F465321
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 574 | 243 | 573 | 208 |
Family's Representative Sequence
| Representative Sequence | 3300037068|Ga0373925_0026308|Ga0373925_0026308_1570_2172 |
| Length | 200 |
| Sequence | MRKGFTRKPQADAPATLARNYITPSGLQRLKDEHQFLLTRERPAVVEVVAWAASNGDRSENADYQYGKRRLRQIDGRIRFLTKRIEAAEVVDPEAPRAGQAKTKTRAFFGATVRYANAAGAERVVSIVGTDEIDLNRNHISWVSPLGRALMKSAAGDSVVLQAPGGPEYLTVLEVCYQRVSVEPFREPPGSEASAKRVPR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2884215851 | Edaphobacter sp. 12200R-103 | Isolate | Rhizosphere |
| 2 | 3300000546 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled | Metagenome | Rhizosphere |
| 3 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 4 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 5 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 7 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 8 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 9 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 11 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 12 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 13 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 14 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 15 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 16 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 21 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 22 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 24 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 25 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 26 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 28 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 31 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 32 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 33 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 34 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 35 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 36 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 37 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 41 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 43 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 44 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 45 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 47 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 48 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 49 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 50 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 51 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 52 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 53 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 54 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 55 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 56 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 58 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 59 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 60 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 61 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 62 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 63 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 64 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 65 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 67 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 68 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 69 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 70 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 71 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300012478 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.9.old.080610 | Metagenome | Rhizosphere |
| 76 | 3300012482 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.130510 | Metagenome | Rhizosphere |
| 77 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 78 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 79 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 80 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 81 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 88 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 91 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300024225 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 | Metagenome | Rhizosphere |
| 93 | 3300024227 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 | Metagenome | Rhizosphere |
| 94 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 95 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300028017 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 | Metagenome | Rhizosphere |
| 143 | 3300028023 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 | Metagenome | Rhizosphere |
| 144 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 148 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 149 | 3300030763 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 150 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 151 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 152 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 153 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 154 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 155 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 156 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 157 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 158 | 3300033546 | Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE2 | Metagenome | Unclassified |
| 159 | 3300033547 | Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE1 | Metagenome | Unclassified |
| 160 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 161 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 162 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 163 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 164 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 165 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 166 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 167 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 168 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 169 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 170 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 171 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 172 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 173 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 174 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 175 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 176 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 177 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 178 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 179 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 180 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 181 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 182 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 183 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 184 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 185 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 186 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 187 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 217 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 218 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 219 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 220 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 221 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 222 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 223 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 224 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 225 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 226 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 227 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 228 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 229 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 230 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 231 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 232 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 233 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 234 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 235 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 236 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 237 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 238 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 239 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 240 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 243 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.65 |
| Metatranscriptomes | 0.17 |
| Isolates | 0.17 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.52 |
| Nodule | 0 |
| Rhizoplane | 4.36 |
| Rhizosphere | 93.55 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 1.57 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | LJNas_1000379 | 3300000546 | Bacteria | 7810 |
| 2 | LJNas_1009679 | 3300000546 | Bacteria | 1030 |
| 3 | rootH2_10047366 | 3300003320 | Bacteria | 7414 |
| 4 | rootL2_10149945 | 3300003322 | Bacteria | 7238 |
| 5 | Ga0070658_10219871 | 3300005327 | Bacteria | 1606 |
| 6 | Ga0070683_100012931 | 3300005329 | Bacteria | 7266 |
| 7 | Ga0070683_100090670 | 3300005329 | Bacteria | 2870 |
| 8 | Ga0070690_100181545 | 3300005330 | Bacteria | 1454 |
| 9 | Ga0068869_100073489 | 3300005334 | Bacteria | 2535 |
| 10 | Ga0070666_10064026 | 3300005335 | Bacteria | 2493 |
| 11 | Ga0070680_100037897 | 3300005336 | Bacteria | 3897 |
| 12 | Ga0070682_100138802 | 3300005337 | Bacteria | 1654 |
| 13 | Ga0070682_100161032 | 3300005337 | Bacteria | 1550 |
| 14 | Ga0068868_100011939 | 3300005338 | Bacteria | 6337 |
| 15 | Ga0068868_100025862 | 3300005338 | Bacteria | 4469 |
| 16 | Ga0068868_100026776 | 3300005338 | Bacteria | 4397 |
| 17 | Ga0068868_100059666 | 3300005338 | Bacteria | 3018 |
| 18 | Ga0070689_100335502 | 3300005340 | Bacteria | 1265 |
| 19 | Ga0070691_10315941 | 3300005341 | Bacteria | 858 |
| 20 | Ga0070687_100072759 | 3300005343 | Bacteria | 1851 |
| 21 | Ga0070661_100160316 | 3300005344 | Bacteria | 1703 |
| 22 | Ga0070668_100037146 | 3300005347 | Bacteria | 3718 |
| 23 | Ga0070668_100166168 | 3300005347 | Bacteria | 1793 |
| 24 | Ga0070675_100316223 | 3300005354 | Bacteria | 1379 |
| 25 | Ga0070671_100008953 | 3300005355 | Bacteria | 8033 |
| 26 | Ga0070671_100214360 | 3300005355 | Bacteria | 1633 |
| 27 | Ga0070671_100293083 | 3300005355 | Bacteria | 1385 |
| 28 | Ga0070671_100919794 | 3300005355 | Bacteria | 764 |
| 29 | Ga0070688_100247663 | 3300005365 | Bacteria | 1267 |
| 30 | Ga0070709_10185312 | 3300005434 | Bacteria | 1464 |
| 31 | Ga0070709_10264171 | 3300005434 | Unclassified | 1245 |
| 32 | Ga0070709_10703400 | 3300005434 | Bacteria | 786 |
| 33 | Ga0070714_100000096 | 3300005435 | Bacteria | 74616 |
| 34 | Ga0070714_100111328 | 3300005435 | Bacteria | 2424 |
| 35 | Ga0070714_100420921 | 3300005435 | Bacteria | 1265 |
| 36 | Ga0070713_100002562 | 3300005436 | Bacteria | 11888 |
| 37 | Ga0070713_100004256 | 3300005436 | Bacteria | 9572 |
| 38 | Ga0070713_100012208 | 3300005436 | Bacteria | 6293 |
| 39 | Ga0070713_100086922 | 3300005436 | Bacteria | 2681 |
| 40 | Ga0070713_100349325 | 3300005436 | Bacteria | 1372 |
| 41 | Ga0070713_100602692 | 3300005436 | Bacteria | 1044 |
| 42 | Ga0070710_10002286 | 3300005437 | Bacteria | 9059 |
| 43 | Ga0070701_10265072 | 3300005438 | Bacteria | 1043 |
| 44 | Ga0070711_100006210 | 3300005439 | Bacteria | 7189 |
| 45 | Ga0070711_100103485 | 3300005439 | Bacteria | 2075 |
| 46 | Ga0070711_100181713 | 3300005439 | Bacteria | 1610 |
| 47 | Ga0070700_100545959 | 3300005441 | Bacteria | 899 |
| 48 | Ga0070678_100175711 | 3300005456 | Bacteria | 1748 |
| 49 | Ga0070678_100233529 | 3300005456 | Bacteria | 1534 |
| 50 | Ga0070662_100008074 | 3300005457 | Bacteria | 6851 |
| 51 | Ga0070662_100032341 | 3300005457 | Bacteria | 3676 |
| 52 | Ga0070681_10000147 | 3300005458 | Bacteria | 53398 |
| 53 | Ga0070681_10051723 | 3300005458 | Bacteria | 4097 |
| 54 | Ga0068867_100058040 | 3300005459 | Bacteria | 2868 |
| 55 | Ga0070707_100126787 | 3300005468 | Bacteria | 2480 |
| 56 | Ga0070679_100006558 | 3300005530 | Bacteria | 10845 |
| 57 | Ga0070679_100045430 | 3300005530 | Bacteria | 4377 |
| 58 | Ga0070679_100179066 | 3300005530 | Bacteria | 2092 |
| 59 | Ga0070679_100235043 | 3300005530 | Bacteria | 1792 |
| 60 | Ga0070679_100413891 | 3300005530 | Bacteria | 1293 |
| 61 | Ga0070679_100570067 | 3300005530 | Bacteria | 1076 |
| 62 | Ga0070684_100048222 | 3300005535 | Unclassified | 3695 |
| 63 | Ga0070684_100146853 | 3300005535 | Bacteria | 2135 |
| 64 | Ga0068853_100001002 | 3300005539 | Bacteria | 19900 |
| 65 | Ga0068853_100007558 | 3300005539 | Bacteria | 8700 |
| 66 | Ga0068853_100008705 | 3300005539 | Bacteria | 8163 |
| 67 | Ga0068853_100015608 | 3300005539 | Bacteria | 6240 |
| 68 | Ga0068853_100377051 | 3300005539 | Bacteria | 1324 |
| 69 | Ga0068853_100401186 | 3300005539 | Bacteria | 1283 |
| 70 | Ga0070686_100402374 | 3300005544 | Bacteria | 1041 |
| 71 | Ga0070696_100360270 | 3300005546 | Bacteria | 1128 |
| 72 | Ga0070693_100120020 | 3300005547 | Bacteria | 1629 |
| 73 | Ga0070665_100037113 | 3300005548 | Bacteria | 4901 |
| 74 | Ga0070665_100212429 | 3300005548 | Bacteria | 1935 |
| 75 | Ga0070665_100264736 | 3300005548 | Bacteria | 1720 |
| 76 | Ga0068855_100001009 | 3300005563 | Bacteria | 35131 |
| 77 | Ga0068855_100030086 | 3300005563 | Bacteria | 6494 |
| 78 | Ga0068855_100064251 | 3300005563 | Bacteria | 4280 |
| 79 | Ga0068855_100082596 | 3300005563 | Bacteria | 3723 |
| 80 | Ga0068855_100157926 | 3300005563 | Bacteria | 2576 |
| 81 | Ga0068855_100202444 | 3300005563 | Unclassified | 2234 |
| 82 | Ga0068855_100338191 | 3300005563 | Bacteria | 1660 |
| 83 | Ga0068855_100464076 | 3300005563 | Bacteria | 1380 |
| 84 | Ga0068855_100937603 | 3300005563 | Bacteria | 913 |
| 85 | Ga0070664_100818152 | 3300005564 | Bacteria | 871 |
| 86 | Ga0070664_101102190 | 3300005564 | Bacteria | 748 |
| 87 | Ga0068857_100663978 | 3300005577 | Bacteria | 989 |
| 88 | Ga0068854_100699788 | 3300005578 | Bacteria | 874 |
| 89 | Ga0068856_100000609 | 3300005614 | Bacteria | 39156 |
| 90 | Ga0068856_100000813 | 3300005614 | Bacteria | 33637 |
| 91 | Ga0068856_100015336 | 3300005614 | Bacteria | 7405 |
| 92 | Ga0068856_100041434 | 3300005614 | Bacteria | 4525 |
| 93 | Ga0068856_100072459 | 3300005614 | Bacteria | 3410 |
| 94 | Ga0068856_100084851 | 3300005614 | Bacteria | 3146 |
| 95 | Ga0068856_100494149 | 3300005614 | Bacteria | 1244 |
| 96 | Ga0070702_100098210 | 3300005615 | Bacteria | 1791 |
| 97 | Ga0068852_100001161 | 3300005616 | Bacteria | 17422 |
| 98 | Ga0068852_100003078 | 3300005616 | Bacteria | 11609 |
| 99 | Ga0068852_100009777 | 3300005616 | Bacteria | 7130 |
| 100 | Ga0068852_100130431 | 3300005616 | Bacteria | 2314 |
| 101 | Ga0068852_100152870 | 3300005616 | Bacteria | 2148 |
| 102 | Ga0068852_100155809 | 3300005616 | Bacteria | 2128 |
| 103 | Ga0068852_100210657 | 3300005616 | Bacteria | 1844 |
| 104 | Ga0068852_100401946 | 3300005616 | Bacteria | 1347 |
| 105 | Ga0068852_100478929 | 3300005616 | Bacteria | 1236 |
| 106 | Ga0068852_100529523 | 3300005616 | Bacteria | 1177 |
| 107 | Ga0068859_100012318 | 3300005617 | Bacteria | 8604 |
| 108 | Ga0068859_100030601 | 3300005617 | Bacteria | 5402 |
| 109 | Ga0068864_100138961 | 3300005618 | Bacteria | 2190 |
| 110 | Ga0068866_10041104 | 3300005718 | Bacteria | 2292 |
| 111 | Ga0068851_10018526 | 3300005834 | Bacteria | 3354 |
| 112 | Ga0068863_100542662 | 3300005841 | Bacteria | 1147 |
| 113 | Ga0068858_100052858 | 3300005842 | Bacteria | 3759 |
| 114 | Ga0068858_100072019 | 3300005842 | Bacteria | 3206 |
| 115 | Ga0068860_100001835 | 3300005843 | Bacteria | 22636 |
| 116 | Ga0068862_100115746 | 3300005844 | Bacteria | 2358 |
| 117 | Ga0081455_10092103 | 3300005937 | Bacteria | 2453 |
| 118 | Ga0070717_10027515 | 3300006028 | Bacteria | 4545 |
| 119 | Ga0070717_10030111 | 3300006028 | Bacteria | 4360 |
| 120 | Ga0070717_10222965 | 3300006028 | Bacteria | 1658 |
| 121 | Ga0070717_10317545 | 3300006028 | Bacteria | 1387 |
| 122 | Ga0070717_10327614 | 3300006028 | Bacteria | 1366 |
| 123 | Ga0070717_10373605 | 3300006028 | Bacteria | 1278 |
| 124 | Ga0070715_10001567 | 3300006163 | Bacteria | 6707 |
| 125 | Ga0070715_10012648 | 3300006163 | Bacteria | 3079 |
| 126 | Ga0070716_100026301 | 3300006173 | Bacteria | 3115 |
| 127 | Ga0070716_100115093 | 3300006173 | Bacteria | 1673 |
| 128 | Ga0070712_100000340 | 3300006175 | Bacteria | 26355 |
| 129 | Ga0070712_100002911 | 3300006175 | Bacteria | 10608 |
| 130 | Ga0070712_100009532 | 3300006175 | Bacteria | 6124 |
| 131 | Ga0070712_100073305 | 3300006175 | Bacteria | 2455 |
| 132 | Ga0070712_100107863 | 3300006175 | Bacteria | 2072 |
| 133 | Ga0097621_100000060 | 3300006237 | Bacteria | 56661 |
| 134 | Ga0097621_100001157 | 3300006237 | Bacteria | 18331 |
| 135 | Ga0097621_100040541 | 3300006237 | Bacteria | 3744 |
| 136 | Ga0097621_100078645 | 3300006237 | Bacteria | 2740 |
| 137 | Ga0097621_100356356 | 3300006237 | Bacteria | 1302 |
| 138 | Ga0068871_100000190 | 3300006358 | Bacteria | 41980 |
| 139 | Ga0068871_100004608 | 3300006358 | Bacteria | 9623 |
| 140 | Ga0068871_100012840 | 3300006358 | Bacteria | 6201 |
| 141 | Ga0068871_100014953 | 3300006358 | Bacteria | 5802 |
| 142 | Ga0068871_100021610 | 3300006358 | Unclassified | 4948 |
| 143 | Ga0068871_100093201 | 3300006358 | Bacteria | 2512 |
| 144 | Ga0068871_100275825 | 3300006358 | Bacteria | 1470 |
| 145 | Ga0075433_10022380 | 3300006852 | Bacteria | 5306 |
| 146 | Ga0068865_100104573 | 3300006881 | Bacteria | 2078 |
| 147 | Ga0075436_100008762 | 3300006914 | Bacteria | 6917 |
| 148 | Ga0097620_100012320 | 3300006931 | Bacteria | 8604 |
| 149 | Ga0097620_100030601 | 3300006931 | Bacteria | 5402 |
| 150 | Ga0105240_10000002 | 3300009093 | Bacteria | 1924170 |
| 151 | Ga0105240_10000213 | 3300009093 | Bacteria | 117084 |
| 152 | Ga0105240_10000683 | 3300009093 | Bacteria | 62430 |
| 153 | Ga0105240_10002547 | 3300009093 | Bacteria | 29224 |
| 154 | Ga0105240_10008749 | 3300009093 | Bacteria | 14433 |
| 155 | Ga0105240_10014750 | 3300009093 | Bacteria | 10660 |
| 156 | Ga0105240_10031044 | 3300009093 | Bacteria | 6934 |
| 157 | Ga0105240_10093628 | 3300009093 | Bacteria | 3667 |
| 158 | Ga0105240_10148738 | 3300009093 | Bacteria | 2791 |
| 159 | Ga0105240_10171859 | 3300009093 | Bacteria | 2566 |
| 160 | Ga0105240_10281083 | 3300009093 | Bacteria | 1912 |
| 161 | Ga0105240_10841802 | 3300009093 | Bacteria | 991 |
| 162 | Ga0105245_10004131 | 3300009098 | Bacteria | 12896 |
| 163 | Ga0105245_10025954 | 3300009098 | Bacteria | 5154 |
| 164 | Ga0105245_10051029 | 3300009098 | Bacteria | 3708 |
| 165 | Ga0105245_10511140 | 3300009098 | Bacteria | 1218 |
| 166 | Ga0105241_10000055 | 3300009174 | Bacteria | 86842 |
| 167 | Ga0105241_10000338 | 3300009174 | Bacteria | 35475 |
| 168 | Ga0105241_10007684 | 3300009174 | Bacteria | 7927 |
| 169 | Ga0105241_10049438 | 3300009174 | Bacteria | 3202 |
| 170 | Ga0105241_10202162 | 3300009174 | Bacteria | 1660 |
| 171 | Ga0105241_10292669 | 3300009174 | Bacteria | 1395 |
| 172 | Ga0105242_10441410 | 3300009176 | Bacteria | 1225 |
| 173 | Ga0105242_11233311 | 3300009176 | Bacteria | 768 |
| 174 | Ga0105248_10001001 | 3300009177 | Bacteria | 31244 |
| 175 | Ga0105248_10004472 | 3300009177 | Bacteria | 15471 |
| 176 | Ga0105248_10018174 | 3300009177 | Bacteria | 7764 |
| 177 | Ga0105248_10456599 | 3300009177 | Bacteria | 1440 |
| 178 | Ga0105248_10628240 | 3300009177 | Bacteria | 1212 |
| 179 | Ga0105248_11255223 | 3300009177 | Bacteria | 838 |
| 180 | Ga0105237_10043368 | 3300009545 | Bacteria | 4532 |
| 181 | Ga0105237_10124815 | 3300009545 | Bacteria | 2569 |
| 182 | Ga0105237_10174603 | 3300009545 | Bacteria | 2149 |
| 183 | Ga0105237_10175557 | 3300009545 | Bacteria | 2143 |
| 184 | Ga0105237_10182162 | 3300009545 | Bacteria | 2100 |
| 185 | Ga0105237_11105553 | 3300009545 | Bacteria | 799 |
| 186 | Ga0105238_10000352 | 3300009551 | Bacteria | 49426 |
| 187 | Ga0105238_10012644 | 3300009551 | Bacteria | 8519 |
| 188 | Ga0105238_10074609 | 3300009551 | Bacteria | 3384 |
| 189 | Ga0105238_10271324 | 3300009551 | Bacteria | 1677 |
| 190 | Ga0105249_10015382 | 3300009553 | Bacteria | 6771 |
| 191 | Ga0105249_10528645 | 3300009553 | Bacteria | 1228 |
| 192 | Ga0105239_10000375 | 3300010375 | Bacteria | 65248 |
| 193 | Ga0105239_10008308 | 3300010375 | Bacteria | 11833 |
| 194 | Ga0105239_10134156 | 3300010375 | Bacteria | 2755 |
| 195 | Ga0105239_10405556 | 3300010375 | Bacteria | 1543 |
| 196 | Ga0105239_11156770 | 3300010375 | Bacteria | 891 |
| 197 | Ga0157328_1003686 | 3300012478 | Bacteria | 814 |
| 198 | Ga0157318_1005835 | 3300012482 | Bacteria | 795 |
| 199 | Ga0157373_10003804 | 3300013100 | Bacteria | 11413 |
| 200 | Ga0157373_10119358 | 3300013100 | Bacteria | 1853 |
| 201 | Ga0157371_10061088 | 3300013102 | Bacteria | 2672 |
| 202 | Ga0157371_10363751 | 3300013102 | Bacteria | 1054 |
| 203 | Ga0157370_10000058 | 3300013104 | Bacteria | 117088 |
| 204 | Ga0157370_10173291 | 3300013104 | Bacteria | 2005 |
| 205 | Ga0157370_10210341 | 3300013104 | Bacteria | 1803 |
| 206 | Ga0157370_10544957 | 3300013104 | Bacteria | 1064 |
| 207 | Ga0157369_10000381 | 3300013105 | Bacteria | 58704 |
| 208 | Ga0157369_10003399 | 3300013105 | Bacteria | 18886 |
| 209 | Ga0157369_10005526 | 3300013105 | Bacteria | 14679 |
| 210 | Ga0157369_10006528 | 3300013105 | Bacteria | 13515 |
| 211 | Ga0157369_10024476 | 3300013105 | Bacteria | 6716 |
| 212 | Ga0157369_10029828 | 3300013105 | Bacteria | 6024 |
| 213 | Ga0157369_10039943 | 3300013105 | Bacteria | 5126 |
| 214 | Ga0157369_10173049 | 3300013105 | Bacteria | 2274 |
| 215 | Ga0157369_10412199 | 3300013105 | Bacteria | 1401 |
| 216 | Ga0157369_10444925 | 3300013105 | Bacteria | 1342 |
| 217 | Ga0157374_10000355 | 3300013296 | Bacteria | 42412 |
| 218 | Ga0157374_10000359 | 3300013296 | Bacteria | 42233 |
| 219 | Ga0157374_10006940 | 3300013296 | Bacteria | 9635 |
| 220 | Ga0157374_10015562 | 3300013296 | Bacteria | 6674 |
| 221 | Ga0157374_10108295 | 3300013296 | Bacteria | 2671 |
| 222 | Ga0157374_10449680 | 3300013296 | Bacteria | 1289 |
| 223 | Ga0157378_10000092 | 3300013297 | Bacteria | 85705 |
| 224 | Ga0157378_10021416 | 3300013297 | Bacteria | 5684 |
| 225 | Ga0157378_10073962 | 3300013297 | Bacteria | 3065 |
| 226 | Ga0157378_10188086 | 3300013297 | Bacteria | 1946 |
| 227 | Ga0163162_10004569 | 3300013306 | Bacteria | 13336 |
| 228 | Ga0157372_10000282 | 3300013307 | Bacteria | 56474 |
| 229 | Ga0157372_10000622 | 3300013307 | Bacteria | 38721 |
| 230 | Ga0157372_10001281 | 3300013307 | Bacteria | 27187 |
| 231 | Ga0157372_10011608 | 3300013307 | Bacteria | 9378 |
| 232 | Ga0157372_10032062 | 3300013307 | Bacteria | 5758 |
| 233 | Ga0157372_10058079 | 3300013307 | Bacteria | 4324 |
| 234 | Ga0157372_10082716 | 3300013307 | Bacteria | 3635 |
| 235 | Ga0157372_10100095 | 3300013307 | Bacteria | 3307 |
| 236 | Ga0157372_10129498 | 3300013307 | Bacteria | 2902 |
| 237 | Ga0157372_10169751 | 3300013307 | Bacteria | 2524 |
| 238 | Ga0157372_10223956 | 3300013307 | Bacteria | 2180 |
| 239 | Ga0157372_10620941 | 3300013307 | Bacteria | 1259 |
| 240 | Ga0157372_10832459 | 3300013307 | Bacteria | 1072 |
| 241 | Ga0157375_10049389 | 3300013308 | Bacteria | 4122 |
| 242 | Ga0157375_10364669 | 3300013308 | Bacteria | 1611 |
| 243 | Ga0163163_10015690 | 3300014325 | Bacteria | 7013 |
| 244 | Ga0163163_10092292 | 3300014325 | Bacteria | 3043 |
| 245 | Ga0163163_10110674 | 3300014325 | Bacteria | 2775 |
| 246 | Ga0182008_10024969 | 3300014497 | Bacteria | 3040 |
| 247 | Ga0157377_10049749 | 3300014745 | Bacteria | 2357 |
| 248 | Ga0157376_10054623 | 3300014969 | Bacteria | 3331 |
| 249 | Ga0157376_10118789 | 3300014969 | Bacteria | 2340 |
| 250 | Ga0182006_1037350 | 3300015261 | Bacteria | 1926 |
| 251 | Ga0163161_10026127 | 3300017792 | Bacteria | 4136 |
| 252 | Ga0224572_1006047 | 3300024225 | Bacteria | 2177 |
| 253 | Ga0228598_1000450 | 3300024227 | Bacteria | 8387 |
| 254 | Ga0228598_1007264 | 3300024227 | Bacteria | 2260 |
| 255 | Ga0209233_1020613 | 3300025261 | Bacteria | 1725 |
| 256 | Ga0207697_10010658 | 3300025315 | Bacteria | 3922 |
| 257 | Ga0207656_10104674 | 3300025321 | Bacteria | 1301 |
| 258 | Ga0207692_10081280 | 3300025898 | Bacteria | 1734 |
| 259 | Ga0207692_10421609 | 3300025898 | Bacteria | 836 |
| 260 | Ga0207680_10092685 | 3300025903 | Bacteria | 1925 |
| 261 | Ga0207647_10036189 | 3300025904 | Bacteria | 3138 |
| 262 | Ga0207699_10206531 | 3300025906 | Unclassified | 1334 |
| 263 | Ga0207705_10401801 | 3300025909 | Bacteria | 1060 |
| 264 | Ga0207654_10000027 | 3300025911 | Bacteria | 132519 |
| 265 | Ga0207654_10022696 | 3300025911 | Bacteria | 3352 |
| 266 | Ga0207654_10109197 | 3300025911 | Bacteria | 1718 |
| 267 | Ga0207654_10126544 | 3300025911 | Bacteria | 1612 |
| 268 | Ga0207654_10216082 | 3300025911 | Bacteria | 1269 |
| 269 | Ga0207654_10436412 | 3300025911 | Bacteria | 916 |
| 270 | Ga0207707_10001984 | 3300025912 | Bacteria | 18596 |
| 271 | Ga0207707_10028982 | 3300025912 | Bacteria | 4838 |
| 272 | Ga0207707_10171917 | 3300025912 | Bacteria | 1893 |
| 273 | Ga0207695_10000002 | 3300025913 | Bacteria | 2188391 |
| 274 | Ga0207695_10000108 | 3300025913 | Bacteria | 252306 |
| 275 | Ga0207695_10000191 | 3300025913 | Bacteria | 174087 |
| 276 | Ga0207695_10000345 | 3300025913 | Bacteria | 107062 |
| 277 | Ga0207695_10003674 | 3300025913 | Bacteria | 21393 |
| 278 | Ga0207695_10004974 | 3300025913 | Bacteria | 17893 |
| 279 | Ga0207695_10006642 | 3300025913 | Bacteria | 14932 |
| 280 | Ga0207695_10007323 | 3300025913 | Bacteria | 14091 |
| 281 | Ga0207695_10008737 | 3300025913 | Bacteria | 12632 |
| 282 | Ga0207695_10011641 | 3300025913 | Bacteria | 10632 |
| 283 | Ga0207695_10011737 | 3300025913 | Bacteria | 10580 |
| 284 | Ga0207695_10037748 | 3300025913 | Bacteria | 5210 |
| 285 | Ga0207695_10050035 | 3300025913 | Bacteria | 4399 |
| 286 | Ga0207695_10116776 | 3300025913 | Bacteria | 2642 |
| 287 | Ga0207695_10234074 | 3300025913 | Bacteria | 1740 |
| 288 | Ga0207695_10472848 | 3300025913 | Unclassified | 1136 |
| 289 | Ga0207695_10636787 | 3300025913 | Bacteria | 947 |
| 290 | Ga0207671_10051482 | 3300025914 | Bacteria | 3052 |
| 291 | Ga0207671_10111175 | 3300025914 | Bacteria | 2084 |
| 292 | Ga0207671_10175256 | 3300025914 | Bacteria | 1667 |
| 293 | Ga0207671_10207195 | 3300025914 | Bacteria | 1533 |
| 294 | Ga0207693_10000182 | 3300025915 | Bacteria | 57166 |
| 295 | Ga0207693_10003469 | 3300025915 | Bacteria | 13455 |
| 296 | Ga0207693_10005077 | 3300025915 | Bacteria | 11041 |
| 297 | Ga0207693_10010767 | 3300025915 | Bacteria | 7425 |
| 298 | Ga0207693_10081981 | 3300025915 | Bacteria | 2526 |
| 299 | Ga0207663_10002131 | 3300025916 | Bacteria | 9442 |
| 300 | Ga0207663_10033331 | 3300025916 | Bacteria | 3068 |
| 301 | Ga0207663_10116830 | 3300025916 | Bacteria | 1819 |
| 302 | Ga0207660_10214837 | 3300025917 | Bacteria | 1507 |
| 303 | Ga0207662_10008307 | 3300025918 | Bacteria | 5684 |
| 304 | Ga0207657_10004189 | 3300025919 | Bacteria | 15285 |
| 305 | Ga0207649_10458610 | 3300025920 | Bacteria | 963 |
| 306 | Ga0207652_10007447 | 3300025921 | Bacteria | 8820 |
| 307 | Ga0207652_10008176 | 3300025921 | Bacteria | 8401 |
| 308 | Ga0207652_10113121 | 3300025921 | Bacteria | 2409 |
| 309 | Ga0207652_10214149 | 3300025921 | Bacteria | 1735 |
| 310 | Ga0207646_10614531 | 3300025922 | Bacteria | 975 |
| 311 | Ga0207694_10000160 | 3300025924 | Bacteria | 68770 |
| 312 | Ga0207694_10000380 | 3300025924 | Bacteria | 41390 |
| 313 | Ga0207694_10001976 | 3300025924 | Bacteria | 16968 |
| 314 | Ga0207694_10103208 | 3300025924 | Bacteria | 2261 |
| 315 | Ga0207694_10130475 | 3300025924 | Bacteria | 2014 |
| 316 | Ga0207694_10202570 | 3300025924 | Bacteria | 1615 |
| 317 | Ga0207694_10385172 | 3300025924 | Bacteria | 1164 |
| 318 | Ga0207650_10000646 | 3300025925 | Bacteria | 27701 |
| 319 | Ga0207687_10002812 | 3300025927 | Bacteria | 11803 |
| 320 | Ga0207687_10047561 | 3300025927 | Bacteria | 2974 |
| 321 | Ga0207687_10670123 | 3300025927 | Bacteria | 879 |
| 322 | Ga0207700_10001771 | 3300025928 | Bacteria | 12242 |
| 323 | Ga0207700_10001960 | 3300025928 | Bacteria | 11710 |
| 324 | Ga0207700_10014215 | 3300025928 | Bacteria | 5209 |
| 325 | Ga0207700_10029540 | 3300025928 | Unclassified | 3869 |
| 326 | Ga0207700_10215535 | 3300025928 | Unclassified | 1625 |
| 327 | Ga0207700_10550893 | 3300025928 | Bacteria | 1024 |
| 328 | Ga0207700_10578386 | 3300025928 | Bacteria | 999 |
| 329 | Ga0207664_10000087 | 3300025929 | Bacteria | 88607 |
| 330 | Ga0207664_10011722 | 3300025929 | Bacteria | 6247 |
| 331 | Ga0207664_10019681 | 3300025929 | Bacteria | 4994 |
| 332 | Ga0207664_10089269 | 3300025929 | Bacteria | 2524 |
| 333 | Ga0207664_10532058 | 3300025929 | Bacteria | 1054 |
| 334 | Ga0207644_10011846 | 3300025931 | Bacteria | 5778 |
| 335 | Ga0207644_10106095 | 3300025931 | Bacteria | 2117 |
| 336 | Ga0207644_10814938 | 3300025931 | Bacteria | 781 |
| 337 | Ga0207690_10164848 | 3300025932 | Bacteria | 1655 |
| 338 | Ga0207690_10207049 | 3300025932 | Bacteria | 1493 |
| 339 | Ga0207670_10275551 | 3300025936 | Bacteria | 1309 |
| 340 | Ga0207665_10019839 | 3300025939 | Bacteria | 4418 |
| 341 | Ga0207711_10000859 | 3300025941 | Bacteria | 29394 |
| 342 | Ga0207711_10008695 | 3300025941 | Bacteria | 8495 |
| 343 | Ga0207711_10108839 | 3300025941 | Bacteria | 2462 |
| 344 | Ga0207661_10061674 | 3300025944 | Bacteria | 3030 |
| 345 | Ga0207661_10194615 | 3300025944 | Unclassified | 1779 |
| 346 | Ga0207661_10291723 | 3300025944 | Bacteria | 1460 |
| 347 | Ga0207679_10072043 | 3300025945 | Bacteria | 2609 |
| 348 | Ga0207679_10132082 | 3300025945 | Bacteria | 2005 |
| 349 | Ga0207667_10000377 | 3300025949 | Bacteria | 60367 |
| 350 | Ga0207667_10000541 | 3300025949 | Bacteria | 49932 |
| 351 | Ga0207667_10002508 | 3300025949 | Bacteria | 22889 |
| 352 | Ga0207667_10005182 | 3300025949 | Bacteria | 15920 |
| 353 | Ga0207667_10005696 | 3300025949 | Bacteria | 15191 |
| 354 | Ga0207667_10026110 | 3300025949 | Bacteria | 6386 |
| 355 | Ga0207667_10037489 | 3300025949 | Bacteria | 5181 |
| 356 | Ga0207667_10074069 | 3300025949 | Bacteria | 3537 |
| 357 | Ga0207667_10527768 | 3300025949 | Bacteria | 1195 |
| 358 | Ga0207712_10006856 | 3300025961 | Bacteria | 7191 |
| 359 | Ga0207668_10004431 | 3300025972 | Bacteria | 8246 |
| 360 | Ga0207640_10230126 | 3300025981 | Bacteria | 1425 |
| 361 | Ga0207640_10243147 | 3300025981 | Bacteria | 1392 |
| 362 | Ga0207658_10473736 | 3300025986 | Bacteria | 1112 |
| 363 | Ga0207677_10014728 | 3300026023 | Bacteria | 4578 |
| 364 | Ga0207677_10015197 | 3300026023 | Bacteria | 4519 |
| 365 | Ga0207677_10025642 | 3300026023 | Bacteria | 3681 |
| 366 | Ga0207677_10030966 | 3300026023 | Bacteria | 3422 |
| 367 | Ga0207703_10028925 | 3300026035 | Bacteria | 4374 |
| 368 | Ga0207703_10069711 | 3300026035 | Bacteria | 2900 |
| 369 | Ga0207639_10000145 | 3300026041 | Bacteria | 53212 |
| 370 | Ga0207639_10022054 | 3300026041 | Bacteria | 4583 |
| 371 | Ga0207639_10121907 | 3300026041 | Bacteria | 2144 |
| 372 | Ga0207639_10253394 | 3300026041 | Bacteria | 1536 |
| 373 | Ga0207639_11173652 | 3300026041 | Bacteria | 720 |
| 374 | Ga0207678_10083540 | 3300026067 | Bacteria | 2731 |
| 375 | Ga0207702_10000175 | 3300026078 | Bacteria | 77336 |
| 376 | Ga0207702_10000561 | 3300026078 | Bacteria | 41319 |
| 377 | Ga0207702_10000583 | 3300026078 | Bacteria | 40507 |
| 378 | Ga0207702_10009227 | 3300026078 | Bacteria | 8292 |
| 379 | Ga0207702_10049937 | 3300026078 | Bacteria | 3531 |
| 380 | Ga0207702_10277235 | 3300026078 | Bacteria | 1584 |
| 381 | Ga0207702_10297313 | 3300026078 | Bacteria | 1531 |
| 382 | Ga0207702_10323065 | 3300026078 | Bacteria | 1470 |
| 383 | Ga0207702_10696498 | 3300026078 | Bacteria | 1001 |
| 384 | Ga0207641_10000021 | 3300026088 | Bacteria | 279851 |
| 385 | Ga0207641_10114978 | 3300026088 | Bacteria | 2392 |
| 386 | Ga0207641_10204079 | 3300026088 | Bacteria | 1824 |
| 387 | Ga0207648_10049988 | 3300026089 | Bacteria | 3657 |
| 388 | Ga0207676_10000518 | 3300026095 | Bacteria | 32418 |
| 389 | Ga0207676_10161373 | 3300026095 | Bacteria | 1942 |
| 390 | Ga0207674_10010667 | 3300026116 | Bacteria | 10390 |
| 391 | Ga0207698_10000070 | 3300026142 | Bacteria | 68316 |
| 392 | Ga0207698_10016707 | 3300026142 | Bacteria | 4956 |
| 393 | Ga0207698_10232460 | 3300026142 | Bacteria | 1675 |
| 394 | Ga0207698_10242551 | 3300026142 | Bacteria | 1643 |
| 395 | Ga0207698_10378255 | 3300026142 | Bacteria | 1346 |
| 396 | Ga0209179_1059039 | 3300027512 | Bacteria | 831 |
| 397 | Ga0265356_1000510 | 3300028017 | Bacteria | 7028 |
| 398 | Ga0265357_1003443 | 3300028023 | Bacteria | 1372 |
| 399 | Ga0268266_10001930 | 3300028379 | Bacteria | 23319 |
| 400 | Ga0268266_10003145 | 3300028379 | Bacteria | 16767 |
| 401 | Ga0268266_10050140 | 3300028379 | Bacteria | 3581 |
| 402 | Ga0268266_10072994 | 3300028379 | Bacteria | 2977 |
| 403 | Ga0268266_10165283 | 3300028379 | Bacteria | 2004 |
| 404 | Ga0268266_10571379 | 3300028379 | Bacteria | 1084 |
| 405 | Ga0268266_10888826 | 3300028379 | Bacteria | 861 |
| 406 | Ga0268265_10108992 | 3300028380 | Bacteria | 2256 |
| 407 | Ga0268264_10006325 | 3300028381 | Bacteria | 9983 |
| 408 | Ga0268264_10036874 | 3300028381 | Bacteria | 4029 |
| 409 | Ga0265326_10033438 | 3300028558 | Bacteria | 1463 |
| 410 | Ga0265338_10001846 | 3300028800 | Bacteria | 33258 |
| 411 | Ga0265338_10054622 | 3300028800 | Unclassified | 3559 |
| 412 | Ga0265338_10111851 | 3300028800 | Bacteria | 2197 |
| 413 | Ga0265338_10126385 | 3300028800 | Bacteria | 2028 |
| 414 | Ga0265338_10150625 | 3300028800 | Bacteria | 1808 |
| 415 | Ga0265763_1001508 | 3300030763 | Bacteria | 1675 |
| 416 | Ga0265330_10004432 | 3300031235 | Bacteria | 7128 |
| 417 | Ga0265330_10169623 | 3300031235 | Bacteria | 926 |
| 418 | Ga0265340_10009761 | 3300031247 | Bacteria | 5145 |
| 419 | Ga0265340_10051251 | 3300031247 | Bacteria | 1999 |
| 420 | Ga0265340_10368601 | 3300031247 | Bacteria | 634 |
| 421 | Ga0265339_10000214 | 3300031249 | Bacteria | 47430 |
| 422 | Ga0265339_10002593 | 3300031249 | Bacteria | 12899 |
| 423 | Ga0265339_10027784 | 3300031249 | Bacteria | 3223 |
| 424 | Ga0265316_10007178 | 3300031344 | Bacteria | 10527 |
| 425 | Ga0265316_10572490 | 3300031344 | Bacteria | 802 |
| 426 | Ga0265313_10038907 | 3300031595 | Bacteria | 2364 |
| 427 | Ga0265314_10002820 | 3300031711 | Bacteria | 17337 |
| 428 | Ga0265314_10034888 | 3300031711 | Bacteria | 3671 |
| 429 | Ga0265314_10144950 | 3300031711 | Bacteria | 1464 |
| 430 | Ga0265314_10264902 | 3300031711 | Bacteria | 979 |
| 431 | Ga0265314_10294734 | 3300031711 | Bacteria | 912 |
| 432 | Ga0265342_10000979 | 3300031712 | Bacteria | 28284 |
| 433 | Ga0265342_10050049 | 3300031712 | Bacteria | 2498 |
| 434 | Ga0265342_10084011 | 3300031712 | Bacteria | 1834 |
| 435 | Ga0265342_10096345 | 3300031712 | Bacteria | 1691 |
| 436 | Ga0307510_10036230 | 3300033180 | Bacteria | 5494 |
| 437 | Ga0307510_10064651 | 3300033180 | Bacteria | 3714 |
| 438 | Ga0316213_1003734 | 3300033546 | Bacteria | 1007 |
| 439 | Ga0316212_1002904 | 3300033547 | Bacteria | 2460 |
| 440 | Ga0373928_0074654 | 3300035084 | Bacteria | 845 |
| 441 | Ga0373934_0030138 | 3300035086 | Bacteria | 2121 |
| 442 | Ga0373923_0189539 | 3300035111 | Bacteria | 947 |
| 443 | Ga0373936_0008282 | 3300035113 | Bacteria | 3909 |
| 444 | Ga0373941_0090618 | 3300035115 | Bacteria | 1048 |
| 445 | Ga0373945_0003446 | 3300035116 | Bacteria | 4974 |
| 446 | Ga0373943_0002800 | 3300035170 | Bacteria | 7927 |
| 447 | Ga0373943_0100598 | 3300035170 | Bacteria | 1511 |
| 448 | Ga0373946_0029158 | 3300035171 | Bacteria | 2194 |
| 449 | Ga0373955_0102027 | 3300035172 | Bacteria | 1648 |
| 450 | Ga0373962_0192348 | 3300035242 | Bacteria | 687 |
| 451 | Ga0373931_0037689 | 3300035691 | Bacteria | 2524 |
| 452 | Ga0373935_0015243 | 3300035692 | Bacteria | 4644 |
| 453 | Ga0373935_0113767 | 3300035692 | Bacteria | 1799 |
| 454 | Ga0373927_0010054 | 3300035695 | Bacteria | 6334 |
| 455 | Ga0373927_0022049 | 3300035695 | Bacteria | 4174 |
| 456 | Ga0373927_0472480 | 3300035695 | Bacteria | 828 |
| 457 | Ga0373933_0019579 | 3300035724 | Bacteria | 3824 |
| 458 | Ga0373933_0041075 | 3300035724 | Bacteria | 2729 |
| 459 | Ga0373933_0046964 | 3300035724 | Bacteria | 2566 |
| 460 | Ga0373947_0003669 | 3300035725 | Bacteria | 9058 |
| 461 | Ga0373947_0009334 | 3300035725 | Bacteria | 5637 |
| 462 | Ga0373947_0036081 | 3300035725 | Bacteria | 2930 |
| 463 | Ga0373947_0192283 | 3300035725 | Bacteria | 1332 |
| 464 | Ga0373947_0425614 | 3300035725 | Bacteria | 897 |
| 465 | Ga0373937_0097862 | 3300036401 | Bacteria | 2721 |
| 466 | Ga0373937_0119299 | 3300036401 | Bacteria | 2457 |
| 467 | Ga0373937_0438269 | 3300036401 | Bacteria | 1240 |
| 468 | Ga0373937_0988024 | 3300036401 | Bacteria | 790 |
| 469 | Ga0373925_0002473 | 3300037068 | Bacteria | 14771 |
| 470 | Ga0373925_0026308 | 3300037068 | Bacteria | 4258 |
| 471 | Ga0373925_0069717 | 3300037068 | Bacteria | 2656 |
| 472 | Ga0373925_0072838 | 3300037068 | Bacteria | 2599 |
| 473 | Ga0373925_0127488 | 3300037068 | Bacteria | 1981 |
| 474 | Ga0395898_0137829 | 3300037466 | Bacteria | 2336 |
| 475 | Ga0436364_0176799 | 3300037853 | Bacteria | 1091 |
| 476 | Ga0436360_1073532 | 3300039438 | Bacteria | 729 |
| 477 | Ga0436362_0325737 | 3300039453 | Bacteria | 1032 |
| 478 | Ga0436362_0698378 | 3300039453 | Bacteria | 907 |
| 479 | Ga0451577_0030308 | 3300042876 | Bacteria | 4888 |
| 480 | Ga0466961_0073960 | 3300044693 | Bacteria | 2161 |
| 481 | Ga0453684_0567019 | 3300044712 | Bacteria | 1248 |
| 482 | Ga0466957_0165821 | 3300044842 | Bacteria | 1437 |
| 483 | Ga0466958_0088139 | 3300045836 | Bacteria | 1917 |
| 484 | Ga0466958_0485978 | 3300045836 | Bacteria | 801 |
| 485 | Ga0466967_0004914 | 3300045976 | Bacteria | 9135 |
| 486 | Ga0495603_0157041 | 3300046455 | Bacteria | 1320 |
| 487 | Ga0495638_0459686 | 3300046460 | Bacteria | 648 |
| 488 | Ga0495650_0000037 | 3300046471 | Bacteria | 390090 |
| 489 | Ga0495580_0016785 | 3300046472 | Bacteria | 5493 |
| 490 | Ga0495580_0022128 | 3300046472 | Bacteria | 4683 |
| 491 | Ga0495580_0134650 | 3300046472 | Bacteria | 1713 |
| 492 | Ga0495580_0294210 | 3300046472 | Bacteria | 1106 |
| 493 | Ga0495582_0007999 | 3300046473 | Bacteria | 5840 |
| 494 | Ga0495664_0031494 | 3300046477 | Bacteria | 3110 |
| 495 | Ga0495664_0307225 | 3300046477 | Bacteria | 957 |
| 496 | Ga0495628_0187436 | 3300046516 | Bacteria | 1563 |
| 497 | Ga0495628_0229236 | 3300046516 | Bacteria | 1393 |
| 498 | Ga0495630_0174937 | 3300046517 | Bacteria | 1636 |
| 499 | Ga0495630_0262137 | 3300046517 | Bacteria | 1320 |
| 500 | Ga0495643_0205784 | 3300046522 | Bacteria | 942 |
| 501 | Ga0495642_0115027 | 3300046528 | Bacteria | 1152 |
| 502 | Ga0495652_0063290 | 3300046529 | Bacteria | 3115 |
| 503 | Ga0495665_0063330 | 3300046531 | Bacteria | 1952 |
| 504 | Ga0495640_0468915 | 3300046533 | Bacteria | 768 |
| 505 | Ga0495645_0058556 | 3300046543 | Bacteria | 2795 |
| 506 | Ga0495645_0301373 | 3300046543 | Bacteria | 1047 |
| 507 | Ga0495622_0243692 | 3300046557 | Bacteria | 792 |
| 508 | Ga0495635_0247268 | 3300046663 | Bacteria | 1203 |
| 509 | Ga0495599_0038192 | 3300046678 | Bacteria | 3017 |
| 510 | Ga0495623_0096380 | 3300046679 | Bacteria | 1808 |
| 511 | Ga0495623_0149655 | 3300046679 | Bacteria | 1381 |
| 512 | Ga0495658_0047416 | 3300046683 | Bacteria | 2420 |
| 513 | Ga0495613_0036282 | 3300046689 | Bacteria | 3656 |
| 514 | Ga0495613_0136057 | 3300046689 | Bacteria | 1758 |
| 515 | Ga0495613_0213931 | 3300046689 | Bacteria | 1355 |
| 516 | Ga0495613_0404221 | 3300046689 | Bacteria | 931 |
| 517 | Ga0495624_0095541 | 3300046690 | Bacteria | 1832 |
| 518 | Ga0495581_0068294 | 3300047315 | Unclassified | 2055 |
| 519 | Ga0495604_0041478 | 3300047317 | Bacteria | 3610 |
| 520 | Ga0495604_0171537 | 3300047317 | Bacteria | 1525 |
| 521 | Ga0495604_0232699 | 3300047317 | Bacteria | 1263 |
| 522 | Ga0495674_0038308 | 3300047319 | Bacteria | 4304 |
| 523 | Ga0495674_0039914 | 3300047319 | Bacteria | 4203 |
| 524 | Ga0495675_0010036 | 3300047444 | Bacteria | 5907 |
| 525 | Ga0495677_0114965 | 3300047445 | Bacteria | 1024 |
| 526 | Ga0495684_0250216 | 3300047471 | Bacteria | 1290 |
| 527 | Ga0495686_0003149 | 3300047472 | Bacteria | 14557 |
| 528 | Ga0495686_0005279 | 3300047472 | Bacteria | 10252 |
| 529 | Ga0495614_0315535 | 3300048089 | Bacteria | 724 |
| 530 | Ga0496100_0038390 | 3300048903 | Bacteria | 3034 |
| 531 | Ga0496101_0008468 | 3300048904 | Bacteria | 6720 |
| 532 | Ga0496103_0091131 | 3300048906 | Bacteria | 1924 |
| 533 | Ga0496104_0022458 | 3300048907 | Bacteria | 5797 |
| 534 | Ga0496104_0035730 | 3300048907 | Bacteria | 4641 |
| 535 | Ga0496104_0221087 | 3300048907 | Bacteria | 1806 |
| 536 | Ga0496104_0293923 | 3300048907 | Unclassified | 1537 |
| 537 | Ga0496104_0390569 | 3300048907 | Bacteria | 1304 |
| 538 | Ga0496104_0451345 | 3300048907 | Bacteria | 1197 |
| 539 | Ga0496105_0217857 | 3300048908 | Bacteria | 1554 |
| 540 | Ga0496107_0165218 | 3300048910 | Bacteria | 1641 |
| 541 | Ga0496109_0374465 | 3300048912 | Bacteria | 1345 |
| 542 | Ga0496111_0004189 | 3300048914 | Bacteria | 9075 |
| 543 | Ga0496112_0000053 | 3300048915 | Bacteria | 79985 |
| 544 | Ga0496112_0002677 | 3300048915 | Bacteria | 14405 |
| 545 | Ga0496112_0041254 | 3300048915 | Bacteria | 4514 |
| 546 | Ga0496112_0071931 | 3300048915 | Bacteria | 3418 |
| 547 | Ga0496112_0115473 | 3300048915 | Bacteria | 2655 |
| 548 | Ga0496112_0787109 | 3300048915 | Bacteria | 876 |
| 549 | Ga0496113_0000907 | 3300048916 | Bacteria | 15648 |
| 550 | Ga0496113_0025323 | 3300048916 | Bacteria | 4228 |
| 551 | Ga0496114_0006722 | 3300048917 | Bacteria | 9061 |
| 552 | Ga0496114_0139469 | 3300048917 | Bacteria | 2098 |
| 553 | Ga0496115_0013978 | 3300048918 | Bacteria | 6076 |
| 554 | Ga0496115_0248589 | 3300048918 | Bacteria | 1465 |
| 555 | Ga0496126_0001110 | 3300048929 | Bacteria | 45105 |
| 556 | Ga0496126_0016479 | 3300048929 | Bacteria | 7386 |
| 557 | Ga0501032_0156464 | 3300049569 | Bacteria | 1497 |
| 558 | Ga0501033_0357396 | 3300049570 | Bacteria | 1022 |
| 559 | Ga0501034_0323325 | 3300049571 | Bacteria | 1475 |
| 560 | Ga0501036_0163829 | 3300049572 | Bacteria | 1874 |
| 561 | Ga0501037_0207923 | 3300049573 | Bacteria | 1381 |
| 562 | Ga0501043_0142786 | 3300049579 | Bacteria | 1874 |
| 563 | Ga0501047_0102299 | 3300049581 | Bacteria | 2744 |
| 564 | Ga0501073_0197651 | 3300049589 | Bacteria | 1391 |
| 565 | Ga0501080_0360705 | 3300049742 | Bacteria | 1311 |
| 566 | Ga0501044_0000314 | 3300049823 | Bacteria | 61262 |
| 567 | Ga0501044_0110697 | 3300049823 | Bacteria | 2754 |
| 568 | nmdc:mga08x19_3469_c1 | 3300050514 | Bacteria | 9399 |
| 569 | Ga0495612_0133302 | 3300053078 | Bacteria | 1074 |
| 570 | Ga0495619_0311402 | 3300053085 | Bacteria | 1090 |
| 571 | Ga0501084_0701432 | 3300054114 | Bacteria | 853 |
| 572 | Ga0500661_016817 | 3300055283 | Bacteria | 1307 |
| 573 | Ga0500661_036370 | 3300055283 | Bacteria | 871 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300035725 | Ga0373947_0009334 | Ga0373947_0009334_5037_5627 | 181 |
| 2 | 3300037068 | Ga0373925_0069717 | Ga0373925_0069717_314_904 | 181 |
| 3 | 3300046517 | Ga0495630_0262137 | Ga0495630_0262137_88_678 | 181 |
| 4 | 3300028379 | Ga0268266_10003145 | Ga0268266_100031458 | 187 |
| 5 | 3300031249 | Ga0265339_10000214 | Ga0265339_1000021420 | 189 |
| 6 | 3300031712 | Ga0265342_10000979 | Ga0265342_100009796 | 189 |
| 7 | iso_pu_bacteria | 2884215851 | 2884219363 | 192 |
| 8 | 3300014497 | Ga0182008_10024969 | Ga0182008_100249692 | 195 |
| 9 | 3300015261 | Ga0182006_1037350 | Ga0182006_10373502 | 195 |
| 10 | 3300003320 | rootH2_10047366 | rootH2_100473662 | 196 |
| 11 | 3300005530 | Ga0070679_100413891 | Ga0070679_1004138912 | 196 |
| 12 | 3300005563 | Ga0068855_100338191 | Ga0068855_1003381913 | 196 |
| 13 | 3300005616 | Ga0068852_100529523 | Ga0068852_1005295232 | 196 |
| 14 | 3300010375 | Ga0105239_11156770 | Ga0105239_111567701 | 196 |
| 15 | 3300013307 | Ga0157372_10129498 | Ga0157372_101294985 | 196 |
| 16 | 3300025920 | Ga0207649_10458610 | Ga0207649_104586102 | 196 |
| 17 | 3300025924 | Ga0207694_10385172 | Ga0207694_103851722 | 196 |
| 18 | 3300025932 | Ga0207690_10164848 | Ga0207690_101648482 | 196 |
| 19 | 3300025949 | Ga0207667_10527768 | Ga0207667_105277681 | 196 |
| 20 | 3300026142 | Ga0207698_10232460 | Ga0207698_102324602 | 196 |
| 21 | 3300031711 | Ga0265314_10144950 | Ga0265314_101449502 | 196 |
| 22 | 3300033180 | Ga0307510_10036230 | Ga0307510_100362306 | 196 |
| 23 | 3300042876 | Ga0451577_0030308 | Ga0451577_0030308_219_842 | 196 |
| 24 | 3300044712 | Ga0453684_0567019 | Ga0453684_0567019_26_649 | 196 |
| 25 | 3300046460 | Ga0495638_0459686 | Ga0495638_0459686_11_601 | 196 |
| 26 | 3300047315 | Ga0495581_0068294 | Ga0495581_0068294_745_1419 | 196 |
| 27 | 3300047317 | Ga0495604_0232699 | Ga0495604_0232699_183_779 | 196 |
| 28 | 3300047472 | Ga0495686_0003149 | Ga0495686_0003149_4662_5252 | 196 |
| 29 | 3300048929 | Ga0496126_0001110 | Ga0496126_0001110_13361_13951 | 196 |
| 30 | 3300055283 | Ga0500661_016817 | Ga0500661_016817_608_1198 | 196 |
| 31 | 3300009093 | Ga0105240_10000002 | Ga0105240_100000021294 | 197 |
| 32 | 3300013307 | Ga0157372_10032062 | Ga0157372_100320622 | 197 |
| 33 | 3300025913 | Ga0207695_10000002 | Ga0207695_100000021297 | 197 |
| 34 | 3300025929 | Ga0207664_10532058 | Ga0207664_105320581 | 197 |
| 35 | 3300003322 | rootL2_10149945 | rootL2_101499453 | 198 |
| 36 | 3300005539 | Ga0068853_100008705 | Ga0068853_1000087059 | 198 |
| 37 | 3300005937 | Ga0081455_10092103 | Ga0081455_100921034 | 198 |
| 38 | 3300006358 | Ga0068871_100275825 | Ga0068871_1002758251 | 198 |
| 39 | 3300013105 | Ga0157369_10005526 | Ga0157369_100055267 | 198 |
| 40 | 3300013307 | Ga0157372_10169751 | Ga0157372_101697513 | 198 |
| 41 | 3300025945 | Ga0207679_10072043 | Ga0207679_100720433 | 198 |
| 42 | 3300026041 | Ga0207639_10022054 | Ga0207639_100220542 | 198 |
| 43 | 3300026142 | Ga0207698_10378255 | Ga0207698_103782551 | 198 |
| 44 | 3300028379 | Ga0268266_10001930 | Ga0268266_1000193013 | 198 |
| 45 | 3300031247 | Ga0265340_10368601 | Ga0265340_103686011 | 198 |
| 46 | 3300033180 | Ga0307510_10064651 | Ga0307510_100646516 | 198 |
| 47 | 3300035170 | Ga0373943_0100598 | Ga0373943_0100598_390_1055 | 198 |
| 48 | 3300035725 | Ga0373947_0425614 | Ga0373947_0425614_244_846 | 198 |
| 49 | 3300037068 | Ga0373925_0026308 | Ga0373925_0026308_1570_2172 | 198 |
| 50 | 3300046471 | Ga0495650_0000037 | Ga0495650_0000037_29397_29999 | 198 |
| 51 | 3300046689 | Ga0495613_0036282 | Ga0495613_0036282_2620_3285 | 198 |
| 52 | 3300046689 | Ga0495613_0213931 | Ga0495613_0213931_50_736 | 198 |
| 53 | 3300047472 | Ga0495686_0005279 | Ga0495686_0005279_5956_6555 | 198 |
| 54 | 3300048907 | Ga0496104_0221087 | Ga0496104_0221087_731_1327 | 198 |
| 55 | 3300048910 | Ga0496107_0165218 | Ga0496107_0165218_909_1595 | 198 |
| 56 | 3300048917 | Ga0496114_0139469 | Ga0496114_0139469_272_868 | 198 |
| 57 | 3300055283 | Ga0500661_036370 | Ga0500661_036370_244_840 | 198 |
| 58 | 3300005355 | Ga0070671_100919794 | Ga0070671_1009197942 | 199 |
| 59 | 3300005436 | Ga0070713_100349325 | Ga0070713_1003493252 | 199 |
| 60 | 3300005548 | Ga0070665_100264736 | Ga0070665_1002647363 | 199 |
| 61 | 3300005564 | Ga0070664_101102190 | Ga0070664_1011021901 | 199 |
| 62 | 3300005578 | Ga0068854_100699788 | Ga0068854_1006997881 | 199 |
| 63 | 3300005614 | Ga0068856_100494149 | Ga0068856_1004941492 | 199 |
| 64 | 3300005616 | Ga0068852_100210657 | Ga0068852_1002106572 | 199 |
| 65 | 3300009093 | Ga0105240_10841802 | Ga0105240_108418021 | 199 |
| 66 | 3300009545 | Ga0105237_10174603 | Ga0105237_101746032 | 199 |
| 67 | 3300009553 | Ga0105249_10528645 | Ga0105249_105286452 | 199 |
| 68 | 3300013104 | Ga0157370_10173291 | Ga0157370_101732912 | 199 |
| 69 | 3300013105 | Ga0157369_10029828 | Ga0157369_100298282 | 199 |
| 70 | 3300013307 | Ga0157372_10620941 | Ga0157372_106209412 | 199 |
| 71 | 3300014325 | Ga0163163_10110674 | Ga0163163_101106743 | 199 |
| 72 | 3300025913 | Ga0207695_10011641 | Ga0207695_100116416 | 199 |
| 73 | 3300025915 | Ga0207693_10005077 | Ga0207693_100050774 | 199 |
| 74 | 3300025928 | Ga0207700_10029540 | Ga0207700_100295403 | 199 |
| 75 | 3300025931 | Ga0207644_10814938 | Ga0207644_108149381 | 199 |
| 76 | 3300025981 | Ga0207640_10230126 | Ga0207640_102301262 | 199 |
| 77 | 3300026041 | Ga0207639_10121907 | Ga0207639_101219073 | 199 |
| 78 | 3300026078 | Ga0207702_10696498 | Ga0207702_106964981 | 199 |
| 79 | 3300026142 | Ga0207698_10242551 | Ga0207698_102425511 | 199 |
| 80 | 3300028379 | Ga0268266_10165283 | Ga0268266_101652833 | 199 |
| 81 | 3300048907 | Ga0496104_0035730 | Ga0496104_0035730_187_786 | 199 |
| 82 | 3300048915 | Ga0496112_0041254 | Ga0496112_0041254_291_890 | 199 |
| 83 | 3300048916 | Ga0496113_0025323 | Ga0496113_0025323_431_1030 | 199 |
| 84 | 3300005337 | Ga0070682_100138802 | Ga0070682_1001388022 | 200 |
| 85 | 3300005338 | Ga0068868_100026776 | Ga0068868_1000267766 | 200 |
| 86 | 3300005341 | Ga0070691_10315941 | Ga0070691_103159411 | 200 |
| 87 | 3300005344 | Ga0070661_100160316 | Ga0070661_1001603162 | 200 |
| 88 | 3300005347 | Ga0070668_100166168 | Ga0070668_1001661682 | 200 |
| 89 | 3300005365 | Ga0070688_100247663 | Ga0070688_1002476631 | 200 |
| 90 | 3300005434 | Ga0070709_10185312 | Ga0070709_101853122 | 200 |
| 91 | 3300005434 | Ga0070709_10264171 | Ga0070709_102641712 | 200 |
| 92 | 3300005435 | Ga0070714_100000096 | Ga0070714_10000009610 | 200 |
| 93 | 3300005435 | Ga0070714_100420921 | Ga0070714_1004209212 | 200 |
| 94 | 3300005436 | Ga0070713_100002562 | Ga0070713_1000025625 | 200 |
| 95 | 3300005436 | Ga0070713_100004256 | Ga0070713_1000042562 | 200 |
| 96 | 3300005437 | Ga0070710_10002286 | Ga0070710_100022862 | 200 |
| 97 | 3300005438 | Ga0070701_10265072 | Ga0070701_102650721 | 200 |
| 98 | 3300005439 | Ga0070711_100006210 | Ga0070711_1000062105 | 200 |
| 99 | 3300005458 | Ga0070681_10000147 | Ga0070681_1000014728 | 200 |
| 100 | 3300005458 | Ga0070681_10051723 | Ga0070681_100517233 | 200 |
| 101 | 3300005530 | Ga0070679_100006558 | Ga0070679_1000065584 | 200 |
| 102 | 3300005530 | Ga0070679_100045430 | Ga0070679_1000454304 | 200 |
| 103 | 3300005530 | Ga0070679_100179066 | Ga0070679_1001790663 | 200 |
| 104 | 3300005535 | Ga0070684_100048222 | Ga0070684_1000482223 | 200 |
| 105 | 3300005539 | Ga0068853_100007558 | Ga0068853_1000075581 | 200 |
| 106 | 3300005546 | Ga0070696_100360270 | Ga0070696_1003602701 | 200 |
| 107 | 3300005547 | Ga0070693_100120020 | Ga0070693_1001200202 | 200 |
| 108 | 3300005563 | Ga0068855_100064251 | Ga0068855_1000642512 | 200 |
| 109 | 3300005563 | Ga0068855_100082596 | Ga0068855_1000825962 | 200 |
| 110 | 3300005563 | Ga0068855_100202444 | Ga0068855_1002024442 | 200 |
| 111 | 3300005614 | Ga0068856_100000609 | Ga0068856_10000060919 | 200 |
| 112 | 3300005616 | Ga0068852_100001161 | Ga0068852_1000011611 | 200 |
| 113 | 3300005616 | Ga0068852_100152870 | Ga0068852_1001528703 | 200 |
| 114 | 3300005718 | Ga0068866_10041104 | Ga0068866_100411044 | 200 |
| 115 | 3300006028 | Ga0070717_10027515 | Ga0070717_100275152 | 200 |
| 116 | 3300006028 | Ga0070717_10030111 | Ga0070717_100301112 | 200 |
| 117 | 3300006028 | Ga0070717_10222965 | Ga0070717_102229652 | 200 |
| 118 | 3300006028 | Ga0070717_10373605 | Ga0070717_103736051 | 200 |
| 119 | 3300006163 | Ga0070715_10001567 | Ga0070715_100015672 | 200 |
| 120 | 3300006163 | Ga0070715_10012648 | Ga0070715_100126485 | 200 |
| 121 | 3300006173 | Ga0070716_100026301 | Ga0070716_1000263016 | 200 |
| 122 | 3300006173 | Ga0070716_100115093 | Ga0070716_1001150932 | 200 |
| 123 | 3300006175 | Ga0070712_100000340 | Ga0070712_10000034023 | 200 |
| 124 | 3300006175 | Ga0070712_100002911 | Ga0070712_1000029116 | 200 |
| 125 | 3300006175 | Ga0070712_100009532 | Ga0070712_1000095322 | 200 |
| 126 | 3300006175 | Ga0070712_100073305 | Ga0070712_1000733051 | 200 |
| 127 | 3300006175 | Ga0070712_100107863 | Ga0070712_1001078633 | 200 |
| 128 | 3300006237 | Ga0097621_100001157 | Ga0097621_1000011573 | 200 |
| 129 | 3300006358 | Ga0068871_100021610 | Ga0068871_1000216102 | 200 |
| 130 | 3300006852 | Ga0075433_10022380 | Ga0075433_100223801 | 200 |
| 131 | 3300006914 | Ga0075436_100008762 | Ga0075436_1000087622 | 200 |
| 132 | 3300009093 | Ga0105240_10002547 | Ga0105240_1000254738 | 200 |
| 133 | 3300009093 | Ga0105240_10031044 | Ga0105240_100310441 | 200 |
| 134 | 3300009093 | Ga0105240_10093628 | Ga0105240_100936282 | 200 |
| 135 | 3300009098 | Ga0105245_10025954 | Ga0105245_100259546 | 200 |
| 136 | 3300009177 | Ga0105248_10004472 | Ga0105248_1000447211 | 200 |
| 137 | 3300009177 | Ga0105248_10628240 | Ga0105248_106282402 | 200 |
| 138 | 3300009545 | Ga0105237_11105553 | Ga0105237_111055532 | 200 |
| 139 | 3300010375 | Ga0105239_10008308 | Ga0105239_1000830812 | 200 |
| 140 | 3300012482 | Ga0157318_1005835 | Ga0157318_10058351 | 200 |
| 141 | 3300013100 | Ga0157373_10003804 | Ga0157373_100038041 | 200 |
| 142 | 3300013104 | Ga0157370_10210341 | Ga0157370_102103413 | 200 |
| 143 | 3300013105 | Ga0157369_10003399 | Ga0157369_100033993 | 200 |
| 144 | 3300013105 | Ga0157369_10412199 | Ga0157369_104121991 | 200 |
| 145 | 3300013296 | Ga0157374_10000355 | Ga0157374_1000035527 | 200 |
| 146 | 3300013306 | Ga0163162_10004569 | Ga0163162_100045696 | 200 |
| 147 | 3300013307 | Ga0157372_10000282 | Ga0157372_1000028249 | 200 |
| 148 | 3300013307 | Ga0157372_10011608 | Ga0157372_100116086 | 200 |
| 149 | 3300013307 | Ga0157372_10832459 | Ga0157372_108324592 | 200 |
| 150 | 3300014325 | Ga0163163_10092292 | Ga0163163_100922922 | 200 |
| 151 | 3300024225 | Ga0224572_1006047 | Ga0224572_10060472 | 200 |
| 152 | 3300024227 | Ga0228598_1000450 | Ga0228598_10004504 | 200 |
| 153 | 3300024227 | Ga0228598_1007264 | Ga0228598_10072641 | 200 |
| 154 | 3300025903 | Ga0207680_10092685 | Ga0207680_100926851 | 200 |
| 155 | 3300025906 | Ga0207699_10206531 | Ga0207699_102065312 | 200 |
| 156 | 3300025911 | Ga0207654_10126544 | Ga0207654_101265441 | 200 |
| 157 | 3300025912 | Ga0207707_10001984 | Ga0207707_1000198427 | 200 |
| 158 | 3300025912 | Ga0207707_10171917 | Ga0207707_101719172 | 200 |
| 159 | 3300025913 | Ga0207695_10004974 | Ga0207695_100049748 | 200 |
| 160 | 3300025913 | Ga0207695_10011737 | Ga0207695_1001173711 | 200 |
| 161 | 3300025913 | Ga0207695_10050035 | Ga0207695_100500352 | 200 |
| 162 | 3300025913 | Ga0207695_10636787 | Ga0207695_106367872 | 200 |
| 163 | 3300025914 | Ga0207671_10175256 | Ga0207671_101752562 | 200 |
| 164 | 3300025915 | Ga0207693_10000182 | Ga0207693_1000018257 | 200 |
| 165 | 3300025915 | Ga0207693_10003469 | Ga0207693_100034694 | 200 |
| 166 | 3300025915 | Ga0207693_10010767 | Ga0207693_100107672 | 200 |
| 167 | 3300025915 | Ga0207693_10081981 | Ga0207693_100819811 | 200 |
| 168 | 3300025916 | Ga0207663_10002131 | Ga0207663_100021315 | 200 |
| 169 | 3300025916 | Ga0207663_10033331 | Ga0207663_100333314 | 200 |
| 170 | 3300025916 | Ga0207663_10116830 | Ga0207663_101168302 | 200 |
| 171 | 3300025917 | Ga0207660_10214837 | Ga0207660_102148372 | 200 |
| 172 | 3300025919 | Ga0207657_10004189 | Ga0207657_100041891 | 200 |
| 173 | 3300025921 | Ga0207652_10007447 | Ga0207652_100074476 | 200 |
| 174 | 3300025921 | Ga0207652_10113121 | Ga0207652_101131212 | 200 |
| 175 | 3300025924 | Ga0207694_10001976 | Ga0207694_100019762 | 200 |
| 176 | 3300025927 | Ga0207687_10002812 | Ga0207687_100028127 | 200 |
| 177 | 3300025928 | Ga0207700_10001771 | Ga0207700_100017716 | 200 |
| 178 | 3300025928 | Ga0207700_10001960 | Ga0207700_100019605 | 200 |
| 179 | 3300025928 | Ga0207700_10215535 | Ga0207700_102155352 | 200 |
| 180 | 3300025929 | Ga0207664_10000087 | Ga0207664_1000008722 | 200 |
| 181 | 3300025929 | Ga0207664_10011722 | Ga0207664_100117225 | 200 |
| 182 | 3300025929 | Ga0207664_10089269 | Ga0207664_100892691 | 200 |
| 183 | 3300025939 | Ga0207665_10019839 | Ga0207665_100198395 | 200 |
| 184 | 3300025941 | Ga0207711_10008695 | Ga0207711_100086954 | 200 |
| 185 | 3300025944 | Ga0207661_10061674 | Ga0207661_100616741 | 200 |
| 186 | 3300025944 | Ga0207661_10194615 | Ga0207661_101946151 | 200 |
| 187 | 3300025944 | Ga0207661_10291723 | Ga0207661_102917232 | 200 |
| 188 | 3300025949 | Ga0207667_10000377 | Ga0207667_1000037738 | 200 |
| 189 | 3300025949 | Ga0207667_10000541 | Ga0207667_100005413 | 200 |
| 190 | 3300025949 | Ga0207667_10005696 | Ga0207667_100056968 | 200 |
| 191 | 3300025949 | Ga0207667_10074069 | Ga0207667_100740693 | 200 |
| 192 | 3300025961 | Ga0207712_10006856 | Ga0207712_100068565 | 200 |
| 193 | 3300025972 | Ga0207668_10004431 | Ga0207668_100044315 | 200 |
| 194 | 3300026023 | Ga0207677_10015197 | Ga0207677_100151977 | 200 |
| 195 | 3300026078 | Ga0207702_10000561 | Ga0207702_1000056122 | 200 |
| 196 | 3300026078 | Ga0207702_10297313 | Ga0207702_102973132 | 200 |
| 197 | 3300026116 | Ga0207674_10010667 | Ga0207674_1001066710 | 200 |
| 198 | 3300026142 | Ga0207698_10016707 | Ga0207698_1001670710 | 200 |
| 199 | 3300027512 | Ga0209179_1059039 | Ga0209179_10590391 | 200 |
| 200 | 3300028023 | Ga0265357_1003443 | Ga0265357_10034433 | 200 |
| 201 | 3300028558 | Ga0265326_10033438 | Ga0265326_100334382 | 200 |
| 202 | 3300028800 | Ga0265338_10111851 | Ga0265338_101118512 | 200 |
| 203 | 3300028800 | Ga0265338_10126385 | Ga0265338_101263852 | 200 |
| 204 | 3300028800 | Ga0265338_10150625 | Ga0265338_101506252 | 200 |
| 205 | 3300030763 | Ga0265763_1001508 | Ga0265763_10015083 | 200 |
| 206 | 3300031235 | Ga0265330_10004432 | Ga0265330_100044326 | 200 |
| 207 | 3300031247 | Ga0265340_10051251 | Ga0265340_100512513 | 200 |
| 208 | 3300031249 | Ga0265339_10027784 | Ga0265339_100277842 | 200 |
| 209 | 3300031344 | Ga0265316_10572490 | Ga0265316_105724901 | 200 |
| 210 | 3300031595 | Ga0265313_10038907 | Ga0265313_100389072 | 200 |
| 211 | 3300031711 | Ga0265314_10034888 | Ga0265314_100348884 | 200 |
| 212 | 3300031711 | Ga0265314_10264902 | Ga0265314_102649021 | 200 |
| 213 | 3300031712 | Ga0265342_10050049 | Ga0265342_100500492 | 200 |
| 214 | 3300031712 | Ga0265342_10096345 | Ga0265342_100963451 | 200 |
| 215 | 3300035084 | Ga0373928_0074654 | Ga0373928_0074654_212_814 | 200 |
| 216 | 3300035111 | Ga0373923_0189539 | Ga0373923_0189539_48_650 | 200 |
| 217 | 3300035113 | Ga0373936_0008282 | Ga0373936_0008282_140_742 | 200 |
| 218 | 3300035115 | Ga0373941_0090618 | Ga0373941_0090618_74_745 | 200 |
| 219 | 3300035116 | Ga0373945_0003446 | Ga0373945_0003446_2446_3048 | 200 |
| 220 | 3300035170 | Ga0373943_0002800 | Ga0373943_0002800_5527_6129 | 200 |
| 221 | 3300035171 | Ga0373946_0029158 | Ga0373946_0029158_910_1512 | 200 |
| 222 | 3300035172 | Ga0373955_0102027 | Ga0373955_0102027_369_971 | 200 |
| 223 | 3300035242 | Ga0373962_0192348 | Ga0373962_0192348_62_664 | 200 |
| 224 | 3300035691 | Ga0373931_0037689 | Ga0373931_0037689_1615_2286 | 200 |
| 225 | 3300035692 | Ga0373935_0015243 | Ga0373935_0015243_2287_2889 | 200 |
| 226 | 3300035692 | Ga0373935_0113767 | Ga0373935_0113767_537_1139 | 200 |
| 227 | 3300035695 | Ga0373927_0010054 | Ga0373927_0010054_5263_5865 | 200 |
| 228 | 3300035695 | Ga0373927_0022049 | Ga0373927_0022049_873_1475 | 200 |
| 229 | 3300035724 | Ga0373933_0019579 | Ga0373933_0019579_3164_3766 | 200 |
| 230 | 3300035724 | Ga0373933_0041075 | Ga0373933_0041075_246_848 | 200 |
| 231 | 3300035724 | Ga0373933_0046964 | Ga0373933_0046964_303_905 | 200 |
| 232 | 3300035725 | Ga0373947_0003669 | Ga0373947_0003669_1896_2498 | 200 |
| 233 | 3300035725 | Ga0373947_0036081 | Ga0373947_0036081_1557_2159 | 200 |
| 234 | 3300035725 | Ga0373947_0192283 | Ga0373947_0192283_93_695 | 200 |
| 235 | 3300036401 | Ga0373937_0097862 | Ga0373937_0097862_387_989 | 200 |
| 236 | 3300036401 | Ga0373937_0119299 | Ga0373937_0119299_1762_2364 | 200 |
| 237 | 3300036401 | Ga0373937_0438269 | Ga0373937_0438269_498_1124 | 200 |
| 238 | 3300036401 | Ga0373937_0988024 | Ga0373937_0988024_170_772 | 200 |
| 239 | 3300037068 | Ga0373925_0002473 | Ga0373925_0002473_6499_7101 | 200 |
| 240 | 3300037068 | Ga0373925_0072838 | Ga0373925_0072838_1397_1999 | 200 |
| 241 | 3300037068 | Ga0373925_0127488 | Ga0373925_0127488_328_930 | 200 |
| 242 | 3300039438 | Ga0436360_1073532 | Ga0436360_1073532_67_708 | 200 |
| 243 | 3300039453 | Ga0436362_0325737 | Ga0436362_0325737_394_1014 | 200 |
| 244 | 3300044693 | Ga0466961_0073960 | Ga0466961_0073960_762_1364 | 200 |
| 245 | 3300044842 | Ga0466957_0165821 | Ga0466957_0165821_401_1003 | 200 |
| 246 | 3300045836 | Ga0466958_0088139 | Ga0466958_0088139_10_612 | 200 |
| 247 | 3300045836 | Ga0466958_0485978 | Ga0466958_0485978_23_625 | 200 |
| 248 | 3300045976 | Ga0466967_0004914 | Ga0466967_0004914_1198_1848 | 200 |
| 249 | 3300046455 | Ga0495603_0157041 | Ga0495603_0157041_309_911 | 200 |
| 250 | 3300046472 | Ga0495580_0016785 | Ga0495580_0016785_3567_4169 | 200 |
| 251 | 3300046472 | Ga0495580_0022128 | Ga0495580_0022128_3500_4102 | 200 |
| 252 | 3300046472 | Ga0495580_0294210 | Ga0495580_0294210_292_894 | 200 |
| 253 | 3300046477 | Ga0495664_0031494 | Ga0495664_0031494_1279_1881 | 200 |
| 254 | 3300046477 | Ga0495664_0307225 | Ga0495664_0307225_294_896 | 200 |
| 255 | 3300046516 | Ga0495628_0187436 | Ga0495628_0187436_41_643 | 200 |
| 256 | 3300046517 | Ga0495630_0174937 | Ga0495630_0174937_400_1002 | 200 |
| 257 | 3300046528 | Ga0495642_0115027 | Ga0495642_0115027_274_876 | 200 |
| 258 | 3300046529 | Ga0495652_0063290 | Ga0495652_0063290_108_710 | 200 |
| 259 | 3300046531 | Ga0495665_0063330 | Ga0495665_0063330_107_709 | 200 |
| 260 | 3300046543 | Ga0495645_0058556 | Ga0495645_0058556_846_1481 | 200 |
| 261 | 3300046557 | Ga0495622_0243692 | Ga0495622_0243692_65_667 | 200 |
| 262 | 3300046678 | Ga0495599_0038192 | Ga0495599_0038192_379_981 | 200 |
| 263 | 3300046679 | Ga0495623_0096380 | Ga0495623_0096380_967_1602 | 200 |
| 264 | 3300046679 | Ga0495623_0149655 | Ga0495623_0149655_431_1033 | 200 |
| 265 | 3300046689 | Ga0495613_0136057 | Ga0495613_0136057_423_1025 | 200 |
| 266 | 3300046689 | Ga0495613_0404221 | Ga0495613_0404221_319_921 | 200 |
| 267 | 3300047319 | Ga0495674_0039914 | Ga0495674_0039914_2405_3007 | 200 |
| 268 | 3300047445 | Ga0495677_0114965 | Ga0495677_0114965_87_689 | 200 |
| 269 | 3300047471 | Ga0495684_0250216 | Ga0495684_0250216_165_767 | 200 |
| 270 | 3300048906 | Ga0496103_0091131 | Ga0496103_0091131_1074_1763 | 200 |
| 271 | 3300048907 | Ga0496104_0022458 | Ga0496104_0022458_371_973 | 200 |
| 272 | 3300048907 | Ga0496104_0293923 | Ga0496104_0293923_757_1440 | 200 |
| 273 | 3300048907 | Ga0496104_0390569 | Ga0496104_0390569_433_1035 | 200 |
| 274 | 3300048908 | Ga0496105_0217857 | Ga0496105_0217857_461_1063 | 200 |
| 275 | 3300048914 | Ga0496111_0004189 | Ga0496111_0004189_6266_6922 | 200 |
| 276 | 3300048915 | Ga0496112_0002677 | Ga0496112_0002677_10731_11414 | 200 |
| 277 | 3300048915 | Ga0496112_0071931 | Ga0496112_0071931_1238_1909 | 200 |
| 278 | 3300048918 | Ga0496115_0248589 | Ga0496115_0248589_636_1238 | 200 |
| 279 | 3300048929 | Ga0496126_0016479 | Ga0496126_0016479_2670_3272 | 200 |
| 280 | 3300053078 | Ga0495612_0133302 | Ga0495612_0133302_156_827 | 200 |
| 281 | 3300000546 | LJNas_1009679 | LJNas_10096791 | 201 |
| 282 | 3300005329 | Ga0070683_100090670 | Ga0070683_1000906702 | 201 |
| 283 | 3300005530 | Ga0070679_100570067 | Ga0070679_1005700671 | 201 |
| 284 | 3300005539 | Ga0068853_100377051 | Ga0068853_1003770512 | 201 |
| 285 | 3300005616 | Ga0068852_100003078 | Ga0068852_1000030788 | 201 |
| 286 | 3300009093 | Ga0105240_10000213 | Ga0105240_1000021377 | 201 |
| 287 | 3300009093 | Ga0105240_10014750 | Ga0105240_100147509 | 201 |
| 288 | 3300009545 | Ga0105237_10182162 | Ga0105237_101821621 | 201 |
| 289 | 3300013100 | Ga0157373_10119358 | Ga0157373_101193582 | 201 |
| 290 | 3300013104 | Ga0157370_10000058 | Ga0157370_1000005876 | 201 |
| 291 | 3300013105 | Ga0157369_10000381 | Ga0157369_1000038127 | 201 |
| 292 | 3300013307 | Ga0157372_10000622 | Ga0157372_1000062210 | 201 |
| 293 | 3300025261 | Ga0209233_1020613 | Ga0209233_10206131 | 201 |
| 294 | 3300025912 | Ga0207707_10028982 | Ga0207707_100289822 | 201 |
| 295 | 3300025913 | Ga0207695_10000191 | Ga0207695_10000191125 | 201 |
| 296 | 3300025913 | Ga0207695_10007323 | Ga0207695_100073233 | 201 |
| 297 | 3300025913 | Ga0207695_10037748 | Ga0207695_100377483 | 201 |
| 298 | 3300025914 | Ga0207671_10111175 | Ga0207671_101111751 | 201 |
| 299 | 3300025949 | Ga0207667_10026110 | Ga0207667_100261103 | 201 |
| 300 | 3300026041 | Ga0207639_11173652 | Ga0207639_111736521 | 201 |
| 301 | 3300026142 | Ga0207698_10000070 | Ga0207698_1000007037 | 201 |
| 302 | 3300005330 | Ga0070690_100181545 | Ga0070690_1001815452 | 202 |
| 303 | 3300005335 | Ga0070666_10064026 | Ga0070666_100640261 | 202 |
| 304 | 3300005436 | Ga0070713_100602692 | Ga0070713_1006026921 | 202 |
| 305 | 3300005614 | Ga0068856_100072459 | Ga0068856_1000724591 | 202 |
| 306 | 3300009177 | Ga0105248_10456599 | Ga0105248_104565992 | 202 |
| 307 | 3300025913 | Ga0207695_10008737 | Ga0207695_100087372 | 202 |
| 308 | 3300025924 | Ga0207694_10103208 | Ga0207694_101032082 | 202 |
| 309 | 3300025924 | Ga0207694_10130475 | Ga0207694_101304753 | 202 |
| 310 | 3300025928 | Ga0207700_10578386 | Ga0207700_105783861 | 202 |
| 311 | 3300025949 | Ga0207667_10005182 | Ga0207667_100051822 | 202 |
| 312 | 3300025986 | Ga0207658_10473736 | Ga0207658_104737361 | 202 |
| 313 | 3300026088 | Ga0207641_10114978 | Ga0207641_101149782 | 202 |
| 314 | 3300005329 | Ga0070683_100012931 | Ga0070683_1000129314 | 203 |
| 315 | 3300005338 | Ga0068868_100025862 | Ga0068868_1000258622 | 203 |
| 316 | 3300005355 | Ga0070671_100293083 | Ga0070671_1002930831 | 203 |
| 317 | 3300005436 | Ga0070713_100086922 | Ga0070713_1000869222 | 203 |
| 318 | 3300005439 | Ga0070711_100103485 | Ga0070711_1001034853 | 203 |
| 319 | 3300005459 | Ga0068867_100058040 | Ga0068867_1000580402 | 203 |
| 320 | 3300005530 | Ga0070679_100235043 | Ga0070679_1002350432 | 203 |
| 321 | 3300005563 | Ga0068855_100001009 | Ga0068855_10000100911 | 203 |
| 322 | 3300005564 | Ga0070664_100818152 | Ga0070664_1008181521 | 203 |
| 323 | 3300005614 | Ga0068856_100000813 | Ga0068856_10000081317 | 203 |
| 324 | 3300005615 | Ga0070702_100098210 | Ga0070702_1000982102 | 203 |
| 325 | 3300005616 | Ga0068852_100401946 | Ga0068852_1004019462 | 203 |
| 326 | 3300005618 | Ga0068864_100138961 | Ga0068864_1001389612 | 203 |
| 327 | 3300005841 | Ga0068863_100542662 | Ga0068863_1005426622 | 203 |
| 328 | 3300005842 | Ga0068858_100052858 | Ga0068858_1000528582 | 203 |
| 329 | 3300006028 | Ga0070717_10327614 | Ga0070717_103276141 | 203 |
| 330 | 3300006237 | Ga0097621_100000060 | Ga0097621_10000006017 | 203 |
| 331 | 3300006358 | Ga0068871_100000190 | Ga0068871_10000019035 | 203 |
| 332 | 3300009176 | Ga0105242_11233311 | Ga0105242_112333111 | 203 |
| 333 | 3300009177 | Ga0105248_10018174 | Ga0105248_100181743 | 203 |
| 334 | 3300013105 | Ga0157369_10024476 | Ga0157369_100244764 | 203 |
| 335 | 3300013296 | Ga0157374_10000359 | Ga0157374_1000035924 | 203 |
| 336 | 3300013296 | Ga0157374_10006940 | Ga0157374_100069403 | 203 |
| 337 | 3300013296 | Ga0157374_10449680 | Ga0157374_104496802 | 203 |
| 338 | 3300013297 | Ga0157378_10000092 | Ga0157378_1000009262 | 203 |
| 339 | 3300013307 | Ga0157372_10001281 | Ga0157372_1000128125 | 203 |
| 340 | 3300025898 | Ga0207692_10421609 | Ga0207692_104216091 | 203 |
| 341 | 3300025904 | Ga0207647_10036189 | Ga0207647_100361892 | 203 |
| 342 | 3300025913 | Ga0207695_10472848 | Ga0207695_104728482 | 203 |
| 343 | 3300025921 | Ga0207652_10214149 | Ga0207652_102141492 | 203 |
| 344 | 3300025928 | Ga0207700_10550893 | Ga0207700_105508932 | 203 |
| 345 | 3300025945 | Ga0207679_10132082 | Ga0207679_101320822 | 203 |
| 346 | 3300025949 | Ga0207667_10002508 | Ga0207667_1000250823 | 203 |
| 347 | 3300025981 | Ga0207640_10243147 | Ga0207640_102431471 | 203 |
| 348 | 3300026023 | Ga0207677_10014728 | Ga0207677_100147282 | 203 |
| 349 | 3300026035 | Ga0207703_10028925 | Ga0207703_100289252 | 203 |
| 350 | 3300026078 | Ga0207702_10000175 | Ga0207702_1000017531 | 203 |
| 351 | 3300026078 | Ga0207702_10000583 | Ga0207702_1000058313 | 203 |
| 352 | 3300026089 | Ga0207648_10049988 | Ga0207648_100499881 | 203 |
| 353 | 3300026095 | Ga0207676_10161373 | Ga0207676_101613731 | 203 |
| 354 | 3300028379 | Ga0268266_10072994 | Ga0268266_100729943 | 203 |
| 355 | 3300028800 | Ga0265338_10054622 | Ga0265338_100546223 | 203 |
| 356 | 3300031235 | Ga0265330_10169623 | Ga0265330_101696231 | 203 |
| 357 | 3300031247 | Ga0265340_10009761 | Ga0265340_100097614 | 203 |
| 358 | 3300031711 | Ga0265314_10294734 | Ga0265314_102947341 | 203 |
| 359 | 3300031712 | Ga0265342_10084011 | Ga0265342_100840112 | 203 |
| 360 | 3300033546 | Ga0316213_1003734 | Ga0316213_10037341 | 203 |
| 361 | 3300033547 | Ga0316212_1002904 | Ga0316212_10029042 | 203 |
| 362 | 3300035086 | Ga0373934_0030138 | Ga0373934_0030138_1483_2094 | 203 |
| 363 | 3300035695 | Ga0373927_0472480 | Ga0373927_0472480_168_779 | 203 |
| 364 | 3300037853 | Ga0436364_0176799 | Ga0436364_0176799_193_804 | 203 |
| 365 | 3300039453 | Ga0436362_0698378 | Ga0436362_0698378_262_873 | 203 |
| 366 | 3300046472 | Ga0495580_0134650 | Ga0495580_0134650_260_871 | 203 |
| 367 | 3300046516 | Ga0495628_0229236 | Ga0495628_0229236_122_766 | 203 |
| 368 | 3300046522 | Ga0495643_0205784 | Ga0495643_0205784_281_928 | 203 |
| 369 | 3300046533 | Ga0495640_0468915 | Ga0495640_0468915_34_681 | 203 |
| 370 | 3300046543 | Ga0495645_0301373 | Ga0495645_0301373_51_695 | 203 |
| 371 | 3300047317 | Ga0495604_0171537 | Ga0495604_0171537_838_1449 | 203 |
| 372 | 3300048915 | Ga0496112_0787109 | Ga0496112_0787109_206_817 | 203 |
| 373 | 3300049569 | Ga0501032_0156464 | Ga0501032_0156464_688_1299 | 203 |
| 374 | 3300049570 | Ga0501033_0357396 | Ga0501033_0357396_12_623 | 203 |
| 375 | 3300049571 | Ga0501034_0323325 | Ga0501034_0323325_71_682 | 203 |
| 376 | 3300049572 | Ga0501036_0163829 | Ga0501036_0163829_839_1450 | 203 |
| 377 | 3300049573 | Ga0501037_0207923 | Ga0501037_0207923_137_748 | 203 |
| 378 | 3300049579 | Ga0501043_0142786 | Ga0501043_0142786_22_633 | 203 |
| 379 | 3300049581 | Ga0501047_0102299 | Ga0501047_0102299_1289_1900 | 203 |
| 380 | 3300049589 | Ga0501073_0197651 | Ga0501073_0197651_215_835 | 203 |
| 381 | 3300049742 | Ga0501080_0360705 | Ga0501080_0360705_136_747 | 203 |
| 382 | 3300049823 | Ga0501044_0000314 | Ga0501044_0000314_42053_42673 | 203 |
| 383 | 3300049823 | Ga0501044_0110697 | Ga0501044_0110697_835_1446 | 203 |
| 384 | 3300054114 | Ga0501084_0701432 | Ga0501084_0701432_227_838 | 203 |
| 385 | 3300028379 | Ga0268266_10888826 | Ga0268266_108888262 | 204 |
| 386 | 3300005456 | Ga0070678_100233529 | Ga0070678_1002335291 | 205 |
| 387 | 3300006358 | Ga0068871_100004608 | Ga0068871_1000046087 | 205 |
| 388 | 3300009176 | Ga0105242_10441410 | Ga0105242_104414101 | 205 |
| 389 | 3300012478 | Ga0157328_1003686 | Ga0157328_10036861 | 205 |
| 390 | 3300046473 | Ga0495582_0007999 | Ga0495582_0007999_582_1202 | 205 |
| 391 | 3300046683 | Ga0495658_0047416 | Ga0495658_0047416_1155_1775 | 205 |
| 392 | 3300047317 | Ga0495604_0041478 | Ga0495604_0041478_857_1507 | 205 |
| 393 | 3300005327 | Ga0070658_10219871 | Ga0070658_102198712 | 206 |
| 394 | 3300005338 | Ga0068868_100011939 | Ga0068868_1000119392 | 206 |
| 395 | 3300005354 | Ga0070675_100316223 | Ga0070675_1003162232 | 206 |
| 396 | 3300005434 | Ga0070709_10703400 | Ga0070709_107034001 | 206 |
| 397 | 3300005435 | Ga0070714_100111328 | Ga0070714_1001113283 | 206 |
| 398 | 3300005436 | Ga0070713_100012208 | Ga0070713_1000122081 | 206 |
| 399 | 3300005439 | Ga0070711_100181713 | Ga0070711_1001817132 | 206 |
| 400 | 3300005535 | Ga0070684_100146853 | Ga0070684_1001468533 | 206 |
| 401 | 3300005539 | Ga0068853_100001002 | Ga0068853_10000100215 | 206 |
| 402 | 3300005539 | Ga0068853_100401186 | Ga0068853_1004011861 | 206 |
| 403 | 3300005563 | Ga0068855_100030086 | Ga0068855_1000300865 | 206 |
| 404 | 3300005563 | Ga0068855_100937603 | Ga0068855_1009376031 | 206 |
| 405 | 3300005577 | Ga0068857_100663978 | Ga0068857_1006639782 | 206 |
| 406 | 3300005614 | Ga0068856_100084851 | Ga0068856_1000848512 | 206 |
| 407 | 3300005616 | Ga0068852_100009777 | Ga0068852_1000097774 | 206 |
| 408 | 3300005616 | Ga0068852_100130431 | Ga0068852_1001304312 | 206 |
| 409 | 3300005616 | Ga0068852_100478929 | Ga0068852_1004789292 | 206 |
| 410 | 3300005834 | Ga0068851_10018526 | Ga0068851_100185262 | 206 |
| 411 | 3300006028 | Ga0070717_10317545 | Ga0070717_103175452 | 206 |
| 412 | 3300006237 | Ga0097621_100078645 | Ga0097621_1000786451 | 206 |
| 413 | 3300006358 | Ga0068871_100012840 | Ga0068871_1000128402 | 206 |
| 414 | 3300009093 | Ga0105240_10148738 | Ga0105240_101487381 | 206 |
| 415 | 3300009093 | Ga0105240_10171859 | Ga0105240_101718593 | 206 |
| 416 | 3300009093 | Ga0105240_10281083 | Ga0105240_102810832 | 206 |
| 417 | 3300009098 | Ga0105245_10051029 | Ga0105245_100510292 | 206 |
| 418 | 3300009174 | Ga0105241_10000055 | Ga0105241_1000005560 | 206 |
| 419 | 3300009174 | Ga0105241_10000338 | Ga0105241_1000033811 | 206 |
| 420 | 3300009174 | Ga0105241_10007684 | Ga0105241_100076849 | 206 |
| 421 | 3300009174 | Ga0105241_10202162 | Ga0105241_102021622 | 206 |
| 422 | 3300009545 | Ga0105237_10043368 | Ga0105237_100433683 | 206 |
| 423 | 3300009545 | Ga0105237_10124815 | Ga0105237_101248152 | 206 |
| 424 | 3300009545 | Ga0105237_10175557 | Ga0105237_101755573 | 206 |
| 425 | 3300009551 | Ga0105238_10012644 | Ga0105238_100126449 | 206 |
| 426 | 3300009551 | Ga0105238_10074609 | Ga0105238_100746093 | 206 |
| 427 | 3300009551 | Ga0105238_10271324 | Ga0105238_102713242 | 206 |
| 428 | 3300010375 | Ga0105239_10134156 | Ga0105239_101341563 | 206 |
| 429 | 3300010375 | Ga0105239_10405556 | Ga0105239_104055562 | 206 |
| 430 | 3300013102 | Ga0157371_10363751 | Ga0157371_103637512 | 206 |
| 431 | 3300013105 | Ga0157369_10006528 | Ga0157369_100065289 | 206 |
| 432 | 3300013105 | Ga0157369_10039943 | Ga0157369_100399433 | 206 |
| 433 | 3300013105 | Ga0157369_10173049 | Ga0157369_101730492 | 206 |
| 434 | 3300013105 | Ga0157369_10444925 | Ga0157369_104449253 | 206 |
| 435 | 3300013296 | Ga0157374_10108295 | Ga0157374_101082952 | 206 |
| 436 | 3300013297 | Ga0157378_10021416 | Ga0157378_100214162 | 206 |
| 437 | 3300013297 | Ga0157378_10073962 | Ga0157378_100739623 | 206 |
| 438 | 3300013307 | Ga0157372_10082716 | Ga0157372_100827162 | 206 |
| 439 | 3300013307 | Ga0157372_10100095 | Ga0157372_101000954 | 206 |
| 440 | 3300013307 | Ga0157372_10223956 | Ga0157372_102239562 | 206 |
| 441 | 3300013308 | Ga0157375_10049389 | Ga0157375_100493895 | 206 |
| 442 | 3300013308 | Ga0157375_10364669 | Ga0157375_103646692 | 206 |
| 443 | 3300014325 | Ga0163163_10015690 | Ga0163163_100156902 | 206 |
| 444 | 3300014969 | Ga0157376_10118789 | Ga0157376_101187892 | 206 |
| 445 | 3300025321 | Ga0207656_10104674 | Ga0207656_101046742 | 206 |
| 446 | 3300025898 | Ga0207692_10081280 | Ga0207692_100812803 | 206 |
| 447 | 3300025909 | Ga0207705_10401801 | Ga0207705_104018012 | 206 |
| 448 | 3300025911 | Ga0207654_10000027 | Ga0207654_1000002717 | 206 |
| 449 | 3300025911 | Ga0207654_10109197 | Ga0207654_101091972 | 206 |
| 450 | 3300025911 | Ga0207654_10216082 | Ga0207654_102160822 | 206 |
| 451 | 3300025913 | Ga0207695_10003674 | Ga0207695_100036741 | 206 |
| 452 | 3300025913 | Ga0207695_10116776 | Ga0207695_101167762 | 206 |
| 453 | 3300025913 | Ga0207695_10234074 | Ga0207695_102340742 | 206 |
| 454 | 3300025914 | Ga0207671_10051482 | Ga0207671_100514824 | 206 |
| 455 | 3300025914 | Ga0207671_10207195 | Ga0207671_102071952 | 206 |
| 456 | 3300025924 | Ga0207694_10000160 | Ga0207694_1000016038 | 206 |
| 457 | 3300025924 | Ga0207694_10202570 | Ga0207694_102025702 | 206 |
| 458 | 3300025927 | Ga0207687_10670123 | Ga0207687_106701232 | 206 |
| 459 | 3300025928 | Ga0207700_10014215 | Ga0207700_100142153 | 206 |
| 460 | 3300025949 | Ga0207667_10037489 | Ga0207667_100374894 | 206 |
| 461 | 3300026023 | Ga0207677_10030966 | Ga0207677_100309663 | 206 |
| 462 | 3300026041 | Ga0207639_10000145 | Ga0207639_1000014514 | 206 |
| 463 | 3300026078 | Ga0207702_10277235 | Ga0207702_102772353 | 206 |
| 464 | 3300046663 | Ga0495635_0247268 | Ga0495635_0247268_317_937 | 206 |
| 465 | 3300046690 | Ga0495624_0095541 | Ga0495624_0095541_202_858 | 206 |
| 466 | 3300048903 | Ga0496100_0038390 | Ga0496100_0038390_1673_2293 | 206 |
| 467 | 3300048904 | Ga0496101_0008468 | Ga0496101_0008468_1525_2145 | 206 |
| 468 | 3300048907 | Ga0496104_0451345 | Ga0496104_0451345_14_634 | 206 |
| 469 | 3300048912 | Ga0496109_0374465 | Ga0496109_0374465_210_830 | 206 |
| 470 | 3300048917 | Ga0496114_0006722 | Ga0496114_0006722_6732_7352 | 206 |
| 471 | 3300048918 | Ga0496115_0013978 | Ga0496115_0013978_4642_5262 | 206 |
| 472 | 3300050514 | nmdc:mga08x19_3469_c1 | nmdc:mga08x19_3469_c1_2702_3322 | 206 |
| 473 | 3300053085 | Ga0495619_0311402 | Ga0495619_0311402_389_1009 | 206 |
| 474 | 3300000546 | LJNas_1000379 | LJNas_10003796 | 207 |
| 475 | 3300005334 | Ga0068869_100073489 | Ga0068869_1000734893 | 207 |
| 476 | 3300005336 | Ga0070680_100037897 | Ga0070680_1000378972 | 207 |
| 477 | 3300005337 | Ga0070682_100161032 | Ga0070682_1001610322 | 207 |
| 478 | 3300005338 | Ga0068868_100059666 | Ga0068868_1000596661 | 207 |
| 479 | 3300005340 | Ga0070689_100335502 | Ga0070689_1003355022 | 207 |
| 480 | 3300005343 | Ga0070687_100072759 | Ga0070687_1000727593 | 207 |
| 481 | 3300005347 | Ga0070668_100037146 | Ga0070668_1000371461 | 207 |
| 482 | 3300005355 | Ga0070671_100008953 | Ga0070671_1000089535 | 207 |
| 483 | 3300005355 | Ga0070671_100214360 | Ga0070671_1002143602 | 207 |
| 484 | 3300005441 | Ga0070700_100545959 | Ga0070700_1005459591 | 207 |
| 485 | 3300005456 | Ga0070678_100175711 | Ga0070678_1001757112 | 207 |
| 486 | 3300005457 | Ga0070662_100008074 | Ga0070662_1000080749 | 207 |
| 487 | 3300005457 | Ga0070662_100032341 | Ga0070662_1000323412 | 207 |
| 488 | 3300005468 | Ga0070707_100126787 | Ga0070707_1001267874 | 207 |
| 489 | 3300005539 | Ga0068853_100015608 | Ga0068853_1000156082 | 207 |
| 490 | 3300005544 | Ga0070686_100402374 | Ga0070686_1004023742 | 207 |
| 491 | 3300005548 | Ga0070665_100037113 | Ga0070665_1000371132 | 207 |
| 492 | 3300005548 | Ga0070665_100212429 | Ga0070665_1002124292 | 207 |
| 493 | 3300005563 | Ga0068855_100157926 | Ga0068855_1001579262 | 207 |
| 494 | 3300005563 | Ga0068855_100464076 | Ga0068855_1004640761 | 207 |
| 495 | 3300005614 | Ga0068856_100015336 | Ga0068856_1000153367 | 207 |
| 496 | 3300005614 | Ga0068856_100041434 | Ga0068856_1000414342 | 207 |
| 497 | 3300005616 | Ga0068852_100155809 | Ga0068852_1001558092 | 207 |
| 498 | 3300005617 | Ga0068859_100012318 | Ga0068859_1000123182 | 207 |
| 499 | 3300005617 | Ga0068859_100030601 | Ga0068859_1000306012 | 207 |
| 500 | 3300005842 | Ga0068858_100072019 | Ga0068858_1000720193 | 207 |
| 501 | 3300005843 | Ga0068860_100001835 | Ga0068860_10000183516 | 207 |
| 502 | 3300005844 | Ga0068862_100115746 | Ga0068862_1001157462 | 207 |
| 503 | 3300006237 | Ga0097621_100040541 | Ga0097621_1000405412 | 207 |
| 504 | 3300006237 | Ga0097621_100356356 | Ga0097621_1003563562 | 207 |
| 505 | 3300006358 | Ga0068871_100014953 | Ga0068871_1000149535 | 207 |
| 506 | 3300006358 | Ga0068871_100093201 | Ga0068871_1000932012 | 207 |
| 507 | 3300006881 | Ga0068865_100104573 | Ga0068865_1001045732 | 207 |
| 508 | 3300006931 | Ga0097620_100012320 | Ga0097620_1000123202 | 207 |
| 509 | 3300006931 | Ga0097620_100030601 | Ga0097620_1000306012 | 207 |
| 510 | 3300009093 | Ga0105240_10000683 | Ga0105240_1000068323 | 207 |
| 511 | 3300009093 | Ga0105240_10008749 | Ga0105240_100087495 | 207 |
| 512 | 3300009098 | Ga0105245_10004131 | Ga0105245_100041317 | 207 |
| 513 | 3300009098 | Ga0105245_10511140 | Ga0105245_105111401 | 207 |
| 514 | 3300009174 | Ga0105241_10049438 | Ga0105241_100494382 | 207 |
| 515 | 3300009174 | Ga0105241_10292669 | Ga0105241_102926691 | 207 |
| 516 | 3300009177 | Ga0105248_10001001 | Ga0105248_1000100112 | 207 |
| 517 | 3300009177 | Ga0105248_11255223 | Ga0105248_112552231 | 207 |
| 518 | 3300009551 | Ga0105238_10000352 | Ga0105238_100003527 | 207 |
| 519 | 3300009553 | Ga0105249_10015382 | Ga0105249_100153825 | 207 |
| 520 | 3300010375 | Ga0105239_10000375 | Ga0105239_1000037529 | 207 |
| 521 | 3300013102 | Ga0157371_10061088 | Ga0157371_100610882 | 207 |
| 522 | 3300013104 | Ga0157370_10544957 | Ga0157370_105449571 | 207 |
| 523 | 3300013296 | Ga0157374_10015562 | Ga0157374_100155622 | 207 |
| 524 | 3300013297 | Ga0157378_10188086 | Ga0157378_101880862 | 207 |
| 525 | 3300013307 | Ga0157372_10058079 | Ga0157372_100580794 | 207 |
| 526 | 3300014745 | Ga0157377_10049749 | Ga0157377_100497492 | 207 |
| 527 | 3300014969 | Ga0157376_10054623 | Ga0157376_100546233 | 207 |
| 528 | 3300017792 | Ga0163161_10026127 | Ga0163161_100261273 | 207 |
| 529 | 3300025315 | Ga0207697_10010658 | Ga0207697_100106583 | 207 |
| 530 | 3300025911 | Ga0207654_10022696 | Ga0207654_100226962 | 207 |
| 531 | 3300025911 | Ga0207654_10436412 | Ga0207654_104364121 | 207 |
| 532 | 3300025913 | Ga0207695_10000108 | Ga0207695_1000010830 | 207 |
| 533 | 3300025913 | Ga0207695_10000345 | Ga0207695_1000034530 | 207 |
| 534 | 3300025913 | Ga0207695_10006642 | Ga0207695_1000664212 | 207 |
| 535 | 3300025918 | Ga0207662_10008307 | Ga0207662_100083072 | 207 |
| 536 | 3300025921 | Ga0207652_10008176 | Ga0207652_100081768 | 207 |
| 537 | 3300025922 | Ga0207646_10614531 | Ga0207646_106145312 | 207 |
| 538 | 3300025924 | Ga0207694_10000380 | Ga0207694_1000038015 | 207 |
| 539 | 3300025925 | Ga0207650_10000646 | Ga0207650_100006461 | 207 |
| 540 | 3300025927 | Ga0207687_10047561 | Ga0207687_100475612 | 207 |
| 541 | 3300025929 | Ga0207664_10019681 | Ga0207664_100196812 | 207 |
| 542 | 3300025931 | Ga0207644_10011846 | Ga0207644_100118465 | 207 |
| 543 | 3300025931 | Ga0207644_10106095 | Ga0207644_101060952 | 207 |
| 544 | 3300025932 | Ga0207690_10207049 | Ga0207690_102070492 | 207 |
| 545 | 3300025936 | Ga0207670_10275551 | Ga0207670_102755511 | 207 |
| 546 | 3300025941 | Ga0207711_10000859 | Ga0207711_100008597 | 207 |
| 547 | 3300025941 | Ga0207711_10108839 | Ga0207711_101088392 | 207 |
| 548 | 3300026023 | Ga0207677_10025642 | Ga0207677_100256423 | 207 |
| 549 | 3300026035 | Ga0207703_10069711 | Ga0207703_100697113 | 207 |
| 550 | 3300026041 | Ga0207639_10253394 | Ga0207639_102533942 | 207 |
| 551 | 3300026067 | Ga0207678_10083540 | Ga0207678_100835402 | 207 |
| 552 | 3300026078 | Ga0207702_10009227 | Ga0207702_100092274 | 207 |
| 553 | 3300026078 | Ga0207702_10049937 | Ga0207702_100499373 | 207 |
| 554 | 3300026078 | Ga0207702_10323065 | Ga0207702_103230653 | 207 |
| 555 | 3300026088 | Ga0207641_10000021 | Ga0207641_1000002142 | 207 |
| 556 | 3300026088 | Ga0207641_10204079 | Ga0207641_102040792 | 207 |
| 557 | 3300026095 | Ga0207676_10000518 | Ga0207676_100005184 | 207 |
| 558 | 3300028017 | Ga0265356_1000510 | Ga0265356_10005103 | 207 |
| 559 | 3300028379 | Ga0268266_10050140 | Ga0268266_100501402 | 207 |
| 560 | 3300028379 | Ga0268266_10571379 | Ga0268266_105713791 | 207 |
| 561 | 3300028380 | Ga0268265_10108992 | Ga0268265_101089921 | 207 |
| 562 | 3300028381 | Ga0268264_10006325 | Ga0268264_100063255 | 207 |
| 563 | 3300028381 | Ga0268264_10036874 | Ga0268264_100368742 | 207 |
| 564 | 3300028800 | Ga0265338_10001846 | Ga0265338_1000184618 | 207 |
| 565 | 3300031249 | Ga0265339_10002593 | Ga0265339_1000259313 | 207 |
| 566 | 3300031344 | Ga0265316_10007178 | Ga0265316_100071783 | 207 |
| 567 | 3300031711 | Ga0265314_10002820 | Ga0265314_1000282016 | 207 |
| 568 | 3300037466 | Ga0395898_0137829 | Ga0395898_0137829_40_675 | 207 |
| 569 | 3300047319 | Ga0495674_0038308 | Ga0495674_0038308_1907_2536 | 207 |
| 570 | 3300047444 | Ga0495675_0010036 | Ga0495675_0010036_245_874 | 207 |
| 571 | 3300048089 | Ga0495614_0315535 | Ga0495614_0315535_46_684 | 207 |
| 572 | 3300048915 | Ga0496112_0000053 | Ga0496112_0000053_2910_3545 | 207 |
| 573 | 3300048915 | Ga0496112_0115473 | Ga0496112_0115473_1442_2065 | 207 |
| 574 | 3300048916 | Ga0496113_0000907 | Ga0496113_0000907_588_1223 | 207 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar