga0496112_0282085
1092 Ga0496113_0012826
1093 Ga0496114_0340994
1094 Ga0496115_0008739
1095 Ga0496126_0049082
1096 Ga0496126_0138718
1097 Ga0501031_0007555
1098 Ga0501033_0188383
1099 Ga0501036_0042828
1100 Ga0501038_0012121
1101 Ga0501041_0031090
1102 Ga0501042_0073229
1103 Ga0501048_0010399
1104 Ga0501071_0020333
1105 Ga0501074_0001994
1106 Ga0501076_0011958
1107 Ga0501081_0025368
1108 Ga0501083_0056251
1109 Ga0501045_0003848
1110 nmdc:mga05p37_126909_c1
1111 nmdc:mga05p37_265654_c1
1112 nmdc:mga0n895_24930_c1
1113 nmdc:mga0n895_8245_c1
1114 nmdc:mga0rr50_148283_c1
1115 nmdc:mga0rr50_45586_c1
1116 nmdc:mga08x19_14128_c1
1117 nmdc:mga08x19_207002_c1
1118 nmdc:mga08x19_366219_c1
1119 nmdc:mga08x19_93034_c1
1120 nmdc:mga0a205_13285_c1
1121 Ga0495601_0000569
1122 Ga0495601_0035871
1123 Ga0495601_0066123
1124 Ga0495601_0129092
1125 Ga0495601_0167367
1126 Ga0495612_0005937
1127 Ga0495595_0001227
1128 Ga0495595_0002846
1129 Ga0495619_0003101
1130 Ga0495619_0052448
1131 Ga0495619_0066040
1132 Ga0495619_0077320
1133 Ga0500651_0156337
1134 Ga0501084_0000897
1135 Ga0501082_0082907
1136 2643902565
1137 2644264577
1138 2644404926
1139 2753268398
1140 2946048916
1141 2954697562
1142 2954704646
1143 2954716719
1144 2954726666
1145 2954735129
1146 2954745588
1147 2954754000
1148 2954764563
1149 8055069462
1150 8055180118

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04672

Methyltransf_19

S-adenosyl methyltransferase

49

312

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
2qe6-assembly1.cif.gz_A crystal structure of a putative methyltransferase (tfu_2867) from thermobifida fusca yx at 1.95 a resolution 0.9155 9 264
3go4-assembly1.cif.gz_A crystal structure of a duf574 family protein (sav_2177) from streptomyces avermitilis ma-4680 at 1.80 a resolution 0.9116 20 265
3go4-assembly1.cif.gz_A crystal structure of a duf574 family protein (sav_2177) from streptomyces avermitilis ma-4680 at 1.80 a resolution 0.8546 20 265
3p71-assembly1.cif.gz_T crystal structure of the complex of lcmt-1 and pp2a 0.7346 52 264
4pn3-assembly2.cif.gz_H crystal structure of 3-hydroxyacyl-coa-dehydrogenase from brucella melitensis 0.7345 75 153
ID Description Score Start End Superfamily
2qe6B00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8833 11 264 3.40.50.150
3go4A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8681 20 265 3.40.50.150
2qe6B00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8637 11 264 3.40.50.150
3go4A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.8388 20 265 3.40.50.150
af_P71785_5_106_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.831 79 130 3.40.50.150
ID Description Score Start End GO Terms
AF-A0A1C6PRM9-F1-model_v4 S-adenosyl methyltransferase 0.9808 7 119 GO:0008168
GO:0032259
AF-A0A385AUU2-F1-model_v4 deleted 0.9768 8 264
AF-A0A3D5DQL2-F1-model_v4 SAM-dependent methyltransferase 0.9751 6 265
AF-A0A841CT41-F1-model_v4 SAM-dependent methyltransferase 0.9718 20 265 GO:0008168
GO:0032259
AF-A0A399YVS5-F1-model_v4 SAM-dependent methyltransferase 0.9685 13 265

Map