F465337

General Info

Members Datasets Scaffolds Average Seq Length
574 428 335 324

Family's Representative Sequence

Representative Sequence 3300048906|Ga0496103_0028587|Ga0496103_0028587_50_1186
Length 378
Sequence MEIPFFMVSRGGLAKRTDVVQRGNDNAVTFQVSRSGGALRIRRSRLALRALSRNNPPMSIPTTHPFAFNPTYGMTLADLRAIVPPEAPPGFDAFWQARYERAIATDPQPVLRKSSLTHPDWQVLDITYTSTGGFEIGGWLLLPQRLPVRRGLVVGHGYGGRDVPDFDLPVEEAAIFFPCARGLSLSARPPIPADASGHVLQGIDNPNTYIIGGCVDDLWLAVSSLLTLYPWLSGHIGYSGVSFGGGIGALAIPFDPRIDRGHLVVPTFGDRELWLTLPTVGSADSVQTYQTTHGSVLGTLRMFDAASAASRIEVPMLAAVALFDPAVAPPCQFAVANALPTSKYNETFILDAGHFDYPGSTEQNAILREKVRDFFKVL

Samples

Sample ID Description Type Environment
1 2509276033 Rhizobium leguminosarum bv. trifolii WSM2012 Isolate Nodule
2 2510065019 Rhizobium leguminosarum bv. trifolii WSM1689 Isolate Nodule
3 2510461076 Rhizobium leguminosarum bv. trifolii TA1 Isolate Nodule
4 2510917022 Rhizobium sp. AP16 Isolate Rhizosphere
5 2510917028 Rhizobium sp. CF122 Isolate Rhizosphere
6 2510917030 Rhizobium sp. CF142 Isolate Rhizosphere
7 2513237084 Rhizobium leguminosarum bv. viciae UPM1131 Isolate Nodule
8 2513237085 Rhizobium leguminosarum bv. viciae UPM1137 Isolate Nodule
9 2513237093 Rhizobium leguminosarum bv. phaseoli FA23 Isolate Nodule
10 2513237103 Rhizobium leguminosarum bv. viciae VF39 Isolate Nodule
11 2513237138 Rhizobium favelukesii OR191 Isolate Nodule
12 2513237162 Rhizobium ruizarguesonis GB30 Isolate Nodule
13 2515075009 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
14 2515154113 Rhizobium ruizarguesonis Vc2 Isolate Nodule
15 2515154114 Rhizobium ruizarguesonis Vh3 Isolate Nodule
16 2515154116 Rhizobium ruizarguesonis Ps8 Isolate Nodule
17 2515154134 Rhizobium gallicum bv. gallicum R602sp Isolate Nodule
18 2516653077 Rhizobium acaciae WSM1481 Isolate Nodule
19 2516653085 Rhizobium leguminosarum bv. phaseoli 4292 Isolate Nodule
20 2517093000 Rhizobium leguminosarum bv. trifolii SRDI943 Isolate Nodule
21 2519899620 Rhizobium sp. Pop5 Isolate Nodule
22 2524023209 Rhizobium leucaenae USDA 9039 Isolate Nodule
23 2529292951 Rhizobium sp. CCGE 510 Isolate Nodule
24 2534681796 Rhizobium grahamii CCGE 502 Isolate Nodule
25 2537561587 Agrobacterium tumefaciens Cherry 2E-2-2 Isolate Rhizosphere
26 2554235003 Agrobacterium tumefaciens WRT31 Isolate Rhizosphere
27 2558860242 Agrobacterium fabacearum P4 Isolate Rhizosphere
28 2582581298 Rhizobium alamii YR540 Isolate Rhizosphere
29 2582581304 Rhizobium sp. YR519 Isolate Rhizosphere
30 2582581307 Rhizobium sp. YR060 Isolate Rhizosphere
31 2582581308 Rhizobium sp. OK494 Isolate Rhizosphere
32 2582581315 Agrobacterium rhizogenes YR147 Isolate Rhizosphere
33 2582581865 Rhizobium sp. CF258 Isolate Rhizosphere
34 2582581867 Rhizobium sp. OV201 Isolate Rhizosphere
35 2585427526 Rhizobium leguminosarum OV152 Isolate Rhizosphere
36 2585427527 Rhizobium lusitanum YR374 Isolate Rhizosphere
37 2585427528 Rhizobium leguminosarum CF307 Isolate Rhizosphere
38 2585427529 Rhizobium alamii YR584 Isolate Rhizosphere
39 2585427530 Rhizobium tropici YR635 Isolate Rhizosphere
40 2585427531 Agrobacterium rhizogenes YR530 Isolate Rhizosphere
41 2585427590 Rhizobium sp. CF048 Isolate Rhizosphere
42 2585427593 Rhizobium tropici CF286 Isolate Rhizosphere
43 2585427594 Rhizobium sp. YR528 Isolate Rhizosphere
44 2585427608 Agrobacterium rhizogenes OV677 Isolate Rhizosphere
45 2585427609 Agrobacterium rhizogenes CF263 Isolate Rhizosphere
46 2585427633 Neorhizobium galegae bv. officinalis HAMBI 1141 Isolate Nodule
47 2585427634 Neorhizobium galegae bv. orientalis HAMBI 540 Isolate Nodule
48 2585428125 Agrobacterium rhizogenes CF262 Isolate Rhizosphere
49 2599185156 Rhizobium sp. NFR03 Isolate Rhizoplane
50 2599185210 Rhizobium sp. NFACC06-2 Isolate Rhizoplane
51 2599185236 Rhizobium sp. NFR07 Isolate Rhizoplane
52 2600255279 Rhizobium sp. NFIX01 Isolate Rhizoplane
53 2600255308 Rhizobium sp. NFIX02 Isolate Rhizoplane
54 2615840626 Rhizobium lusitanum P1-7 Isolate Nodule
55 2615840698 Rhizobium multihospitium HAMBI 2975 Isolate Nodule
56 2617270742 Rhizobium miluonense HAMBI 2971 Isolate Nodule
57 2643221582 Rhizobium sp. Root651 Isolate Unclassified
58 2643221599 Rhizobium sp. Root708 Isolate Unclassified
59 2643221643 Rhizobium sp. Root1220 Isolate Unclassified
60 2643221693 Rhizobium sp. Root491 Isolate Unclassified
61 2667528174 Rhizobium sp. NFR17 Isolate Rhizoplane
62 2718217927 Rhizobium sp. N324 Isolate Nodule
63 2718218199 Rhizobium phaseoli sv. phaseoli N261 Isolate Nodule
64 2718218233 Rhizobium phaseoli sv. phaseoli R744 Isolate Nodule
65 2718218235 Rhizobium phaseoli sv. phaseoli R620 Isolate Nodule
66 2718218269 Rhizobium phaseoli sv. phaseoli N671 Isolate Nodule
67 2718218423 Rhizobium sp. N941 Isolate Nodule
68 2721755556 Rhizobium phaseoli sv. phaseoli N931 Isolate Nodule
69 2721755684 Rhizobium phaseoli sv. phaseoli N841 Isolate Nodule
70 2721755685 Rhizobium phaseoli sv. phaseoli R611 Isolate Nodule
71 2721755809 Rhizobium sp. N541 Isolate Nodule
72 2721755819 Rhizobium phaseoli sv. phaseoli N771 Isolate Nodule
73 2721755822 Rhizobium phaseoli sv. phaseoli R650 Isolate Nodule
74 2724679232 Rhizobium leguminosarum Vaf12 Isolate Unclassified
75 2728369352 Rhizobium phaseoli sv. phaseoli N831 Isolate Nodule
76 2738541293 Rhizobium sp. GV031 Isolate Unclassified
77 2738541333 Rhizobium sophoriradicis CCBAU 03470 Isolate Unclassified
78 2765235942 Rhizobium sp. WYCCWR10014 Isolate Nodule
79 2791355253 Rhizobium rhizosphaerae RD15 Isolate Rhizosphere
80 2791355256 Rhizobium sp. M10 Isolate Nodule
81 2791355260 Rhizobium sp. L9 Isolate Nodule
82 2791355261 Rhizobium sp. J15 Isolate Nodule
83 2791355262 Rhizobium sp. M1 Isolate Nodule
84 2791355263 Rhizobium chutanense C5 Isolate Nodule
85 2791355265 Rhizobium sp. H4 Isolate Nodule
86 2791355266 Rhizobium sp. L43 Isolate Nodule
87 2791355267 Rhizobium sp. L18 Isolate Nodule
88 2802429605 Rhizobium sophoriradicis L101 Isolate Nodule
89 2802429606 Rhizobium sophoriradicis JJW1 Isolate Nodule
90 2802429633 Rhizobium anhuiense J3 Isolate Nodule
91 2802429634 Rhizobium anhuiense S10 Isolate Nodule
92 2802429635 Rhizobium anhuiense Y27 Isolate Nodule
93 2802429636 Rhizobium anhuiense JX3 Isolate Nodule
94 2802429637 Rhizobium anhuiense C15 Isolate Nodule
95 2808606387 Rhizobium sp. SJZ105 Isolate Rhizosphere
96 2818991439 Agrobacterium tumefaciens 1187 Isolate Unclassified
97 2818991448 Rhizobium miluonense 1234 Isolate Unclassified
98 2818991453 Rhizobium lusitanum 1158 Isolate Unclassified
99 2818991461 Neorhizobium alkalisoli 1225 Isolate Unclassified
100 2838016132 Rhizobium phaseoli SEMIA 4071 Isolate Nodule
101 2838029111 Rhizobium tropici SEMIA 4079 Isolate Nodule
102 2838042994 Rhizobium esperanzae SEMIA 4089 Isolate Nodule
103 2838068647 Rhizobium esperanzae VC28 Isolate Nodule
104 2838668709 Rhizobium sophoriradicis SEMIA 403 Isolate Nodule
105 2838675328 Agrobacterium radiobacter SEMIA 410 Isolate Nodule
106 2838680041 Rhizobium leguminosarum SEMIA 415 Isolate Nodule
107 2838686498 Rhizobium leguminosarum SEMIA 416 Isolate Nodule
108 2838694306 Rhizobium leguminosarum SEMIA 421 Isolate Nodule
109 2838701080 Rhizobium aethiopicum SEMIA 428 Isolate Nodule
110 2838707686 Rhizobium leguminosarum SEMIA 430 Isolate Nodule
111 2838714209 Agrobacterium radiobacter SEMIA 435 Isolate Nodule
112 2838719591 Agrobacterium radiobacter SEMIA 436 Isolate Nodule
113 2838724970 Agrobacterium radiobacter SEMIA 437 Isolate Nodule
114 2838729681 Rhizobium leguminosarum SEMIA 445 Isolate Nodule
115 2838742623 Rhizobium leguminosarum SEMIA 449 Isolate Nodule
116 2841846520 Agrobacterium radiobacter SEMIA 440 Isolate Nodule
117 2841851746 Rhizobium leguminosarum SEMIA 498 Isolate Nodule
118 2841859092 Agrobacterium radiobacter SEMIA 4026 Isolate Nodule
119 2841864319 Rhizobium leguminosarum SEMIA 4052 Isolate Nodule
120 2842077413 Rhizobium leguminosarum SEMIA 422 Isolate Nodule
121 2842110456 Rhizobium esperanzae SEMIA 414 Isolate Nodule
122 2842118031 Rhizobium esperanzae SEMIA 420 Isolate Nodule
123 2842124991 Agrobacterium radiobacter SEMIA 434 Isolate Nodule
124 2842130223 Agrobacterium radiobacter SEMIA 441 Isolate Nodule
125 2842146304 Rhizobium sophoriradicis SEMIA 454 Isolate Nodule
126 2842152218 Agrobacterium radiobacter SEMIA 457 Isolate Nodule
127 2842156927 Rhizobium leguminosarum SEMIA 459 Isolate Nodule
128 2842163707 Rhizobium leguminosarum SEMIA 460 Isolate Nodule
129 2842170452 Agrobacterium radiobacter SEMIA 461 Isolate Nodule
130 2842175837 Agrobacterium radiobacter SEMIA 462 Isolate Nodule
131 2842180545 Rhizobium leguminosarum SEMIA 463 Isolate Nodule
132 2842187318 Agrobacterium radiobacter SEMIA 464 Isolate Nodule
133 2842198810 Rhizobium aethiopicum SEMIA 470 Isolate Nodule
134 2842205361 Rhizobium etli SEMIA 471 Isolate Nodule
135 2842211629 Agrobacterium radiobacter SEMIA 472 Isolate Nodule
136 2842217011 Rhizobium leguminosarum SEMIA 475 Isolate Nodule
137 2842224351 Agrobacterium radiobacter SEMIA 480 Isolate Nodule
138 2842229732 Rhizobium leguminosarum SEMIA 481 Isolate Nodule
139 2842237096 Rhizobium leguminosarum SEMIA 482 Isolate Nodule
140 2842243621 Rhizobium leguminosarum SEMIA 483 Isolate Nodule
141 2842250916 Rhizobium etli SEMIA 484 Isolate Nodule
142 2842257432 Rhizobium leguminosarum SEMIA 485 Isolate Nodule
143 2842264693 Rhizobium phaseoli SEMIA 487 Isolate Nodule
144 2842271015 Rhizobium leguminosarum SEMIA 488 Isolate Nodule
145 2842278818 Rhizobium etli SEMIA 489 Isolate Nodule
146 2842291075 Rhizobium leguminosarum SEMIA 491 Isolate Nodule
147 2842298080 Rhizobium leucaenae SEMIA 492 Isolate Nodule
148 2842304105 Rhizobium leguminosarum SEMIA 499 Isolate Nodule
149 2842357229 Rhizobium leucaenae SEMIA 4015 Isolate Nodule
150 2842363717 Rhizobium leguminosarum SEMIA 4016 Isolate Nodule
151 2842370503 Rhizobium leguminosarum SEMIA 4022 Isolate Nodule
152 2842377471 Rhizobium leguminosarum SEMIA 4024 Isolate Nodule
153 2842384541 Rhizobium leguminosarum SEMIA 4025 Isolate Nodule
154 2842395702 Rhizobium ecuadorense SEMIA 4029 Isolate Nodule
155 2842422224 Rhizobium esperanzae SEMIA 4042 Isolate Nodule
156 2842428310 Rhizobium phaseoli SEMIA 4050 Isolate Nodule
157 2842434925 Rhizobium esperanzae SEMIA 4051 Isolate Nodule
158 2842441272 Rhizobium esperanzae SEMIA 4053 Isolate Nodule
159 2842462802 Rhizobium phaseoli SEMIA 4057 Isolate Nodule
160 2842469257 Rhizobium phaseoli SEMIA 4058 Isolate Nodule
161 2842475841 Rhizobium tropici SEMIA 4059 Isolate Nodule
162 2842489311 Rhizobium sophoriradicis SEMIA 4061 Isolate Nodule
163 2842495871 Rhizobium etli SEMIA 4062 Isolate Nodule
164 2842502639 Rhizobium tropici SEMIA 4063 Isolate Nodule
165 2842509118 Rhizobium paranaense SEMIA 4064 Isolate Nodule
166 2842515876 Agrobacterium radiobacter SEMIA 4072 Isolate Nodule
167 2842922631 Pararhizobium sp. R-72066 Isolate Unclassified
168 2844454524 Rhizobium leguminosarum bv. viciae BIHB 1217 Isolate Nodule
169 2852387548 Rhizobium jaguaris CCGE525 Isolate Unclassified
170 2854896431 Neorhizobium alkalisoli DSM 21826 Isolate Unclassified
171 2854916844 Neorhizobium huautlense DSM 21817 Isolate Unclassified
172 2857516855 Rhizobium sp. R-72456 Isolate Unclassified
173 2899792073 Agrobacterium deltaense CNPSo 3391 Isolate Nodule
174 2899803654 Agrobacterium sp. a22-2 Isolate Unclassified
175 2899845264 Agrobacterium fabacearum CNPSo 675 Isolate Unclassified
176 2919100787 Rhizobium sp. 1399 Isolate Rhizosphere
177 2919114240 Agrobacterium tumefaciens 1457 Isolate Rhizosphere
178 2919171160 Neorhizobium sp. 2083 Isolate Unclassified
179 2919408235 Rhizobium miluonense 3199 Isolate Unclassified
180 2923556063 Rhizobium tibeticum 3740 Isolate Unclassified
181 2926754445 Agrobacterium radiobacter SLBN-94 Isolate Rhizosphere
182 2926760298 Agrobacterium tumefaciens SLBN-170 Isolate Rhizosphere
183 2933006813 Rhizobium sp. SEMIA 439 Isolate Unclassified
184 2933011516 Rhizobium sp. SEMIA 4032 Isolate Unclassified
185 2933570622 Rhizobium leguminosarum SEMIA 409 Isolate Nodule
186 2933586486 Rhizobium leguminosarum SEMIA 4039 Isolate Nodule
187 2933594066 Agrobacterium fabrum 35/80 Isolate Nodule
188 2933599457 Rhizobium phaseoli M3 Isolate Nodule
189 2935894831 Rhizobium leguminosarum SEMIA 419 Isolate Nodule
190 2935901341 Rhizobium leguminosarum SEMIA 4082 Isolate Nodule
191 2936367885 Rhizobium changzhiense WYCCWR 11290 Isolate Nodule
192 2936375103 Rhizobium changzhiense WYCCWR 11317 Isolate Nodule
193 2936381700 Rhizobium chutanense C16 Isolate Unclassified
194 2979089926 Agrobacterium sp. SORGH_AS 745 Isolate Unclassified
195 2979095461 Agrobacterium tumefaciens SORGH_AS 749 Isolate Unclassified
196 2979100975 Agrobacterium pusense SORGH_AS 755 Isolate Unclassified
197 2984509177 Agrobacterium pusense SORGH_AS260 Isolate Aerial Root
198 2984518228 Agrobacterium pusense SORGH_AS285 Isolate Aerial Root
199 2984537506 Agrobacterium sp. SORGH_AS440 Isolate Aerial Root
200 2984601300 Rhizobium pusense SORGH_AS1083 Isolate Aerial Root
201 3005409236 Rhizobium sp. P32RR-XVIII Isolate Rhizosphere
202 3005416602 Rhizobium sp. P40RR-XXII Isolate Rhizosphere
203 3005445848 Rhizobium sp. WYJ-E13 Isolate Unclassified
204 3005452660 Rhizobium grahamii BG7 Isolate Unclassified
205 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
206 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
207 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
208 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
209 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
210 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
211 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
212 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
213 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
214 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
215 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
216 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
217 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
218 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
219 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
220 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
221 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
222 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
223 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
224 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
225 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
226 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
227 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
228 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
229 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
230 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
231 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
232 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
233 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
234 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
235 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
236 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
237 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
238 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
239 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
240 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
241 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
242 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
243 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
244 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
245 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
246 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
247 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
248 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
249 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
250 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
251 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
252 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
253 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
254 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
255 3300009766 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule Metagenome Nodule
256 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
257 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
258 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
259 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
260 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
261 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
262 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
263 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
264 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
265 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
266 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
267 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
268 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
269 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
270 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
271 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
272 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
273 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
274 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
275 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
276 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
277 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
278 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
279 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
280 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
281 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
282 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
283 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
284 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
285 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
286 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
287 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
288 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
289 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
290 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
291 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
292 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
293 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
294 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
295 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
296 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
297 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
298 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
299 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
300 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
301 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
302 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
303 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
304 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
305 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
306 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
307 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
308 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
309 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
310 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
311 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
312 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
313 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
314 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
315 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
316 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
317 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
318 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
319 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
320 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
321 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
322 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
323 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
324 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
325 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
326 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
327 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
328 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
329 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
330 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
331 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
332 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
333 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
334 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
335 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
336 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
337 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
338 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
339 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
340 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
341 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
342 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
343 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
344 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
345 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
346 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
347 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
348 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
349 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
350 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
351 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
352 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
353 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
354 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
355 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
356 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
357 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
358 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
359 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
360 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
361 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
362 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
363 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
364 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
365 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
366 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
367 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
368 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
369 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
370 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
371 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
372 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
373 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
374 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
375 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
376 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
377 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
378 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
379 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
380 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
381 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
382 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
383 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
384 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
385 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
386 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
387 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
388 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
389 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
390 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
391 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
392 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
393 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
394 639633055 Rhizobium leguminosarum bv. viciae 3841 Isolate Unclassified
395 650716007 Agrobacterium fabacearum H13-3 Isolate Rhizosphere
396 8003570095 Agrobacterium rhizogenes GBBC3284 Isolate Unclassified
397 8005275841 Rhizobium sp. N4311 Isolate Nodule
398 8005282627 Rhizobium phaseoli NC1 Isolate Nodule
399 8005289223 Rhizobium bangladeshense 1002 Isolate Nodule
400 8005301065 Rhizobium bangladeshense 1017 Isolate Nodule
401 8005307578 Rhizobium leguminosarum bv. phaseoli LCS0306 Isolate Unclassified
402 8005314921 Rhizobium sp. P28RR-XV Isolate Rhizosphere
403 8005376324 Rhizobium changzhiense WYCCWR 11279 Isolate Nodule
404 8005395548 Rhizobium sp. R339 Isolate Nodule
405 8005460587 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
406 8005484373 Rhizobium tropici SARCC-755 Isolate Nodule
407 8005497431 Rhizobium phaseoli CCGM8 Isolate Unclassified
408 8005542996 Rhizobium grahamii CCGM3 Isolate Unclassified
409 8005556819 Rhizobium sp. WYCCWR 11128 Isolate Nodule
410 8005563573 Rhizobium sp. WYCCWR 11152 Isolate Nodule
411 8005570704 Rhizobium anhuiense bv. trifolii WYCCWR10015 Isolate Nodule
412 8005619151 Rhizobium phaseoli CCGM2 Isolate Unclassified
413 8005626139 Rhizobium phaseoli Y18 Isolate Nodule
414 8005645114 Rhizobium tropici IGFRI Rhizo-19 Isolate Rhizosphere
415 8005668836 Rhizobium phaseoli CCGM9 Isolate Unclassified
416 8005682033 Rhizobium dioscoreae S-93 Isolate Unclassified
417 8005695170 Rhizobium sp. RMa-01 Isolate Unclassified
418 8018150411 Rhizobium straminoryzae SM12 Isolate Rhizosphere
419 8018163183 Rhizobium sp. WYCCWR 11146 Isolate Nodule
420 8018176218 Rhizobium sp. N122 Isolate Nodule
421 8023680758 Rhizobium leguminosarum SARCC-132 Isolate Nodule
422 8024479707 Rhizobium leguminosarum Tri-43 Isolate Nodule
423 8024501048 Rhizobium sp. H4 Isolate Nodule
424 8046767195 Rhizobium calliandrae CCGE524 Isolate Unclassified
425 8056375014 Rhizobium redzepovicii 18T Isolate Nodule
426 8056382006 Rhizobium croatiense 13T Isolate Nodule
427 8057575449 Rhizobium mayense CCGE526 Isolate Nodule
428 8057874678 Rhizobium acaciae 1AS12 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 58.36
Metatranscriptomes 0
Isolates 41.64

Biome Distribution

Category Percentage (%)
Aerial Root 0.7
Bulb 0
Endosphere 21.78
Nodule 27.35
Rhizoplane 3.66
Rhizosphere 26.31
Stem 0
Stem Tuber 0
Unclassified 20.21

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10009986 3300001979 Bacteria 3680
2 JGI25155J39150_1000015 3300002704 Bacteria 178839
3 JGI25156J39149_1000007 3300002705 Bacteria 252108
4 JGI25162J39368_1000119 3300002737 Bacteria 87157
5 JGI25154J39366_1000145 3300002738 Bacteria 55861
6 JGI25157J39369_1000012 3300002741 Bacteria 205167
7 JGI25150J39212_1000063 3300002774 Bacteria 64558
8 JGI25159J45721_1000158 3300002987 Bacteria 31947
9 JGI25159J45721_1009456 3300002987 Bacteria 2570
10 JGI25151J46595_10000140 3300003187 Bacteria 95958
11 JGI25151J46595_10004395 3300003187 Bacteria 7469
12 JGI25151J46595_10012076 3300003187 Bacteria 3938
13 JGI25165J46597_1000211 3300003214 Bacteria 82463
14 JGI25153J46596_10003536 3300003215 Bacteria 8719
15 JGI25153J46596_10011329 3300003215 Bacteria 3949
16 JGI25153J46596_10012584 3300003215 Bacteria 3638
17 JGI25153J46596_10024270 3300003215 Bacteria 2189
18 rootH1_10007048 3300003316 Bacteria 5687
19 rootH1_10109868 3300003316 Bacteria 1409
20 rootH2_10047955 3300003320 Bacteria 10860
21 rootL2_10004132 3300003322 Bacteria 41354
22 rootH1_10206213 3300003323 Bacteria 4297
23 JGI25160J50197_1000026 3300003354 Bacteria 184693
24 JGI25160J50197_1001632 3300003354 Bacteria 11005
25 JGI25161J50226_1000014 3300003374 Bacteria 191109
26 JGI25161J50226_1000190 3300003374 Bacteria 39988
27 Ga0055526_1002283 3300003771 Bacteria 13096
28 Ga0055526_1002411 3300003771 Bacteria 12660
29 Ga0055524_1001464 3300003775 Bacteria 13480
30 Ga0055524_1003315 3300003775 Bacteria 7865
31 Ga0055524_1007853 3300003775 Bacteria 4489
32 Ga0055536_1000808 3300003781 Bacteria 20707
33 Ga0055528_1001675 3300003790 Bacteria 12949
34 Ga0055528_1002267 3300003790 Bacteria 10429
35 Ga0055528_1009275 3300003790 Bacteria 4126
36 Ga0055528_1021085 3300003790 Bacteria 2083
37 Ga0055540_1000988 3300003792 Bacteria 18354
38 Ga0055540_1002505 3300003792 Bacteria 9603
39 Ga0055531_10010550 3300003794 Bacteria 4574
40 Ga0055543_1000079 3300004625 Bacteria 84916
41 Ga0055543_1000115 3300004625 Bacteria 68252
42 Ga0055543_1000329 3300004625 Bacteria 32613
43 Ga0065165_1000073 3300005262 Bacteria 164910
44 Ga0065165_1002408 3300005262 Bacteria 15963
45 Ga0065165_1012719 3300005262 Bacteria 3403
46 Ga0065165_1017630 3300005262 Bacteria 2621
47 Ga0070670_100002696 3300005331 Bacteria 14664
48 Ga0070666_10136490 3300005335 Bacteria 1707
49 Ga0070671_100004488 3300005355 Bacteria 11047
50 Ga0068853_100149950 3300005539 Bacteria 2098
51 Ga0070665_100014665 3300005548 Bacteria 7865
52 Ga0070665_100020401 3300005548 Bacteria 6657
53 Ga0070665_100105578 3300005548 Bacteria 2819
54 Ga0068855_100033786 3300005563 Bacteria 6102
55 Ga0068856_100056248 3300005614 Bacteria 3882
56 Ga0075365_10000600 3300006038 Bacteria 14128
57 Ga0075365_10066655 3300006038 Bacteria 2416
58 Ga0075365_10100425 3300006038 Bacteria 1981
59 Ga0075368_10001513 3300006042 Bacteria 7446
60 Ga0075363_100047842 3300006048 Bacteria 2273
61 Ga0075364_10003970 3300006051 Bacteria 8496
62 Ga0075362_10029412 3300006177 Bacteria 2367
63 Ga0075362_10043103 3300006177 Bacteria 1997
64 Ga0075367_10008024 3300006178 Bacteria 5444
65 Ga0075367_10122779 3300006178 Bacteria 1601
66 Ga0075369_10003349 3300006186 Bacteria 5825
67 Ga0075369_10025166 3300006186 Bacteria 2472
68 Ga0075370_10008391 3300006353 Bacteria 5316
69 Ga0075370_10011474 3300006353 Bacteria 4658
70 Ga0099826_10000149 3300006948 Bacteria 29916
71 Ga0099826_10004007 3300006948 Bacteria 10209
72 Ga0105251_10002518 3300009011 Bacteria 14301
73 Ga0105250_10081071 3300009092 Bacteria 1315
74 Ga0105240_10000217 3300009093 Bacteria 115649
75 Ga0105240_10038252 3300009093 Bacteria 6155
76 Ga0105240_10542679 3300009093 Bacteria 1287
77 Ga0105245_10242231 3300009098 Bacteria 1748
78 Ga0105243_10025899 3300009148 Bacteria 4486
79 Ga0105243_10167033 3300009148 Bacteria 1902
80 Ga0105241_10005766 3300009174 Bacteria 9142
81 Ga0105248_10050115 3300009177 Bacteria 4683
82 Ga0105237_10001458 3300009545 Bacteria 31192
83 Ga0105237_10025230 3300009545 Bacteria 6080
84 Ga0105249_10174029 3300009553 Bacteria 2089
85 Ga0123342_1018576 3300009766 Bacteria 5498
86 Ga0105239_10001164 3300010375 Bacteria 36154
87 Ga0105246_10036031 3300011119 Bacteria 3312
88 Ga0157373_10007095 3300013100 Bacteria 8354
89 Ga0157371_10000004 3300013102 Bacteria 512593
90 Ga0157370_10000768 3300013104 Bacteria 40191
91 Ga0157370_10008228 3300013104 Bacteria 11263
92 Ga0157374_10034180 3300013296 Bacteria 4641
93 Ga0157378_10094579 3300013297 Bacteria 2721
94 Ga0209435_100006 3300025206 Bacteria 542459
95 Ga0209436_100060 3300025208 Bacteria 60450
96 Ga0209437_100042 3300025233 Bacteria 444095
97 Ga0209437_100062 3300025233 Bacteria 336900
98 Ga0209437_105361 3300025233 Bacteria 2187
99 Ga0207425_1000080 3300025245 Bacteria 100578
100 Ga0207425_1002206 3300025245 Bacteria 7076
101 Ga0209646_1000015 3300025246 Bacteria 542459
102 Ga0209026_1000046 3300025250 Bacteria 262031
103 Ga0209677_100295 3300025253 Bacteria 32620
104 Ga0209759_1000005 3300025256 Bacteria 542459
105 Ga0209129_1000195 3300025258 Bacteria 80791
106 Ga0209129_1001740 3300025258 Bacteria 11696
107 Ga0209129_1002157 3300025258 Bacteria 9956
108 Ga0209129_1011866 3300025258 Bacteria 2047
109 Ga0209233_1000082 3300025261 Bacteria 336320
110 Ga0209233_1000103 3300025261 Bacteria 284123
111 Ga0209233_1000288 3300025261 Bacteria 66882
112 Ga0209673_1000325 3300025273 Bacteria 87535
113 Ga0209673_1006836 3300025273 Bacteria 5408
114 Ga0209673_1012570 3300025273 Bacteria 3402
115 Ga0209673_1015006 3300025273 Bacteria 2968
116 Ga0209130_1000015 3300025284 Bacteria 409631
117 Ga0209130_1000219 3300025284 Bacteria 74906
118 Ga0209676_1037104 3300025292 Bacteria 1410
119 Ga0209025_1000060 3300025294 Bacteria 305017
120 Ga0209025_1000332 3300025294 Bacteria 104326
121 Ga0209025_1000483 3300025294 Bacteria 77146
122 Ga0209564_1000703 3300025295 Bacteria 48991
123 Ga0209564_1000984 3300025295 Bacteria 35737
124 Ga0209564_1009055 3300025295 Bacteria 4796
125 Ga0209758_1000148 3300025297 Bacteria 166232
126 Ga0209758_1000263 3300025297 Bacteria 104297
127 Ga0209758_1000544 3300025297 Bacteria 59862
128 Ga0209758_1000576 3300025297 Bacteria 57318
129 Ga0209758_1001861 3300025297 Bacteria 23130
130 Ga0209758_1012600 3300025297 Bacteria 4712
131 Ga0209758_1012869 3300025297 Bacteria 4633
132 Ga0209050_1004762 3300025298 Bacteria 8958
133 Ga0209256_1000245 3300025299 Bacteria 96643
134 Ga0209256_1005344 3300025299 Bacteria 7449
135 Ga0209256_1005801 3300025299 Bacteria 6887
136 Ga0207426_1000039 3300025302 Bacteria 439937
137 Ga0207426_1000075 3300025302 Bacteria 321337
138 Ga0207426_1000122 3300025302 Bacteria 218307
139 Ga0207426_1007526 3300025302 Bacteria 4544
140 Ga0209051_1002064 3300025303 Bacteria 15232
141 Ga0209051_1002404 3300025303 Bacteria 13465
142 Ga0209051_1003118 3300025303 Bacteria 11174
143 Ga0209051_1011202 3300025303 Bacteria 4451
144 Ga0209257_1001330 3300025304 Bacteria 30051
145 Ga0207647_10004941 3300025904 Bacteria 9828
146 Ga0207654_10013521 3300025911 Bacteria 4200
147 Ga0207695_10000613 3300025913 Bacteria 71568
148 Ga0207695_10003120 3300025913 Bacteria 23704
149 Ga0207671_10000337 3300025914 Bacteria 69135
150 Ga0207671_10001160 3300025914 Bacteria 31428
151 Ga0207694_10003347 3300025924 Bacteria 12757
152 Ga0207650_10001919 3300025925 Bacteria 14650
153 Ga0207667_10036580 3300025949 Bacteria 5260
154 Ga0207667_10127742 3300025949 Bacteria 2619
155 Ga0207640_10051174 3300025981 Bacteria 2684
156 Ga0207639_10105431 3300026041 Bacteria 2287
157 Ga0207702_10120552 3300026078 Bacteria 2347
158 Ga0209371_1000009 3300027312 Bacteria 963030
159 Ga0209282_1000380 3300027666 Bacteria 21686
160 Ga0268266_10000769 3300028379 Bacteria 42897
161 Ga0268266_10090385 3300028379 Bacteria 2684
162 Ga0268266_10123595 3300028379 Bacteria 2306
163 Ga0307515_10017559 3300028794 Bacteria 13018
164 Ga0268256_1000010 3300030500 Bacteria 963034
165 Ga0307406_10002153 3300031901 Bacteria 10724
166 Ga0307412_10055646 3300031911 Bacteria 2632
167 Ga0373927_0000075 3300035695 Bacteria 72822
168 Ga0373925_0001050 3300037068 Bacteria 25040
169 Ga0395905_0005571 3300037471 Bacteria 12830
170 Ga0395905_0006484 3300037471 Bacteria 11776
171 Ga0439465_0008800 3300041413 Bacteria 3180
172 Ga0439465_0057006 3300041413 Bacteria 1288
173 Ga0451787_546452 3300041441 Bacteria 1801
174 Ga0451833_0157354 3300041491 Bacteria 6832
175 Ga0451835_1169534 3300041492 Bacteria 2910
176 Ga0451841_0262451 3300041498 Bacteria 2641
177 Ga0451847_0231158 3300041503 Bacteria 6403
178 Ga0451851_0529450 3300041507 Bacteria 1117
179 Ga0451843_1326941 3300041509 Bacteria 1313
180 Ga0451855_0293665 3300041511 Bacteria 4523
181 Ga0451853_0935403 3300041512 Bacteria 1813
182 Ga0439431_0053902 3300041997 Bacteria 1048
183 Ga0439449_0055274 3300042007 Bacteria 1466
184 Ga0439462_0009613 3300042015 Bacteria 2445
185 Ga0466969_0049345 3300044656 Bacteria 2077
186 Ga0466966_0030391 3300044684 Bacteria 3508
187 Ga0453684_0268925 3300044712 Bacteria 1949
188 Ga0466970_0019183 3300044765 Bacteria 3544
189 Ga0466957_0032037 3300044842 Bacteria 3146
190 Ga0466959_0121669 3300045049 Bacteria 1855
191 Ga0451576_0144735 3300045051 Bacteria 2478
192 Ga0495592_0308646 3300046454 Bacteria 1026
193 Ga0495638_0000395 3300046460 Bacteria 53823
194 Ga0495651_0001124 3300046462 Bacteria 20699
195 Ga0495605_0000650 3300046474 Bacteria 26529
196 Ga0495605_0040098 3300046474 Bacteria 2342
197 Ga0495585_0034695 3300046492 Bacteria 2852
198 Ga0495585_0104430 3300046492 Bacteria 1512
199 Ga0495607_0005399 3300046501 Bacteria 9155
200 Ga0495583_0014653 3300046506 Bacteria 4313
201 Ga0495583_0050882 3300046506 Bacteria 1891
202 Ga0495606_0009313 3300046507 Bacteria 8326
203 Ga0495610_0001811 3300046512 Bacteria 18572
204 Ga0495610_0007979 3300046512 Bacteria 6943
205 Ga0495616_0012217 3300046513 Bacteria 4884
206 Ga0495620_0048264 3300046515 Bacteria 1828
207 Ga0495628_0047721 3300046516 Bacteria 3396
208 Ga0495631_0000362 3300046518 Bacteria 31319
209 Ga0495632_0001545 3300046519 Bacteria 19004
210 Ga0495632_0021710 3300046519 Bacteria 3455
211 Ga0495632_0029053 3300046519 Bacteria 2882
212 Ga0495643_0011170 3300046522 Bacteria 5487
213 Ga0495643_0022049 3300046522 Bacteria 3641
214 Ga0495643_0135954 3300046522 Bacteria 1230
215 Ga0495648_0106078 3300046524 Bacteria 1539
216 Ga0495652_0236738 3300046529 Bacteria 1362
217 Ga0495654_0066170 3300046530 Bacteria 1724
218 Ga0495597_0004692 3300046542 Bacteria 7415
219 Ga0495625_0002545 3300046660 Bacteria 19606
220 Ga0495625_0015606 3300046660 Bacteria 6009
221 Ga0495625_0029081 3300046660 Bacteria 4137
222 Ga0495661_0173260 3300046665 Bacteria 1149
223 Ga0495588_0008452 3300046674 Bacteria 4727
224 Ga0495670_0156286 3300046691 Bacteria 1197
225 Ga0495671_0018597 3300046692 Bacteria 3686
226 Ga0495649_0037596 3300046694 Bacteria 2657
227 Ga0495600_0044672 3300046809 Bacteria 2890
228 Ga0495687_068892 3300047443 Bacteria 1427
229 Ga0495681_0014933 3300047470 Bacteria 4425
230 Ga0495686_0001486 3300047472 Bacteria 25489
231 Ga0495686_0023701 3300047472 Bacteria 4043
232 Ga0495686_0044790 3300047472 Bacteria 2800
233 Ga0495686_0089109 3300047472 Bacteria 1875
234 Ga0495686_0125624 3300047472 Bacteria 1525
235 Ga0495686_0180602 3300047472 Bacteria 1223
236 Ga0496100_0001458 3300048903 Bacteria 11600
237 Ga0496101_0019168 3300048904 Bacteria 4666
238 Ga0496102_0003597 3300048905 Bacteria 13128
239 Ga0496102_0041612 3300048905 Bacteria 4161
240 Ga0496103_0002492 3300048906 Bacteria 11548
241 Ga0496103_0028587 3300048906 Bacteria 3384
242 Ga0496104_0195734 3300048907 Bacteria 1933
243 Ga0496104_0201009 3300048907 Bacteria 1905
244 Ga0496106_0002048 3300048909 Bacteria 15151
245 Ga0496106_0195420 3300048909 Bacteria 1609
246 Ga0496109_0447616 3300048912 Bacteria 1220
247 Ga0496110_0097120 3300048913 Bacteria 2640
248 Ga0496111_0000974 3300048914 Bacteria 15651
249 Ga0496111_0040832 3300048914 Bacteria 3328
250 Ga0496116_0002495 3300048919 Bacteria 19279
251 Ga0496116_0004853 3300048919 Bacteria 12683
252 Ga0496116_0022249 3300048919 Bacteria 4756
253 Ga0496116_0042301 3300048919 Bacteria 3116
254 Ga0496116_0194924 3300048919 Bacteria 1067
255 Ga0496117_0000002 3300048920 Bacteria 2483758
256 Ga0496117_0004786 3300048920 Bacteria 14671
257 Ga0496117_0029675 3300048920 Bacteria 4212
258 Ga0496117_0122124 3300048920 Bacteria 1598
259 Ga0496118_0004084 3300048921 Bacteria 17702
260 Ga0496118_0004764 3300048921 Bacteria 15870
261 Ga0496118_0005381 3300048921 Bacteria 14579
262 Ga0496118_0050862 3300048921 Bacteria 3175
263 Ga0496118_0064841 3300048921 Bacteria 2677
264 Ga0496118_0254420 3300048921 Bacteria 996
265 Ga0496119_0004967 3300048922 Bacteria 12997
266 Ga0496119_0016900 3300048922 Bacteria 5521
267 Ga0496119_0024786 3300048922 Bacteria 4209
268 Ga0496119_0045458 3300048922 Bacteria 2752
269 Ga0496120_0000034 3300048923 Bacteria 215228
270 Ga0496120_0004041 3300048923 Bacteria 12700
271 Ga0496120_0095268 3300048923 Bacteria 1583
272 Ga0496121_0006476 3300048924 Bacteria 14512
273 Ga0496121_0008946 3300048924 Bacteria 11621
274 Ga0496121_0012128 3300048924 Bacteria 9461
275 Ga0496121_0022517 3300048924 Bacteria 6110
276 Ga0496121_0143695 3300048924 Bacteria 1766
277 Ga0496122_0000001 3300048925 Bacteria 1827766
278 Ga0496122_0000107 3300048925 Bacteria 193163
279 Ga0496122_0006549 3300048925 Bacteria 13317
280 Ga0496122_0017559 3300048925 Bacteria 6680
281 Ga0496122_0036132 3300048925 Bacteria 4003
282 Ga0496122_0071820 3300048925 Bacteria 2464
283 Ga0496123_0000001 3300048926 Bacteria 1831497
284 Ga0496123_0000063 3300048926 Bacteria 216072
285 Ga0496123_0004822 3300048926 Bacteria 13919
286 Ga0496123_0007564 3300048926 Bacteria 10184
287 Ga0496123_0052465 3300048926 Bacteria 2706
288 Ga0496124_0005510 3300048927 Bacteria 14211
289 Ga0496124_0009023 3300048927 Bacteria 10317
290 Ga0496124_0013288 3300048927 Bacteria 8045
291 Ga0496124_0054242 3300048927 Bacteria 3394
292 Ga0496124_0054340 3300048927 Bacteria 3390
293 Ga0496124_0060158 3300048927 Bacteria 3188
294 Ga0496124_0064873 3300048927 Bacteria 3047
295 Ga0496125_0007481 3300048928 Bacteria 11618
296 Ga0496125_0016911 3300048928 Bacteria 6980
297 Ga0496125_0038705 3300048928 Bacteria 4120
298 Ga0496125_0062158 3300048928 Bacteria 2989
299 Ga0496125_0064277 3300048928 Bacteria 2917
300 Ga0496125_0103954 3300048928 Bacteria 2082
301 Ga0496126_0050423 3300048929 Bacteria 3793
302 Ga0496126_0059488 3300048929 Bacteria 3440
303 Ga0496126_0125338 3300048929 Bacteria 2224
304 Ga0496126_0154275 3300048929 Bacteria 1966
305 Ga0495678_060663 3300049459 Bacteria 1422
306 Ga0501036_0302081 3300049572 Bacteria 1339
307 Ga0501241_011489 3300049758 Bacteria 1607
308 nmdc:mga03683_8336_c1 3300050489 Bacteria 3639
309 nmdc:mga00v17_270_c1 3300050491 Bacteria 30629
310 nmdc:mga00v17_7480_c1 3300050491 Bacteria 5831
311 nmdc:mga0yw44_54021_c1 3300050492 Bacteria 2440
312 nmdc:mga0yw44_5875_c1 3300050492 Bacteria 5863
313 nmdc:mga0k408_31039_c1 3300050493 Bacteria 3049
314 nmdc:mga07m45_2189_c1 3300050496 Bacteria 9119
315 nmdc:mga07m45_52431_c1 3300050496 Bacteria 2303
316 nmdc:mga0sz30_208_c1 3300050516 Bacteria 22004
317 nmdc:mga0sz30_31874_c1 3300050516 Bacteria 2183
318 Ga0500560_005056 3300053107 Bacteria 2876
319 Ga0500569_051921 3300053109 Bacteria 1239
320 Ga0500594_0011957 3300053118 Bacteria 2035
321 Ga0500618_005686 3300053125 Bacteria 3760
322 Ga0500618_007276 3300053125 Bacteria 3175
323 Ga0500658_0000642 3300053134 Bacteria 14510
324 Ga0500658_0004206 3300053134 Bacteria 5403
325 Ga0500559_0016896 3300053136 Bacteria 3082
326 Ga0500561_0000741 3300053137 Bacteria 5174
327 Ga0500568_0000845 3300053139 Bacteria 21549
328 Ga0500568_0001485 3300053139 Bacteria 14998
329 Ga0500568_0054925 3300053139 Bacteria 1556
330 Ga0500616_0000709 3300053153 Bacteria 38615
331 Ga0500616_0001350 3300053153 Bacteria 23981
332 Ga0500616_0003848 3300053153 Bacteria 11090
333 Ga0500622_0000618 3300053156 Bacteria 32174
334 Ga0500627_0050498 3300053158 Bacteria 1812
335 Ga0500633_0000532 3300053160 Bacteria 6153

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005548 Ga0070665_100105578 Ga0070665_1001055783 301
2 3300028379 Ga0268266_10123595 Ga0268266_101235953 301
3 3300037471 Ga0395905_0006484 Ga0395905_0006484_6394_7308 302
4 3300035695 Ga0373927_0000075 Ga0373927_0000075_21840_22751 303
5 3300037068 Ga0373925_0001050 Ga0373925_0001050_8948_9859 303
6 3300041509 Ga0451843_1326941 Ga0451843_1326941_43_954 303
7 3300046460 Ga0495638_0000395 Ga0495638_0000395_31634_32545 303
8 3300047443 Ga0495687_068892 Ga0495687_068892_47_958 303
9 3300047472 Ga0495686_0180602 Ga0495686_0180602_31_942 303
10 3300048921 Ga0496118_0254420 Ga0496118_0254420_40_951 303
11 3300050492 nmdc:mga0yw44_54021_c1 nmdc:mga0yw44_54021_c1_225_1154 303
12 3300053139 Ga0500568_0000845 Ga0500568_0000845_4349_5260 303
13 3300053153 Ga0500616_0001350 Ga0500616_0001350_20498_21409 303
14 3300046512 Ga0495610_0001811 Ga0495610_0001811_1886_2875 308
15 3300046515 Ga0495620_0048264 Ga0495620_0048264_256_1245 308
16 3300046522 Ga0495643_0135954 Ga0495643_0135954_136_1125 308
17 3300047472 Ga0495686_0044790 Ga0495686_0044790_1711_2700 308
18 3300002704 JGI25155J39150_1000015 JGI25155J39150_100001527 309
19 3300002705 JGI25156J39149_1000007 JGI25156J39149_100000727 309
20 3300002738 JGI25154J39366_1000145 JGI25154J39366_100014527 309
21 3300002741 JGI25157J39369_1000012 JGI25157J39369_1000012174 309
22 3300003316 rootH1_10007048 rootH1_100070483 309
23 3300003320 rootH2_10047955 rootH2_100479556 309
24 3300003322 rootL2_10004132 rootL2_100041324 309
25 3300025206 Ga0209435_100006 Ga0209435_100006499 309
26 3300025246 Ga0209646_1000015 Ga0209646_100001535 309
27 3300025250 Ga0209026_1000046 Ga0209026_100004635 309
28 3300025256 Ga0209759_1000005 Ga0209759_1000005499 309
29 3300045051 Ga0451576_0144735 Ga0451576_0144735_1431_2405 310
30 3300025911 Ga0207654_10013521 Ga0207654_100135213 311
31 3300026041 Ga0207639_10105431 Ga0207639_101054312 311
32 3300044712 Ga0453684_0268925 Ga0453684_0268925_405_1364 311
33 iso_pu_bacteria 2513237138 2513867003 311
34 3300005539 Ga0068853_100149950 Ga0068853_1001499502 314
35 3300005548 Ga0070665_100020401 Ga0070665_1000204015 314
36 3300005563 Ga0068855_100033786 Ga0068855_1000337864 314
37 3300009093 Ga0105240_10038252 Ga0105240_100382525 314
38 3300009174 Ga0105241_10005766 Ga0105241_100057662 314
39 3300009545 Ga0105237_10025230 Ga0105237_100252304 314
40 3300013296 Ga0157374_10034180 Ga0157374_100341802 314
41 3300025904 Ga0207647_10004941 Ga0207647_100049415 314
42 3300025913 Ga0207695_10003120 Ga0207695_100031203 314
43 3300025914 Ga0207671_10000337 Ga0207671_100003373 314
44 3300025924 Ga0207694_10003347 Ga0207694_1000334712 314
45 3300025949 Ga0207667_10036580 Ga0207667_100365803 314
46 3300028379 Ga0268266_10090385 Ga0268266_100903852 314
47 3300044656 Ga0466969_0049345 Ga0466969_0049345_802_1794 314
48 3300044765 Ga0466970_0019183 Ga0466970_0019183_1120_2112 314
49 3300046454 Ga0495592_0308646 Ga0495592_0308646_12_1004 314
50 3300046462 Ga0495651_0001124 Ga0495651_0001124_19678_20670 314
51 3300046516 Ga0495628_0047721 Ga0495628_0047721_1438_2430 314
52 3300046529 Ga0495652_0236738 Ga0495652_0236738_320_1312 314
53 3300046809 Ga0495600_0044672 Ga0495600_0044672_799_1791 314
54 iso_pu_bacteria 2510917030 2511197876 314
55 iso_pu_bacteria 2791355253 2793280101 314
56 iso_pu_bacteria 2919100787 2919100832 314
57 iso_pu_bacteria 3005445848 3005446593 314
58 iso_pu_bacteria 2509276033 2509446641 315
59 iso_pu_bacteria 2510065019 2510133566 315
60 iso_pu_bacteria 2510461076 2510894947 315
61 iso_pu_bacteria 2510917022 2511135682 315
62 iso_pu_bacteria 2510917028 2511187331 315
63 iso_pu_bacteria 2513237084 2513573351 315
64 iso_pu_bacteria 2513237085 2513577518 315
65 iso_pu_bacteria 2513237093 2513629833 315
66 iso_pu_bacteria 2513237103 2513708467 315
67 iso_pu_bacteria 2513237162 2514022071 315
68 iso_pu_bacteria 2515075009 2515112546 315
69 iso_pu_bacteria 2515154113 2515632888 315
70 iso_pu_bacteria 2515154114 2515640032 315
71 iso_pu_bacteria 2515154116 2515655773 315
72 iso_pu_bacteria 2515154134 2515740225 315
73 iso_pu_bacteria 2516653077 2517036272 315
74 iso_pu_bacteria 2516653085 2517076634 315
75 iso_pu_bacteria 2517093000 2517095409 315
76 iso_pu_bacteria 2519899620 2520382121 315
77 iso_pu_bacteria 2524023209 2524459761 315
78 iso_pu_bacteria 2529292951 2530645739 315
79 iso_pu_bacteria 2534681796 2535519376 315
80 iso_pu_bacteria 2537561587 2537873312 315
81 iso_pu_bacteria 2582581304 2585257904 315
82 iso_pu_bacteria 2582581307 2585272757 315
83 iso_pu_bacteria 2582581308 2585281258 315
84 iso_pu_bacteria 2582581315 2585327366 315
85 iso_pu_bacteria 2582581865 2585390746 315
86 iso_pu_bacteria 2582581867 2585402276 315
87 iso_pu_bacteria 2585427526 2585527027 315
88 iso_pu_bacteria 2585427527 2585536081 315
89 iso_pu_bacteria 2585427528 2585537789 315
90 iso_pu_bacteria 2585427530 2585557392 315
91 iso_pu_bacteria 2585427531 2585562425 315
92 iso_pu_bacteria 2585427590 2585822424 315
93 iso_pu_bacteria 2585427593 2585835739 315
94 iso_pu_bacteria 2585427594 2585845440 315
95 iso_pu_bacteria 2585427608 2585896873 315
96 iso_pu_bacteria 2585427609 2585906408 315
97 iso_pu_bacteria 2585427633 2585997160 315
98 iso_pu_bacteria 2585427634 2586001758 315
99 iso_pu_bacteria 2585428125 2587981830 315
100 iso_pu_bacteria 2599185156 2599332016 315
101 iso_pu_bacteria 2599185210 2599605776 315
102 iso_pu_bacteria 2599185236 2599720118 315
103 iso_pu_bacteria 2600255279 2601609327 315
104 iso_pu_bacteria 2600255308 2601746102 315
105 iso_pu_bacteria 2615840626 2616310940 315
106 iso_pu_bacteria 2615840698 2616551869 315
107 iso_pu_bacteria 2617270742 2617382872 315
108 iso_pu_bacteria 2643221599 2644006509 315
109 iso_pu_bacteria 2643221643 2644241927 315
110 iso_pu_bacteria 2718217927 2719385980 315
111 iso_pu_bacteria 2718218199 2720492219 315
112 iso_pu_bacteria 2718218233 2720620360 315
113 iso_pu_bacteria 2718218235 2720631783 315
114 iso_pu_bacteria 2718218269 2720775511 315
115 iso_pu_bacteria 2718218423 2721399760 315
116 iso_pu_bacteria 2721755556 2723027130 315
117 iso_pu_bacteria 2721755684 2723560742 315
118 iso_pu_bacteria 2721755685 2723567330 315
119 iso_pu_bacteria 2721755809 2724038573 315
120 iso_pu_bacteria 2721755819 2724090118 315
121 iso_pu_bacteria 2721755822 2724104595 315
122 iso_pu_bacteria 2724679232 2725950508 315
123 iso_pu_bacteria 2728369352 2730108066 315
124 iso_pu_bacteria 2738541293 2738800367 315
125 iso_pu_bacteria 2791355256 2793294887 315
126 iso_pu_bacteria 2791355260 2793323001 315
127 iso_pu_bacteria 2791355261 2793331843 315
128 iso_pu_bacteria 2791355262 2793335847 315
129 iso_pu_bacteria 2791355263 2793341725 315
130 iso_pu_bacteria 2791355265 2793352848 315
131 iso_pu_bacteria 2791355266 2793360714 315
132 iso_pu_bacteria 2791355267 2793366945 315
133 iso_pu_bacteria 2802429605 2805925908 315
134 iso_pu_bacteria 2802429606 2805937550 315
135 iso_pu_bacteria 2818991448 2819607508 315
136 iso_pu_bacteria 2818991453 2819643943 315
137 iso_pu_bacteria 2818991461 2819686428 315
138 iso_pu_bacteria 2838016132 2838018011 315
139 iso_pu_bacteria 2838029111 2838032007 315
140 iso_pu_bacteria 2838042994 2838043643 315
141 iso_pu_bacteria 2838068647 2838074325 315
142 iso_pu_bacteria 2838668709 2838673646 315
143 iso_pu_bacteria 2838675328 2838677383 315
144 iso_pu_bacteria 2838680041 2838681975 315
145 iso_pu_bacteria 2838686498 2838692021 315
146 iso_pu_bacteria 2838694306 2838696546 315
147 iso_pu_bacteria 2838701080 2838706042 315
148 iso_pu_bacteria 2838707686 2838710214 315
149 iso_pu_bacteria 2838714209 2838716271 315
150 iso_pu_bacteria 2838719591 2838719929 315
151 iso_pu_bacteria 2838724970 2838727023 315
152 iso_pu_bacteria 2838729681 2838732833 315
153 iso_pu_bacteria 2838742623 2838745711 315
154 iso_pu_bacteria 2841846520 2841846860 315
155 iso_pu_bacteria 2841851746 2841855831 315
156 iso_pu_bacteria 2841859092 2841860611 315
157 iso_pu_bacteria 2841864319 2841864332 315
158 iso_pu_bacteria 2842077413 2842078388 315
159 iso_pu_bacteria 2842110456 2842114158 315
160 iso_pu_bacteria 2842118031 2842119103 315
161 iso_pu_bacteria 2842124991 2842127111 315
162 iso_pu_bacteria 2842130223 2842132276 315
163 iso_pu_bacteria 2842146304 2842150895 315
164 iso_pu_bacteria 2842152218 2842152555 315
165 iso_pu_bacteria 2842156927 2842157177 315
166 iso_pu_bacteria 2842163707 2842167838 315
167 iso_pu_bacteria 2842170452 2842172516 315
168 iso_pu_bacteria 2842175837 2842176174 315
169 iso_pu_bacteria 2842180545 2842181239 315
170 iso_pu_bacteria 2842187318 2842189378 315
171 iso_pu_bacteria 2842198810 2842201860 315
172 iso_pu_bacteria 2842205361 2842205827 315
173 iso_pu_bacteria 2842211629 2842213692 315
174 iso_pu_bacteria 2842217011 2842217504 315
175 iso_pu_bacteria 2842224351 2842224690 315
176 iso_pu_bacteria 2842229732 2842230710 315
177 iso_pu_bacteria 2842237096 2842239626 315
178 iso_pu_bacteria 2842243621 2842245190 315
179 iso_pu_bacteria 2842250916 2842255856 315
180 iso_pu_bacteria 2842257432 2842259003 315
181 iso_pu_bacteria 2842264693 2842265846 315
182 iso_pu_bacteria 2842271015 2842276327 315
183 iso_pu_bacteria 2842278818 2842279284 315
184 iso_pu_bacteria 2842291075 2842292050 315
185 iso_pu_bacteria 2842298080 2842301636 315
186 iso_pu_bacteria 2842304105 2842304530 315
187 iso_pu_bacteria 2842357229 2842361795 315
188 iso_pu_bacteria 2842363717 2842364781 315
189 iso_pu_bacteria 2842370503 2842372541 315
190 iso_pu_bacteria 2842377471 2842378446 315
191 iso_pu_bacteria 2842384541 2842385613 315
192 iso_pu_bacteria 2842395702 2842398895 315
193 iso_pu_bacteria 2842422224 2842427560 315
194 iso_pu_bacteria 2842428310 2842429517 315
195 iso_pu_bacteria 2842434925 2842436130 315
196 iso_pu_bacteria 2842441272 2842442477 315
197 iso_pu_bacteria 2842462802 2842463938 315
198 iso_pu_bacteria 2842469257 2842470459 315
199 iso_pu_bacteria 2842475841 2842478739 315
200 iso_pu_bacteria 2842489311 2842490239 315
201 iso_pu_bacteria 2842495871 2842495966 315
202 iso_pu_bacteria 2842502639 2842505942 315
203 iso_pu_bacteria 2842509118 2842513464 315
204 iso_pu_bacteria 2842515876 2842517396 315
205 iso_pu_bacteria 2842922631 2842924351 315
206 iso_pu_bacteria 2844454524 2844458924 315
207 iso_pu_bacteria 2852387548 2852395165 315
208 iso_pu_bacteria 2854896431 2854900223 315
209 iso_pu_bacteria 2854916844 2854919175 315
210 iso_pu_bacteria 2857516855 2857519950 315
211 iso_pu_bacteria 2899792073 2899794597 315
212 iso_pu_bacteria 2899803654 2899804147 315
213 iso_pu_bacteria 2899845264 2899845940 315
214 iso_pu_bacteria 2919114240 2919116475 315
215 iso_pu_bacteria 2919171160 2919173454 315
216 iso_pu_bacteria 2919408235 2919413102 315
217 iso_pu_bacteria 2923556063 2923558729 315
218 iso_pu_bacteria 2926754445 2926754497 315
219 iso_pu_bacteria 2926760298 2926761670 315
220 iso_pu_bacteria 2933006813 2933007201 315
221 iso_pu_bacteria 2933011516 2933015208 315
222 iso_pu_bacteria 2933570622 2933571803 315
223 iso_pu_bacteria 2933594066 2933594403 315
224 iso_pu_bacteria 2933599457 2933604782 315
225 iso_pu_bacteria 2935894831 2935897598 315
226 iso_pu_bacteria 2935901341 2935905448 315
227 iso_pu_bacteria 2936367885 2936372464 315
228 iso_pu_bacteria 2936375103 2936376546 315
229 iso_pu_bacteria 2936381700 2936388416 315
230 iso_pu_bacteria 3005409236 3005414626 315
231 iso_pu_bacteria 639633055 639648786 315
232 iso_pu_bacteria 650716007 650738892 315
233 iso_pu_bacteria 8003570095 8003572449 315
234 iso_pu_bacteria 8005275841 8005280763 315
235 iso_pu_bacteria 8005282627 8005285292 315
236 iso_pu_bacteria 8005289223 8005293299 315
237 iso_pu_bacteria 8005301065 8005302774 315
238 iso_pu_bacteria 8005307578 8005312402 315
239 iso_pu_bacteria 8005376324 8005379459 315
240 iso_pu_bacteria 8005395548 8005396566 315
241 iso_pu_bacteria 8005460587 8005463219 315
242 iso_pu_bacteria 8005484373 8005490053 315
243 iso_pu_bacteria 8005497431 8005500532 315
244 iso_pu_bacteria 8005542996 8005547063 315
245 iso_pu_bacteria 8005556819 8005557456 315
246 iso_pu_bacteria 8005563573 8005568635 315
247 iso_pu_bacteria 8005619151 8005621910 315
248 iso_pu_bacteria 8005626139 8005627152 315
249 iso_pu_bacteria 8005645114 8005650927 315
250 iso_pu_bacteria 8005668836 8005671950 315
251 iso_pu_bacteria 8005682033 8005688187 315
252 iso_pu_bacteria 8005695170 8005699794 315
253 iso_pu_bacteria 8018150411 8018151348 315
254 iso_pu_bacteria 8018163183 8018166546 315
255 iso_pu_bacteria 8018176218 8018178727 315
256 iso_pu_bacteria 8023680758 8023685147 315
257 iso_pu_bacteria 8024479707 8024483291 315
258 iso_pu_bacteria 8024501048 8024501426 315
259 iso_pu_bacteria 8046767195 8046769087 315
260 iso_pu_bacteria 8056375014 8056376831 315
261 iso_pu_bacteria 8056382006 8056388058 315
262 iso_pu_bacteria 8057575449 8057576448 315
263 iso_pu_bacteria 8057874678 8057874798 315
264 3300005262 Ga0065165_1002408 Ga0065165_10024082 317
265 3300048925 Ga0496122_0000107 Ga0496122_0000107_51342_52301 317
266 3300048926 Ga0496123_0000063 Ga0496123_0000063_140808_141767 317
267 3300003792 Ga0055540_1002505 Ga0055540_10025054 318
268 3300005331 Ga0070670_100002696 Ga0070670_1000026963 318
269 3300009092 Ga0105250_10081071 Ga0105250_100810712 318
270 3300025925 Ga0207650_10001919 Ga0207650_1000191913 318
271 3300046506 Ga0495583_0014653 Ga0495583_0014653_1383_2348 318
272 3300046694 Ga0495649_0037596 Ga0495649_0037596_516_1481 318
273 3300048924 Ga0496121_0022517 Ga0496121_0022517_4853_5818 318
274 3300048924 Ga0496121_0143695 Ga0496121_0143695_468_1427 318
275 3300048928 Ga0496125_0064277 Ga0496125_0064277_60_1025 318
276 3300049572 Ga0501036_0302081 Ga0501036_0302081_149_1117 318
277 3300053139 Ga0500568_0054925 Ga0500568_0054925_463_1428 318
278 3300053156 Ga0500622_0000618 Ga0500622_0000618_9579_10544 318
279 3300053158 Ga0500627_0050498 Ga0500627_0050498_424_1413 318
280 3300002774 JGI25150J39212_1000063 JGI25150J39212_100006353 319
281 3300002987 JGI25159J45721_1000158 JGI25159J45721_100015828 319
282 3300003187 JGI25151J46595_10000140 JGI25151J46595_1000014086 319
283 3300003187 JGI25151J46595_10012076 JGI25151J46595_100120764 319
284 3300003215 JGI25153J46596_10003536 JGI25153J46596_100035362 319
285 3300003215 JGI25153J46596_10011329 JGI25153J46596_100113294 319
286 3300003316 rootH1_10109868 rootH1_101098682 319
287 3300003354 JGI25160J50197_1000026 JGI25160J50197_100002634 319
288 3300003374 JGI25161J50226_1000014 JGI25161J50226_1000014156 319
289 3300003775 Ga0055524_1003315 Ga0055524_10033157 319
290 3300003781 Ga0055536_1000808 Ga0055536_10008084 319
291 3300003790 Ga0055528_1009275 Ga0055528_10092752 319
292 3300003790 Ga0055528_1021085 Ga0055528_10210852 319
293 3300003792 Ga0055540_1000988 Ga0055540_10009884 319
294 3300003794 Ga0055531_10010550 Ga0055531_100105506 319
295 3300004625 Ga0055543_1000079 Ga0055543_100007946 319
296 3300005262 Ga0065165_1000073 Ga0065165_1000073133 319
297 3300005335 Ga0070666_10136490 Ga0070666_101364902 319
298 3300005355 Ga0070671_100004488 Ga0070671_10000448812 319
299 3300005548 Ga0070665_100014665 Ga0070665_1000146655 319
300 3300006038 Ga0075365_10000600 Ga0075365_1000060013 319
301 3300006038 Ga0075365_10066655 Ga0075365_100666552 319
302 3300006038 Ga0075365_10100425 Ga0075365_101004252 319
303 3300006177 Ga0075362_10029412 Ga0075362_100294122 319
304 3300006186 Ga0075369_10003349 Ga0075369_100033495 319
305 3300006353 Ga0075370_10008391 Ga0075370_100083915 319
306 3300009011 Ga0105251_10002518 Ga0105251_100025185 319
307 3300009093 Ga0105240_10000217 Ga0105240_1000021785 319
308 3300009093 Ga0105240_10542679 Ga0105240_105426792 319
309 3300009098 Ga0105245_10242231 Ga0105245_102422311 319
310 3300009148 Ga0105243_10167033 Ga0105243_101670332 319
311 3300009177 Ga0105248_10050115 Ga0105248_100501152 319
312 3300009545 Ga0105237_10001458 Ga0105237_100014587 319
313 3300009553 Ga0105249_10174029 Ga0105249_101740292 319
314 3300009766 Ga0123342_1018576 Ga0123342_10185762 319
315 3300010375 Ga0105239_10001164 Ga0105239_1000116423 319
316 3300013104 Ga0157370_10000768 Ga0157370_1000076811 319
317 3300013297 Ga0157378_10094579 Ga0157378_100945792 319
318 3300025233 Ga0209437_100042 Ga0209437_100042121 319
319 3300025233 Ga0209437_105361 Ga0209437_1053612 319
320 3300025245 Ga0207425_1000080 Ga0207425_100008086 319
321 3300025253 Ga0209677_100295 Ga0209677_10029522 319
322 3300025258 Ga0209129_1000195 Ga0209129_100019515 319
323 3300025261 Ga0209233_1000103 Ga0209233_1000103121 319
324 3300025261 Ga0209233_1000288 Ga0209233_100028836 319
325 3300025273 Ga0209673_1006836 Ga0209673_10068364 319
326 3300025273 Ga0209673_1012570 Ga0209673_10125702 319
327 3300025284 Ga0209130_1000219 Ga0209130_100021942 319
328 3300025292 Ga0209676_1037104 Ga0209676_10371042 319
329 3300025294 Ga0209025_1000060 Ga0209025_1000060193 319
330 3300025294 Ga0209025_1000332 Ga0209025_100033286 319
331 3300025295 Ga0209564_1009055 Ga0209564_10090552 319
332 3300025297 Ga0209758_1000263 Ga0209758_100026386 319
333 3300025297 Ga0209758_1000576 Ga0209758_100057622 319
334 3300025297 Ga0209758_1001861 Ga0209758_100186122 319
335 3300025298 Ga0209050_1004762 Ga0209050_10047629 319
336 3300025299 Ga0209256_1005801 Ga0209256_10058012 319
337 3300025302 Ga0207426_1000075 Ga0207426_1000075172 319
338 3300025302 Ga0207426_1007526 Ga0207426_10075264 319
339 3300025303 Ga0209051_1003118 Ga0209051_10031183 319
340 3300025303 Ga0209051_1011202 Ga0209051_10112023 319
341 3300025304 Ga0209257_1001330 Ga0209257_100133023 319
342 3300025913 Ga0207695_10000613 Ga0207695_1000061328 319
343 3300025914 Ga0207671_10001160 Ga0207671_1000116023 319
344 3300025949 Ga0207667_10127742 Ga0207667_101277422 319
345 3300025981 Ga0207640_10051174 Ga0207640_100511742 319
346 3300028379 Ga0268266_10000769 Ga0268266_1000076914 319
347 3300028794 Ga0307515_10017559 Ga0307515_100175597 319
348 3300031901 Ga0307406_10002153 Ga0307406_100021535 319
349 3300031911 Ga0307412_10055646 Ga0307412_100556461 319
350 3300041413 Ga0439465_0057006 Ga0439465_0057006_315_1274 319
351 3300041441 Ga0451787_546452 Ga0451787_546452_390_1349 319
352 3300041491 Ga0451833_0157354 Ga0451833_0157354_5848_6807 319
353 3300041492 Ga0451835_1169534 Ga0451835_1169534_1886_2845 319
354 3300041498 Ga0451841_0262451 Ga0451841_0262451_26_985 319
355 3300041503 Ga0451847_0231158 Ga0451847_0231158_5362_6321 319
356 3300041507 Ga0451851_0529450 Ga0451851_0529450_133_1092 319
357 3300041511 Ga0451855_0293665 Ga0451855_0293665_3216_4175 319
358 3300041512 Ga0451853_0935403 Ga0451853_0935403_581_1540 319
359 3300041997 Ga0439431_0053902 Ga0439431_0053902_76_1035 319
360 3300042007 Ga0439449_0055274 Ga0439449_0055274_381_1340 319
361 3300042015 Ga0439462_0009613 Ga0439462_0009613_1365_2324 319
362 3300046474 Ga0495605_0000650 Ga0495605_0000650_9013_9972 319
363 3300046474 Ga0495605_0040098 Ga0495605_0040098_1210_2169 319
364 3300046492 Ga0495585_0104430 Ga0495585_0104430_215_1174 319
365 3300046501 Ga0495607_0005399 Ga0495607_0005399_8176_9135 319
366 3300046506 Ga0495583_0050882 Ga0495583_0050882_599_1558 319
367 3300046507 Ga0495606_0009313 Ga0495606_0009313_2349_3314 319
368 3300046512 Ga0495610_0007979 Ga0495610_0007979_4327_5286 319
369 3300046513 Ga0495616_0012217 Ga0495616_0012217_20_979 319
370 3300046518 Ga0495631_0000362 Ga0495631_0000362_26384_27343 319
371 3300046519 Ga0495632_0001545 Ga0495632_0001545_16077_17066 319
372 3300046519 Ga0495632_0021710 Ga0495632_0021710_1781_2740 319
373 3300046519 Ga0495632_0029053 Ga0495632_0029053_487_1446 319
374 3300046522 Ga0495643_0011170 Ga0495643_0011170_3156_4115 319
375 3300046522 Ga0495643_0022049 Ga0495643_0022049_819_1778 319
376 3300046524 Ga0495648_0106078 Ga0495648_0106078_43_1002 319
377 3300046530 Ga0495654_0066170 Ga0495654_0066170_134_1093 319
378 3300046542 Ga0495597_0004692 Ga0495597_0004692_6265_7224 319
379 3300046660 Ga0495625_0002545 Ga0495625_0002545_851_1810 319
380 3300046660 Ga0495625_0029081 Ga0495625_0029081_2914_3879 319
381 3300046691 Ga0495670_0156286 Ga0495670_0156286_89_1048 319
382 3300047472 Ga0495686_0001486 Ga0495686_0001486_22094_23059 319
383 3300047472 Ga0495686_0023701 Ga0495686_0023701_772_1731 319
384 3300047472 Ga0495686_0089109 Ga0495686_0089109_109_1074 319
385 3300047472 Ga0495686_0125624 Ga0495686_0125624_24_989 319
386 3300048903 Ga0496100_0001458 Ga0496100_0001458_1934_2893 319
387 3300048904 Ga0496101_0019168 Ga0496101_0019168_3539_4504 319
388 3300048905 Ga0496102_0003597 Ga0496102_0003597_9036_9995 319
389 3300048905 Ga0496102_0041612 Ga0496102_0041612_2707_3672 319
390 3300048906 Ga0496103_0002492 Ga0496103_0002492_8480_9439 319
391 3300048907 Ga0496104_0195734 Ga0496104_0195734_343_1308 319
392 3300048907 Ga0496104_0201009 Ga0496104_0201009_91_1056 319
393 3300048909 Ga0496106_0195420 Ga0496106_0195420_170_1135 319
394 3300048912 Ga0496109_0447616 Ga0496109_0447616_199_1164 319
395 3300048913 Ga0496110_0097120 Ga0496110_0097120_964_1929 319
396 3300048914 Ga0496111_0000974 Ga0496111_0000974_4309_5274 319
397 3300048914 Ga0496111_0040832 Ga0496111_0040832_104_1069 319
398 3300048919 Ga0496116_0002495 Ga0496116_0002495_11363_12352 319
399 3300048919 Ga0496116_0004853 Ga0496116_0004853_8149_9108 319
400 3300048919 Ga0496116_0022249 Ga0496116_0022249_39_1028 319
401 3300048919 Ga0496116_0042301 Ga0496116_0042301_484_1473 319
402 3300048919 Ga0496116_0194924 Ga0496116_0194924_32_997 319
403 3300048920 Ga0496117_0004786 Ga0496117_0004786_3843_4802 319
404 3300048920 Ga0496117_0029675 Ga0496117_0029675_867_1856 319
405 3300048921 Ga0496118_0004764 Ga0496118_0004764_4413_5372 319
406 3300048921 Ga0496118_0005381 Ga0496118_0005381_3799_4758 319
407 3300048921 Ga0496118_0050862 Ga0496118_0050862_2177_3142 319
408 3300048921 Ga0496118_0064841 Ga0496118_0064841_1655_2644 319
409 3300048922 Ga0496119_0004967 Ga0496119_0004967_8277_9236 319
410 3300048922 Ga0496119_0016900 Ga0496119_0016900_3273_4238 319
411 3300048923 Ga0496120_0004041 Ga0496120_0004041_3593_4552 319
412 3300048923 Ga0496120_0095268 Ga0496120_0095268_138_1097 319
413 3300048924 Ga0496121_0006476 Ga0496121_0006476_9870_10829 319
414 3300048924 Ga0496121_0008946 Ga0496121_0008946_910_1899 319
415 3300048924 Ga0496121_0012128 Ga0496121_0012128_2063_3028 319
416 3300048925 Ga0496122_0006549 Ga0496122_0006549_3224_4183 319
417 3300048925 Ga0496122_0036132 Ga0496122_0036132_1149_2114 319
418 3300048925 Ga0496122_0071820 Ga0496122_0071820_1375_2364 319
419 3300048926 Ga0496123_0004822 Ga0496123_0004822_9317_10276 319
420 3300048926 Ga0496123_0007564 Ga0496123_0007564_8953_9918 319
421 3300048927 Ga0496124_0005510 Ga0496124_0005510_9845_10804 319
422 3300048927 Ga0496124_0009023 Ga0496124_0009023_5987_6976 319
423 3300048927 Ga0496124_0013288 Ga0496124_0013288_3664_4653 319
424 3300048927 Ga0496124_0054340 Ga0496124_0054340_2378_3367 319
425 3300048927 Ga0496124_0060158 Ga0496124_0060158_1336_2301 319
426 3300048928 Ga0496125_0007481 Ga0496125_0007481_8497_9456 319
427 3300048928 Ga0496125_0016911 Ga0496125_0016911_3442_4431 319
428 3300048928 Ga0496125_0062158 Ga0496125_0062158_99_1058 319
429 3300048929 Ga0496126_0050423 Ga0496126_0050423_2595_3584 319
430 3300048929 Ga0496126_0059488 Ga0496126_0059488_934_1893 319
431 3300048929 Ga0496126_0125338 Ga0496126_0125338_619_1596 319
432 3300048929 Ga0496126_0154275 Ga0496126_0154275_586_1551 319
433 3300049459 Ga0495678_060663 Ga0495678_060663_88_1047 319
434 3300049758 Ga0501241_011489 Ga0501241_011489_342_1307 319
435 3300050489 nmdc:mga03683_8336_c1 nmdc:mga03683_8336_c1_2207_3166 319
436 3300050496 nmdc:mga07m45_52431_c1 nmdc:mga07m45_52431_c1_154_1113 319
437 3300053109 Ga0500569_051921 Ga0500569_051921_180_1139 319
438 3300053118 Ga0500594_0011957 Ga0500594_0011957_681_1640 319
439 3300053125 Ga0500618_005686 Ga0500618_005686_1604_2599 319
440 3300053134 Ga0500658_0000642 Ga0500658_0000642_8087_9046 319
441 3300053153 Ga0500616_0000709 Ga0500616_0000709_19269_20234 319
442 3300053153 Ga0500616_0003848 Ga0500616_0003848_8857_9816 319
443 3300002737 JGI25162J39368_1000119 JGI25162J39368_100011931 325
444 3300003214 JGI25165J46597_1000211 JGI25165J46597_100021131 325
445 3300025233 Ga0209437_100062 Ga0209437_100062297 325
446 3300025261 Ga0209233_1000082 Ga0209233_1000082297 325
447 3300048927 Ga0496124_0054242 Ga0496124_0054242_1116_2117 325
448 3300003187 JGI25151J46595_10004395 JGI25151J46595_100043954 326
449 3300003215 JGI25153J46596_10024270 JGI25153J46596_100242702 326
450 3300025258 Ga0209129_1001740 Ga0209129_10017407 326
451 3300025294 Ga0209025_1000483 Ga0209025_100048330 326
452 3300025297 Ga0209758_1000544 Ga0209758_100054449 326
453 3300006051 Ga0075364_10003970 Ga0075364_100039704 328
454 3300006353 Ga0075370_10011474 Ga0075370_100114744 328
455 3300027312 Ga0209371_1000009 Ga0209371_1000009665 328
456 3300030500 Ga0268256_1000010 Ga0268256_1000010664 328
457 3300046665 Ga0495661_0173260 Ga0495661_0173260_82_1089 328
458 3300048909 Ga0496106_0002048 Ga0496106_0002048_9797_10804 328
459 3300050491 nmdc:mga00v17_7480_c1 nmdc:mga00v17_7480_c1_2635_3705 328
460 3300050492 nmdc:mga0yw44_5875_c1 nmdc:mga0yw44_5875_c1_2351_3421 328
461 3300050496 nmdc:mga07m45_2189_c1 nmdc:mga07m45_2189_c1_2171_3241 328
462 3300053134 Ga0500658_0004206 Ga0500658_0004206_3239_4246 328
463 3300053139 Ga0500568_0001485 Ga0500568_0001485_10125_11132 328
464 3300053160 Ga0500633_0000532 Ga0500633_0000532_1676_2683 328
465 3300002987 JGI25159J45721_1009456 JGI25159J45721_10094562 329
466 3300003215 JGI25153J46596_10012584 JGI25153J46596_100125844 329
467 3300003374 JGI25161J50226_1000190 JGI25161J50226_10001906 329
468 3300003771 Ga0055526_1002411 Ga0055526_100241110 329
469 3300003775 Ga0055524_1001464 Ga0055524_100146411 329
470 3300003790 Ga0055528_1002267 Ga0055528_10022672 329
471 3300004625 Ga0055543_1000115 Ga0055543_100011540 329
472 3300005262 Ga0065165_1012719 Ga0065165_10127193 329
473 3300025208 Ga0209436_100060 Ga0209436_10006062 329
474 3300025273 Ga0209673_1015006 Ga0209673_10150063 329
475 3300025284 Ga0209130_1000015 Ga0209130_100001538 329
476 3300025295 Ga0209564_1000984 Ga0209564_100098412 329
477 3300025297 Ga0209758_1000148 Ga0209758_10001486 329
478 3300025299 Ga0209256_1005344 Ga0209256_10053445 329
479 3300025302 Ga0207426_1000122 Ga0207426_1000122194 329
480 3300025303 Ga0209051_1002404 Ga0209051_10024043 329
481 3300041413 Ga0439465_0008800 Ga0439465_0008800_41_1042 329
482 3300048927 Ga0496124_0064873 Ga0496124_0064873_1135_2130 329
483 iso_pu_bacteria 2667528174 2671116774 329
484 3300053136 Ga0500559_0016896 Ga0500559_0016896_1482_2528 330
485 iso_pu_bacteria 2765235942 2766066889 330
486 iso_pu_bacteria 2933586486 2933590254 330
487 iso_pu_bacteria 3005416602 3005421924 330
488 iso_pu_bacteria 8005314921 8005321206 330
489 3300003323 rootH1_10206213 rootH1_102062135 331
490 3300025258 Ga0209129_1002157 Ga0209129_10021579 331
491 3300048906 Ga0496103_0028587 Ga0496103_0028587_50_1186 331
492 3300048928 Ga0496125_0038705 Ga0496125_0038705_496_1605 331
493 iso_pu_bacteria 3005452660 3005455626 331
494 3300025245 Ga0207425_1002206 Ga0207425_10022063 332
495 3300025258 Ga0209129_1011866 Ga0209129_10118662 332
496 3300025297 Ga0209758_1012600 Ga0209758_10126003 332
497 3300025297 Ga0209758_1012869 Ga0209758_10128693 332
498 3300037471 Ga0395905_0005571 Ga0395905_0005571_1572_2615 332
499 iso_pu_bacteria 2582581298 2585225433 332
500 iso_pu_bacteria 2585427529 2585548292 332
501 3300001979 JGI24740J21852_10009986 JGI24740J21852_100099864 333
502 3300003354 JGI25160J50197_1001632 JGI25160J50197_100163212 333
503 3300003771 Ga0055526_1002283 Ga0055526_10022837 333
504 3300003775 Ga0055524_1007853 Ga0055524_10078536 333
505 3300003790 Ga0055528_1001675 Ga0055528_100167513 333
506 3300004625 Ga0055543_1000329 Ga0055543_100032910 333
507 3300005262 Ga0065165_1017630 Ga0065165_10176303 333
508 3300005614 Ga0068856_100056248 Ga0068856_1000562484 333
509 3300006042 Ga0075368_10001513 Ga0075368_100015135 333
510 3300006048 Ga0075363_100047842 Ga0075363_1000478422 333
511 3300006177 Ga0075362_10043103 Ga0075362_100431032 333
512 3300006178 Ga0075367_10008024 Ga0075367_100080245 333
513 3300006178 Ga0075367_10122779 Ga0075367_101227792 333
514 3300006186 Ga0075369_10025166 Ga0075369_100251662 333
515 3300006948 Ga0099826_10000149 Ga0099826_1000014916 333
516 3300006948 Ga0099826_10004007 Ga0099826_100040078 333
517 3300009148 Ga0105243_10025899 Ga0105243_100258992 333
518 3300011119 Ga0105246_10036031 Ga0105246_100360312 333
519 3300013100 Ga0157373_10007095 Ga0157373_100070953 333
520 3300013102 Ga0157371_10000004 Ga0157371_10000004332 333
521 3300013104 Ga0157370_10008228 Ga0157370_100082289 333
522 3300025273 Ga0209673_1000325 Ga0209673_100032543 333
523 3300025295 Ga0209564_1000703 Ga0209564_100070345 333
524 3300025299 Ga0209256_1000245 Ga0209256_100024546 333
525 3300025302 Ga0207426_1000039 Ga0207426_1000039370 333
526 3300025303 Ga0209051_1002064 Ga0209051_10020649 333
527 3300026078 Ga0207702_10120552 Ga0207702_101205523 333
528 3300027666 Ga0209282_1000380 Ga0209282_10003809 333
529 3300044684 Ga0466966_0030391 Ga0466966_0030391_2420_3493 333
530 3300044842 Ga0466957_0032037 Ga0466957_0032037_1009_2124 333
531 3300045049 Ga0466959_0121669 Ga0466959_0121669_42_1115 333
532 3300046492 Ga0495585_0034695 Ga0495585_0034695_1647_2726 333
533 3300046660 Ga0495625_0015606 Ga0495625_0015606_3329_4408 333
534 3300046674 Ga0495588_0008452 Ga0495588_0008452_2572_3627 333
535 3300046692 Ga0495671_0018597 Ga0495671_0018597_2203_3285 333
536 3300047470 Ga0495681_0014933 Ga0495681_0014933_2182_3264 333
537 3300048920 Ga0496117_0000002 Ga0496117_0000002_2127035_2128051 333
538 3300048920 Ga0496117_0122124 Ga0496117_0122124_397_1398 333
539 3300048921 Ga0496118_0004084 Ga0496118_0004084_2203_3219 333
540 3300048922 Ga0496119_0024786 Ga0496119_0024786_258_1259 333
541 3300048922 Ga0496119_0045458 Ga0496119_0045458_835_1905 333
542 3300048923 Ga0496120_0000034 Ga0496120_0000034_60342_61358 333
543 3300048925 Ga0496122_0000001 Ga0496122_0000001_1497831_1498847 333
544 3300048925 Ga0496122_0017559 Ga0496122_0017559_5222_6223 333
545 3300048926 Ga0496123_0000001 Ga0496123_0000001_1501562_1502578 333
546 3300048926 Ga0496123_0052465 Ga0496123_0052465_659_1660 333
547 3300048928 Ga0496125_0103954 Ga0496125_0103954_85_1155 333
548 3300050491 nmdc:mga00v17_270_c1 nmdc:mga00v17_270_c1_23018_24034 333
549 3300050493 nmdc:mga0k408_31039_c1 nmdc:mga0k408_31039_c1_387_1406 333
550 3300050516 nmdc:mga0sz30_208_c1 nmdc:mga0sz30_208_c1_13869_14885 333
551 3300050516 nmdc:mga0sz30_31874_c1 nmdc:mga0sz30_31874_c1_235_1305 333
552 3300053107 Ga0500560_005056 Ga0500560_005056_525_1580 333
553 3300053125 Ga0500618_007276 Ga0500618_007276_812_1876 333
554 3300053137 Ga0500561_0000741 Ga0500561_0000741_1848_2864 333
555 iso_pu_bacteria 2554235003 2554246429 333
556 iso_pu_bacteria 2558860242 2559293651 333
557 iso_pu_bacteria 2643221582 2643920814 333
558 iso_pu_bacteria 2643221693 2644519382 333
559 iso_pu_bacteria 2738541333 2739032445 333
560 iso_pu_bacteria 2802429633 2806043421 333
561 iso_pu_bacteria 2802429634 2806050646 333
562 iso_pu_bacteria 2802429635 2806057463 333
563 iso_pu_bacteria 2802429636 2806064844 333
564 iso_pu_bacteria 2802429637 2806072110 333
565 iso_pu_bacteria 2808606387 2808986578 333
566 iso_pu_bacteria 2818991439 2819556649 333
567 iso_pu_bacteria 2979089926 2979093067 333
568 iso_pu_bacteria 2979095461 2979099545 333
569 iso_pu_bacteria 2979100975 2979105037 333
570 iso_pu_bacteria 2984509177 2984513149 333
571 iso_pu_bacteria 2984518228 2984520484 333
572 iso_pu_bacteria 2984537506 2984539778 333
573 iso_pu_bacteria 2984601300 2984601992 333
574 iso_pu_bacteria 8005570704 8005574502 333

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF05448

AXE1

Acetyl xylan esterase (AXE1)

71

369

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
1l7a-assembly1.cif.gz_A structural genomics, crystal structure of cephalosporin c deacetylase 0.871 31 327
1ods-assembly1.cif.gz_A cephalosporin c deacetylase from bacillus subtilis 0.8674 31 330
1odt-assembly1.cif.gz_C cephalosporin c deacetylase mutated, in complex with acetate 0.8611 31 330
6agq-assembly1.cif.gz_D acetyl xylan esterase from paenibacillus sp. r4 0.861 31 324
2xlb-assembly1.cif.gz_G acetyl xylan esterase from bacillus pumilus without ligands 0.8561 31 324
ID Description Score Start End Superfamily
6agqE00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.846 31 324 3.40.50.1820
3fcyB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8337 31 325 3.40.50.1820
3m83C00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8313 31 329 3.40.50.1820
3fvtF00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8264 31 324 3.40.50.1820
6fkxA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.7998 18 324 3.40.50.1820
ID Description Score Start End GO Terms
AF-A0A387G278-F1-model_v4 Acetylxylan esterase 0.9972 16 332 GO:0005976
GO:0052689
AF-A0A1S7TYW7-F1-model_v4 deleted 0.9916 9 332
AF-A0A495VGX0-F1-model_v4 Cephalosporin-C deacetylase 0.9889 65 329 GO:0005976
GO:0052689
AF-A0A387G278-F1-model_v4 Acetylxylan esterase 0.9879 16 332 GO:0005976
GO:0052689
AF-A0A7C6W0B0-F1-model_v4 Acetylxylan esterase 0.9816 18 332 GO:0005976
GO:0052689

Feature Viewer

pLDDT pTM Quality
93.14 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map