F465321

General Info

Members Datasets Scaffolds Average Seq Length
574 243 573 208

Family's Representative Sequence

Representative Sequence 3300037068|Ga0373925_0026308|Ga0373925_0026308_1570_2172
Length 200
Sequence MRKGFTRKPQADAPATLARNYITPSGLQRLKDEHQFLLTRERPAVVEVVAWAASNGDRSENADYQYGKRRLRQIDGRIRFLTKRIEAAEVVDPEAPRAGQAKTKTRAFFGATVRYANAAGAERVVSIVGTDEIDLNRNHISWVSPLGRALMKSAAGDSVVLQAPGGPEYLTVLEVCYQRVSVEPFREPPGSEASAKRVPR

Samples

Sample ID Description Type Environment
1 2884215851 Edaphobacter sp. 12200R-103 Isolate Rhizosphere
2 3300000546 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled Metagenome Rhizosphere
3 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
4 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
14 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
15 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
16 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
17 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
18 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
19 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
20 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
21 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
22 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
23 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
24 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
25 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
26 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
27 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
28 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
29 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
30 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
31 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
32 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
33 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
34 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
35 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
36 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
37 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
38 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
39 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
40 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
41 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
42 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
43 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
44 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
45 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
46 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
47 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
48 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
49 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
50 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
51 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
52 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
53 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
54 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
55 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
56 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
57 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
58 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
59 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
60 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
61 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
62 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
63 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
64 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
65 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
66 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
67 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
68 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
69 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
70 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
71 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
72 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
73 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
74 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
75 3300012478 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.9.old.080610 Metagenome Rhizosphere
76 3300012482 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.130510 Metagenome Rhizosphere
77 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
78 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
79 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
80 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
81 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
82 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
83 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
84 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
85 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
86 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
87 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
88 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
89 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
90 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
91 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
92 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
93 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
94 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
95 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300028017 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 Metagenome Rhizosphere
143 3300028023 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 Metagenome Rhizosphere
144 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
148 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
149 3300030763 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
150 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
151 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
152 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
153 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
154 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
155 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
156 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
157 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
158 3300033546 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE2 Metagenome Unclassified
159 3300033547 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE1 Metagenome Unclassified
160 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
161 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
162 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
163 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
164 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
165 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
166 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
167 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
168 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
169 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
170 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
171 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
172 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
173 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
174 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
175 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
176 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
177 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
178 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
179 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
180 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
181 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
182 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
183 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
184 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
185 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
186 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
187 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
188 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
189 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
190 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
191 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
192 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
193 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
194 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
195 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
196 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
197 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
198 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
199 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
200 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
201 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
202 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
203 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
204 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
205 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
206 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
207 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
208 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
209 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
210 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
211 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
212 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
213 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
214 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
215 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
216 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
217 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
218 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
219 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
220 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
221 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
222 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
223 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
224 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
225 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
226 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
227 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
228 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
229 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
230 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
231 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
232 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
233 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
234 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
235 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
236 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
237 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
238 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
239 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
240 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
241 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
242 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
243 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.65
Metatranscriptomes 0.17
Isolates 0.17

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.52
Nodule 0
Rhizoplane 4.36
Rhizosphere 93.55
Stem 0
Stem Tuber 0
Unclassified 1.57

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 LJNas_1000379 3300000546 Bacteria 7810
2 LJNas_1009679 3300000546 Bacteria 1030
3 rootH2_10047366 3300003320 Bacteria 7414
4 rootL2_10149945 3300003322 Bacteria 7238
5 Ga0070658_10219871 3300005327 Bacteria 1606
6 Ga0070683_100012931 3300005329 Bacteria 7266
7 Ga0070683_100090670 3300005329 Bacteria 2870
8 Ga0070690_100181545 3300005330 Bacteria 1454
9 Ga0068869_100073489 3300005334 Bacteria 2535
10 Ga0070666_10064026 3300005335 Bacteria 2493
11 Ga0070680_100037897 3300005336 Bacteria 3897
12 Ga0070682_100138802 3300005337 Bacteria 1654
13 Ga0070682_100161032 3300005337 Bacteria 1550
14 Ga0068868_100011939 3300005338 Bacteria 6337
15 Ga0068868_100025862 3300005338 Bacteria 4469
16 Ga0068868_100026776 3300005338 Bacteria 4397
17 Ga0068868_100059666 3300005338 Bacteria 3018
18 Ga0070689_100335502 3300005340 Bacteria 1265
19 Ga0070691_10315941 3300005341 Bacteria 858
20 Ga0070687_100072759 3300005343 Bacteria 1851
21 Ga0070661_100160316 3300005344 Bacteria 1703
22 Ga0070668_100037146 3300005347 Bacteria 3718
23 Ga0070668_100166168 3300005347 Bacteria 1793
24 Ga0070675_100316223 3300005354 Bacteria 1379
25 Ga0070671_100008953 3300005355 Bacteria 8033
26 Ga0070671_100214360 3300005355 Bacteria 1633
27 Ga0070671_100293083 3300005355 Bacteria 1385
28 Ga0070671_100919794 3300005355 Bacteria 764
29 Ga0070688_100247663 3300005365 Bacteria 1267
30 Ga0070709_10185312 3300005434 Bacteria 1464
31 Ga0070709_10264171 3300005434 Unclassified 1245
32 Ga0070709_10703400 3300005434 Bacteria 786
33 Ga0070714_100000096 3300005435 Bacteria 74616
34 Ga0070714_100111328 3300005435 Bacteria 2424
35 Ga0070714_100420921 3300005435 Bacteria 1265
36 Ga0070713_100002562 3300005436 Bacteria 11888
37 Ga0070713_100004256 3300005436 Bacteria 9572
38 Ga0070713_100012208 3300005436 Bacteria 6293
39 Ga0070713_100086922 3300005436 Bacteria 2681
40 Ga0070713_100349325 3300005436 Bacteria 1372
41 Ga0070713_100602692 3300005436 Bacteria 1044
42 Ga0070710_10002286 3300005437 Bacteria 9059
43 Ga0070701_10265072 3300005438 Bacteria 1043
44 Ga0070711_100006210 3300005439 Bacteria 7189
45 Ga0070711_100103485 3300005439 Bacteria 2075
46 Ga0070711_100181713 3300005439 Bacteria 1610
47 Ga0070700_100545959 3300005441 Bacteria 899
48 Ga0070678_100175711 3300005456 Bacteria 1748
49 Ga0070678_100233529 3300005456 Bacteria 1534
50 Ga0070662_100008074 3300005457 Bacteria 6851
51 Ga0070662_100032341 3300005457 Bacteria 3676
52 Ga0070681_10000147 3300005458 Bacteria 53398
53 Ga0070681_10051723 3300005458 Bacteria 4097
54 Ga0068867_100058040 3300005459 Bacteria 2868
55 Ga0070707_100126787 3300005468 Bacteria 2480
56 Ga0070679_100006558 3300005530 Bacteria 10845
57 Ga0070679_100045430 3300005530 Bacteria 4377
58 Ga0070679_100179066 3300005530 Bacteria 2092
59 Ga0070679_100235043 3300005530 Bacteria 1792
60 Ga0070679_100413891 3300005530 Bacteria 1293
61 Ga0070679_100570067 3300005530 Bacteria 1076
62 Ga0070684_100048222 3300005535 Unclassified 3695
63 Ga0070684_100146853 3300005535 Bacteria 2135
64 Ga0068853_100001002 3300005539 Bacteria 19900
65 Ga0068853_100007558 3300005539 Bacteria 8700
66 Ga0068853_100008705 3300005539 Bacteria 8163
67 Ga0068853_100015608 3300005539 Bacteria 6240
68 Ga0068853_100377051 3300005539 Bacteria 1324
69 Ga0068853_100401186 3300005539 Bacteria 1283
70 Ga0070686_100402374 3300005544 Bacteria 1041
71 Ga0070696_100360270 3300005546 Bacteria 1128
72 Ga0070693_100120020 3300005547 Bacteria 1629
73 Ga0070665_100037113 3300005548 Bacteria 4901
74 Ga0070665_100212429 3300005548 Bacteria 1935
75 Ga0070665_100264736 3300005548 Bacteria 1720
76 Ga0068855_100001009 3300005563 Bacteria 35131
77 Ga0068855_100030086 3300005563 Bacteria 6494
78 Ga0068855_100064251 3300005563 Bacteria 4280
79 Ga0068855_100082596 3300005563 Bacteria 3723
80 Ga0068855_100157926 3300005563 Bacteria 2576
81 Ga0068855_100202444 3300005563 Unclassified 2234
82 Ga0068855_100338191 3300005563 Bacteria 1660
83 Ga0068855_100464076 3300005563 Bacteria 1380
84 Ga0068855_100937603 3300005563 Bacteria 913
85 Ga0070664_100818152 3300005564 Bacteria 871
86 Ga0070664_101102190 3300005564 Bacteria 748
87 Ga0068857_100663978 3300005577 Bacteria 989
88 Ga0068854_100699788 3300005578 Bacteria 874
89 Ga0068856_100000609 3300005614 Bacteria 39156
90 Ga0068856_100000813 3300005614 Bacteria 33637
91 Ga0068856_100015336 3300005614 Bacteria 7405
92 Ga0068856_100041434 3300005614 Bacteria 4525
93 Ga0068856_100072459 3300005614 Bacteria 3410
94 Ga0068856_100084851 3300005614 Bacteria 3146
95 Ga0068856_100494149 3300005614 Bacteria 1244
96 Ga0070702_100098210 3300005615 Bacteria 1791
97 Ga0068852_100001161 3300005616 Bacteria 17422
98 Ga0068852_100003078 3300005616 Bacteria 11609
99 Ga0068852_100009777 3300005616 Bacteria 7130
100 Ga0068852_100130431 3300005616 Bacteria 2314
101 Ga0068852_100152870 3300005616 Bacteria 2148
102 Ga0068852_100155809 3300005616 Bacteria 2128
103 Ga0068852_100210657 3300005616 Bacteria 1844
104 Ga0068852_100401946 3300005616 Bacteria 1347
105 Ga0068852_100478929 3300005616 Bacteria 1236
106 Ga0068852_100529523 3300005616 Bacteria 1177
107 Ga0068859_100012318 3300005617 Bacteria 8604
108 Ga0068859_100030601 3300005617 Bacteria 5402
109 Ga0068864_100138961 3300005618 Bacteria 2190
110 Ga0068866_10041104 3300005718 Bacteria 2292
111 Ga0068851_10018526 3300005834 Bacteria 3354
112 Ga0068863_100542662 3300005841 Bacteria 1147
113 Ga0068858_100052858 3300005842 Bacteria 3759
114 Ga0068858_100072019 3300005842 Bacteria 3206
115 Ga0068860_100001835 3300005843 Bacteria 22636
116 Ga0068862_100115746 3300005844 Bacteria 2358
117 Ga0081455_10092103 3300005937 Bacteria 2453
118 Ga0070717_10027515 3300006028 Bacteria 4545
119 Ga0070717_10030111 3300006028 Bacteria 4360
120 Ga0070717_10222965 3300006028 Bacteria 1658
121 Ga0070717_10317545 3300006028 Bacteria 1387
122 Ga0070717_10327614 3300006028 Bacteria 1366
123 Ga0070717_10373605 3300006028 Bacteria 1278
124 Ga0070715_10001567 3300006163 Bacteria 6707
125 Ga0070715_10012648 3300006163 Bacteria 3079
126 Ga0070716_100026301 3300006173 Bacteria 3115
127 Ga0070716_100115093 3300006173 Bacteria 1673
128 Ga0070712_100000340 3300006175 Bacteria 26355
129 Ga0070712_100002911 3300006175 Bacteria 10608
130 Ga0070712_100009532 3300006175 Bacteria 6124
131 Ga0070712_100073305 3300006175 Bacteria 2455
132 Ga0070712_100107863 3300006175 Bacteria 2072
133 Ga0097621_100000060 3300006237 Bacteria 56661
134 Ga0097621_100001157 3300006237 Bacteria 18331
135 Ga0097621_100040541 3300006237 Bacteria 3744
136 Ga0097621_100078645 3300006237 Bacteria 2740
137 Ga0097621_100356356 3300006237 Bacteria 1302
138 Ga0068871_100000190 3300006358 Bacteria 41980
139 Ga0068871_100004608 3300006358 Bacteria 9623
140 Ga0068871_100012840 3300006358 Bacteria 6201
141 Ga0068871_100014953 3300006358 Bacteria 5802
142 Ga0068871_100021610 3300006358 Unclassified 4948
143 Ga0068871_100093201 3300006358 Bacteria 2512
144 Ga0068871_100275825 3300006358 Bacteria 1470
145 Ga0075433_10022380 3300006852 Bacteria 5306
146 Ga0068865_100104573 3300006881 Bacteria 2078
147 Ga0075436_100008762 3300006914 Bacteria 6917
148 Ga0097620_100012320 3300006931 Bacteria 8604
149 Ga0097620_100030601 3300006931 Bacteria 5402
150 Ga0105240_10000002 3300009093 Bacteria 1924170
151 Ga0105240_10000213 3300009093 Bacteria 117084
152 Ga0105240_10000683 3300009093 Bacteria 62430
153 Ga0105240_10002547 3300009093 Bacteria 29224
154 Ga0105240_10008749 3300009093 Bacteria 14433
155 Ga0105240_10014750 3300009093 Bacteria 10660
156 Ga0105240_10031044 3300009093 Bacteria 6934
157 Ga0105240_10093628 3300009093 Bacteria 3667
158 Ga0105240_10148738 3300009093 Bacteria 2791
159 Ga0105240_10171859 3300009093 Bacteria 2566
160 Ga0105240_10281083 3300009093 Bacteria 1912
161 Ga0105240_10841802 3300009093 Bacteria 991
162 Ga0105245_10004131 3300009098 Bacteria 12896
163 Ga0105245_10025954 3300009098 Bacteria 5154
164 Ga0105245_10051029 3300009098 Bacteria 3708
165 Ga0105245_10511140 3300009098 Bacteria 1218
166 Ga0105241_10000055 3300009174 Bacteria 86842
167 Ga0105241_10000338 3300009174 Bacteria 35475
168 Ga0105241_10007684 3300009174 Bacteria 7927
169 Ga0105241_10049438 3300009174 Bacteria 3202
170 Ga0105241_10202162 3300009174 Bacteria 1660
171 Ga0105241_10292669 3300009174 Bacteria 1395
172 Ga0105242_10441410 3300009176 Bacteria 1225
173 Ga0105242_11233311 3300009176 Bacteria 768
174 Ga0105248_10001001 3300009177 Bacteria 31244
175 Ga0105248_10004472 3300009177 Bacteria 15471
176 Ga0105248_10018174 3300009177 Bacteria 7764
177 Ga0105248_10456599 3300009177 Bacteria 1440
178 Ga0105248_10628240 3300009177 Bacteria 1212
179 Ga0105248_11255223 3300009177 Bacteria 838
180 Ga0105237_10043368 3300009545 Bacteria 4532
181 Ga0105237_10124815 3300009545 Bacteria 2569
182 Ga0105237_10174603 3300009545 Bacteria 2149
183 Ga0105237_10175557 3300009545 Bacteria 2143
184 Ga0105237_10182162 3300009545 Bacteria 2100
185 Ga0105237_11105553 3300009545 Bacteria 799
186 Ga0105238_10000352 3300009551 Bacteria 49426
187 Ga0105238_10012644 3300009551 Bacteria 8519
188 Ga0105238_10074609 3300009551 Bacteria 3384
189 Ga0105238_10271324 3300009551 Bacteria 1677
190 Ga0105249_10015382 3300009553 Bacteria 6771
191 Ga0105249_10528645 3300009553 Bacteria 1228
192 Ga0105239_10000375 3300010375 Bacteria 65248
193 Ga0105239_10008308 3300010375 Bacteria 11833
194 Ga0105239_10134156 3300010375 Bacteria 2755
195 Ga0105239_10405556 3300010375 Bacteria 1543
196 Ga0105239_11156770 3300010375 Bacteria 891
197 Ga0157328_1003686 3300012478 Bacteria 814
198 Ga0157318_1005835 3300012482 Bacteria 795
199 Ga0157373_10003804 3300013100 Bacteria 11413
200 Ga0157373_10119358 3300013100 Bacteria 1853
201 Ga0157371_10061088 3300013102 Bacteria 2672
202 Ga0157371_10363751 3300013102 Bacteria 1054
203 Ga0157370_10000058 3300013104 Bacteria 117088
204 Ga0157370_10173291 3300013104 Bacteria 2005
205 Ga0157370_10210341 3300013104 Bacteria 1803
206 Ga0157370_10544957 3300013104 Bacteria 1064
207 Ga0157369_10000381 3300013105 Bacteria 58704
208 Ga0157369_10003399 3300013105 Bacteria 18886
209 Ga0157369_10005526 3300013105 Bacteria 14679
210 Ga0157369_10006528 3300013105 Bacteria 13515
211 Ga0157369_10024476 3300013105 Bacteria 6716
212 Ga0157369_10029828 3300013105 Bacteria 6024
213 Ga0157369_10039943 3300013105 Bacteria 5126
214 Ga0157369_10173049 3300013105 Bacteria 2274
215 Ga0157369_10412199 3300013105 Bacteria 1401
216 Ga0157369_10444925 3300013105 Bacteria 1342
217 Ga0157374_10000355 3300013296 Bacteria 42412
218 Ga0157374_10000359 3300013296 Bacteria 42233
219 Ga0157374_10006940 3300013296 Bacteria 9635
220 Ga0157374_10015562 3300013296 Bacteria 6674
221 Ga0157374_10108295 3300013296 Bacteria 2671
222 Ga0157374_10449680 3300013296 Bacteria 1289
223 Ga0157378_10000092 3300013297 Bacteria 85705
224 Ga0157378_10021416 3300013297 Bacteria 5684
225 Ga0157378_10073962 3300013297 Bacteria 3065
226 Ga0157378_10188086 3300013297 Bacteria 1946
227 Ga0163162_10004569 3300013306 Bacteria 13336
228 Ga0157372_10000282 3300013307 Bacteria 56474
229 Ga0157372_10000622 3300013307 Bacteria 38721
230 Ga0157372_10001281 3300013307 Bacteria 27187
231 Ga0157372_10011608 3300013307 Bacteria 9378
232 Ga0157372_10032062 3300013307 Bacteria 5758
233 Ga0157372_10058079 3300013307 Bacteria 4324
234 Ga0157372_10082716 3300013307 Bacteria 3635
235 Ga0157372_10100095 3300013307 Bacteria 3307
236 Ga0157372_10129498 3300013307 Bacteria 2902
237 Ga0157372_10169751 3300013307 Bacteria 2524
238 Ga0157372_10223956 3300013307 Bacteria 2180
239 Ga0157372_10620941 3300013307 Bacteria 1259
240 Ga0157372_10832459 3300013307 Bacteria 1072
241 Ga0157375_10049389 3300013308 Bacteria 4122
242 Ga0157375_10364669 3300013308 Bacteria 1611
243 Ga0163163_10015690 3300014325 Bacteria 7013
244 Ga0163163_10092292 3300014325 Bacteria 3043
245 Ga0163163_10110674 3300014325 Bacteria 2775
246 Ga0182008_10024969 3300014497 Bacteria 3040
247 Ga0157377_10049749 3300014745 Bacteria 2357
248 Ga0157376_10054623 3300014969 Bacteria 3331
249 Ga0157376_10118789 3300014969 Bacteria 2340
250 Ga0182006_1037350 3300015261 Bacteria 1926
251 Ga0163161_10026127 3300017792 Bacteria 4136
252 Ga0224572_1006047 3300024225 Bacteria 2177
253 Ga0228598_1000450 3300024227 Bacteria 8387
254 Ga0228598_1007264 3300024227 Bacteria 2260
255 Ga0209233_1020613 3300025261 Bacteria 1725
256 Ga0207697_10010658 3300025315 Bacteria 3922
257 Ga0207656_10104674 3300025321 Bacteria 1301
258 Ga0207692_10081280 3300025898 Bacteria 1734
259 Ga0207692_10421609 3300025898 Bacteria 836
260 Ga0207680_10092685 3300025903 Bacteria 1925
261 Ga0207647_10036189 3300025904 Bacteria 3138
262 Ga0207699_10206531 3300025906 Unclassified 1334
263 Ga0207705_10401801 3300025909 Bacteria 1060
264 Ga0207654_10000027 3300025911 Bacteria 132519
265 Ga0207654_10022696 3300025911 Bacteria 3352
266 Ga0207654_10109197 3300025911 Bacteria 1718
267 Ga0207654_10126544 3300025911 Bacteria 1612
268 Ga0207654_10216082 3300025911 Bacteria 1269
269 Ga0207654_10436412 3300025911 Bacteria 916
270 Ga0207707_10001984 3300025912 Bacteria 18596
271 Ga0207707_10028982 3300025912 Bacteria 4838
272 Ga0207707_10171917 3300025912 Bacteria 1893
273 Ga0207695_10000002 3300025913 Bacteria 2188391
274 Ga0207695_10000108 3300025913 Bacteria 252306
275 Ga0207695_10000191 3300025913 Bacteria 174087
276 Ga0207695_10000345 3300025913 Bacteria 107062
277 Ga0207695_10003674 3300025913 Bacteria 21393
278 Ga0207695_10004974 3300025913 Bacteria 17893
279 Ga0207695_10006642 3300025913 Bacteria 14932
280 Ga0207695_10007323 3300025913 Bacteria 14091
281 Ga0207695_10008737 3300025913 Bacteria 12632
282 Ga0207695_10011641 3300025913 Bacteria 10632
283 Ga0207695_10011737 3300025913 Bacteria 10580
284 Ga0207695_10037748 3300025913 Bacteria 5210
285 Ga0207695_10050035 3300025913 Bacteria 4399
286 Ga0207695_10116776 3300025913 Bacteria 2642
287 Ga0207695_10234074 3300025913 Bacteria 1740
288 Ga0207695_10472848 3300025913 Unclassified 1136
289 Ga0207695_10636787 3300025913 Bacteria 947
290 Ga0207671_10051482 3300025914 Bacteria 3052
291 Ga0207671_10111175 3300025914 Bacteria 2084
292 Ga0207671_10175256 3300025914 Bacteria 1667
293 Ga0207671_10207195 3300025914 Bacteria 1533
294 Ga0207693_10000182 3300025915 Bacteria 57166
295 Ga0207693_10003469 3300025915 Bacteria 13455
296 Ga0207693_10005077 3300025915 Bacteria 11041
297 Ga0207693_10010767 3300025915 Bacteria 7425
298 Ga0207693_10081981 3300025915 Bacteria 2526
299 Ga0207663_10002131 3300025916 Bacteria 9442
300 Ga0207663_10033331 3300025916 Bacteria 3068
301 Ga0207663_10116830 3300025916 Bacteria 1819
302 Ga0207660_10214837 3300025917 Bacteria 1507
303 Ga0207662_10008307 3300025918 Bacteria 5684
304 Ga0207657_10004189 3300025919 Bacteria 15285
305 Ga0207649_10458610 3300025920 Bacteria 963
306 Ga0207652_10007447 3300025921 Bacteria 8820
307 Ga0207652_10008176 3300025921 Bacteria 8401
308 Ga0207652_10113121 3300025921 Bacteria 2409
309 Ga0207652_10214149 3300025921 Bacteria 1735
310 Ga0207646_10614531 3300025922 Bacteria 975
311 Ga0207694_10000160 3300025924 Bacteria 68770
312 Ga0207694_10000380 3300025924 Bacteria 41390
313 Ga0207694_10001976 3300025924 Bacteria 16968
314 Ga0207694_10103208 3300025924 Bacteria 2261
315 Ga0207694_10130475 3300025924 Bacteria 2014
316 Ga0207694_10202570 3300025924 Bacteria 1615
317 Ga0207694_10385172 3300025924 Bacteria 1164
318 Ga0207650_10000646 3300025925 Bacteria 27701
319 Ga0207687_10002812 3300025927 Bacteria 11803
320 Ga0207687_10047561 3300025927 Bacteria 2974
321 Ga0207687_10670123 3300025927 Bacteria 879
322 Ga0207700_10001771 3300025928 Bacteria 12242
323 Ga0207700_10001960 3300025928 Bacteria 11710
324 Ga0207700_10014215 3300025928 Bacteria 5209
325 Ga0207700_10029540 3300025928 Unclassified 3869
326 Ga0207700_10215535 3300025928 Unclassified 1625
327 Ga0207700_10550893 3300025928 Bacteria 1024
328 Ga0207700_10578386 3300025928 Bacteria 999
329 Ga0207664_10000087 3300025929 Bacteria 88607
330 Ga0207664_10011722 3300025929 Bacteria 6247
331 Ga0207664_10019681 3300025929 Bacteria 4994
332 Ga0207664_10089269 3300025929 Bacteria 2524
333 Ga0207664_10532058 3300025929 Bacteria 1054
334 Ga0207644_10011846 3300025931 Bacteria 5778
335 Ga0207644_10106095 3300025931 Bacteria 2117
336 Ga0207644_10814938 3300025931 Bacteria 781
337 Ga0207690_10164848 3300025932 Bacteria 1655
338 Ga0207690_10207049 3300025932 Bacteria 1493
339 Ga0207670_10275551 3300025936 Bacteria 1309
340 Ga0207665_10019839 3300025939 Bacteria 4418
341 Ga0207711_10000859 3300025941 Bacteria 29394
342 Ga0207711_10008695 3300025941 Bacteria 8495
343 Ga0207711_10108839 3300025941 Bacteria 2462
344 Ga0207661_10061674 3300025944 Bacteria 3030
345 Ga0207661_10194615 3300025944 Unclassified 1779
346 Ga0207661_10291723 3300025944 Bacteria 1460
347 Ga0207679_10072043 3300025945 Bacteria 2609
348 Ga0207679_10132082 3300025945 Bacteria 2005
349 Ga0207667_10000377 3300025949 Bacteria 60367
350 Ga0207667_10000541 3300025949 Bacteria 49932
351 Ga0207667_10002508 3300025949 Bacteria 22889
352 Ga0207667_10005182 3300025949 Bacteria 15920
353 Ga0207667_10005696 3300025949 Bacteria 15191
354 Ga0207667_10026110 3300025949 Bacteria 6386
355 Ga0207667_10037489 3300025949 Bacteria 5181
356 Ga0207667_10074069 3300025949 Bacteria 3537
357 Ga0207667_10527768 3300025949 Bacteria 1195
358 Ga0207712_10006856 3300025961 Bacteria 7191
359 Ga0207668_10004431 3300025972 Bacteria 8246
360 Ga0207640_10230126 3300025981 Bacteria 1425
361 Ga0207640_10243147 3300025981 Bacteria 1392
362 Ga0207658_10473736 3300025986 Bacteria 1112
363 Ga0207677_10014728 3300026023 Bacteria 4578
364 Ga0207677_10015197 3300026023 Bacteria 4519
365 Ga0207677_10025642 3300026023 Bacteria 3681
366 Ga0207677_10030966 3300026023 Bacteria 3422
367 Ga0207703_10028925 3300026035 Bacteria 4374
368 Ga0207703_10069711 3300026035 Bacteria 2900
369 Ga0207639_10000145 3300026041 Bacteria 53212
370 Ga0207639_10022054 3300026041 Bacteria 4583
371 Ga0207639_10121907 3300026041 Bacteria 2144
372 Ga0207639_10253394 3300026041 Bacteria 1536
373 Ga0207639_11173652 3300026041 Bacteria 720
374 Ga0207678_10083540 3300026067 Bacteria 2731
375 Ga0207702_10000175 3300026078 Bacteria 77336
376 Ga0207702_10000561 3300026078 Bacteria 41319
377 Ga0207702_10000583 3300026078 Bacteria 40507
378 Ga0207702_10009227 3300026078 Bacteria 8292
379 Ga0207702_10049937 3300026078 Bacteria 3531
380 Ga0207702_10277235 3300026078 Bacteria 1584
381 Ga0207702_10297313 3300026078 Bacteria 1531
382 Ga0207702_10323065 3300026078 Bacteria 1470
383 Ga0207702_10696498 3300026078 Bacteria 1001
384 Ga0207641_10000021 3300026088 Bacteria 279851
385 Ga0207641_10114978 3300026088 Bacteria 2392
386 Ga0207641_10204079 3300026088 Bacteria 1824
387 Ga0207648_10049988 3300026089 Bacteria 3657
388 Ga0207676_10000518 3300026095 Bacteria 32418
389 Ga0207676_10161373 3300026095 Bacteria 1942
390 Ga0207674_10010667 3300026116 Bacteria 10390
391 Ga0207698_10000070 3300026142 Bacteria 68316
392 Ga0207698_10016707 3300026142 Bacteria 4956
393 Ga0207698_10232460 3300026142 Bacteria 1675
394 Ga0207698_10242551 3300026142 Bacteria 1643
395 Ga0207698_10378255 3300026142 Bacteria 1346
396 Ga0209179_1059039 3300027512 Bacteria 831
397 Ga0265356_1000510 3300028017 Bacteria 7028
398 Ga0265357_1003443 3300028023 Bacteria 1372
399 Ga0268266_10001930 3300028379 Bacteria 23319
400 Ga0268266_10003145 3300028379 Bacteria 16767
401 Ga0268266_10050140 3300028379 Bacteria 3581
402 Ga0268266_10072994 3300028379 Bacteria 2977
403 Ga0268266_10165283 3300028379 Bacteria 2004
404 Ga0268266_10571379 3300028379 Bacteria 1084
405 Ga0268266_10888826 3300028379 Bacteria 861
406 Ga0268265_10108992 3300028380 Bacteria 2256
407 Ga0268264_10006325 3300028381 Bacteria 9983
408 Ga0268264_10036874 3300028381 Bacteria 4029
409 Ga0265326_10033438 3300028558 Bacteria 1463
410 Ga0265338_10001846 3300028800 Bacteria 33258
411 Ga0265338_10054622 3300028800 Unclassified 3559
412 Ga0265338_10111851 3300028800 Bacteria 2197
413 Ga0265338_10126385 3300028800 Bacteria 2028
414 Ga0265338_10150625 3300028800 Bacteria 1808
415 Ga0265763_1001508 3300030763 Bacteria 1675
416 Ga0265330_10004432 3300031235 Bacteria 7128
417 Ga0265330_10169623 3300031235 Bacteria 926
418 Ga0265340_10009761 3300031247 Bacteria 5145
419 Ga0265340_10051251 3300031247 Bacteria 1999
420 Ga0265340_10368601 3300031247 Bacteria 634
421 Ga0265339_10000214 3300031249 Bacteria 47430
422 Ga0265339_10002593 3300031249 Bacteria 12899
423 Ga0265339_10027784 3300031249 Bacteria 3223
424 Ga0265316_10007178 3300031344 Bacteria 10527
425 Ga0265316_10572490 3300031344 Bacteria 802
426 Ga0265313_10038907 3300031595 Bacteria 2364
427 Ga0265314_10002820 3300031711 Bacteria 17337
428 Ga0265314_10034888 3300031711 Bacteria 3671
429 Ga0265314_10144950 3300031711 Bacteria 1464
430 Ga0265314_10264902 3300031711 Bacteria 979
431 Ga0265314_10294734 3300031711 Bacteria 912
432 Ga0265342_10000979 3300031712 Bacteria 28284
433 Ga0265342_10050049 3300031712 Bacteria 2498
434 Ga0265342_10084011 3300031712 Bacteria 1834
435 Ga0265342_10096345 3300031712 Bacteria 1691
436 Ga0307510_10036230 3300033180 Bacteria 5494
437 Ga0307510_10064651 3300033180 Bacteria 3714
438 Ga0316213_1003734 3300033546 Bacteria 1007
439 Ga0316212_1002904 3300033547 Bacteria 2460
440 Ga0373928_0074654 3300035084 Bacteria 845
441 Ga0373934_0030138 3300035086 Bacteria 2121
442 Ga0373923_0189539 3300035111 Bacteria 947
443 Ga0373936_0008282 3300035113 Bacteria 3909
444 Ga0373941_0090618 3300035115 Bacteria 1048
445 Ga0373945_0003446 3300035116 Bacteria 4974
446 Ga0373943_0002800 3300035170 Bacteria 7927
447 Ga0373943_0100598 3300035170 Bacteria 1511
448 Ga0373946_0029158 3300035171 Bacteria 2194
449 Ga0373955_0102027 3300035172 Bacteria 1648
450 Ga0373962_0192348 3300035242 Bacteria 687
451 Ga0373931_0037689 3300035691 Bacteria 2524
452 Ga0373935_0015243 3300035692 Bacteria 4644
453 Ga0373935_0113767 3300035692 Bacteria 1799
454 Ga0373927_0010054 3300035695 Bacteria 6334
455 Ga0373927_0022049 3300035695 Bacteria 4174
456 Ga0373927_0472480 3300035695 Bacteria 828
457 Ga0373933_0019579 3300035724 Bacteria 3824
458 Ga0373933_0041075 3300035724 Bacteria 2729
459 Ga0373933_0046964 3300035724 Bacteria 2566
460 Ga0373947_0003669 3300035725 Bacteria 9058
461 Ga0373947_0009334 3300035725 Bacteria 5637
462 Ga0373947_0036081 3300035725 Bacteria 2930
463 Ga0373947_0192283 3300035725 Bacteria 1332
464 Ga0373947_0425614 3300035725 Bacteria 897
465 Ga0373937_0097862 3300036401 Bacteria 2721
466 Ga0373937_0119299 3300036401 Bacteria 2457
467 Ga0373937_0438269 3300036401 Bacteria 1240
468 Ga0373937_0988024 3300036401 Bacteria 790
469 Ga0373925_0002473 3300037068 Bacteria 14771
470 Ga0373925_0026308 3300037068 Bacteria 4258
471 Ga0373925_0069717 3300037068 Bacteria 2656
472 Ga0373925_0072838 3300037068 Bacteria 2599
473 Ga0373925_0127488 3300037068 Bacteria 1981
474 Ga0395898_0137829 3300037466 Bacteria 2336
475 Ga0436364_0176799 3300037853 Bacteria 1091
476 Ga0436360_1073532 3300039438 Bacteria 729
477 Ga0436362_0325737 3300039453 Bacteria 1032
478 Ga0436362_0698378 3300039453 Bacteria 907
479 Ga0451577_0030308 3300042876 Bacteria 4888
480 Ga0466961_0073960 3300044693 Bacteria 2161
481 Ga0453684_0567019 3300044712 Bacteria 1248
482 Ga0466957_0165821 3300044842 Bacteria 1437
483 Ga0466958_0088139 3300045836 Bacteria 1917
484 Ga0466958_0485978 3300045836 Bacteria 801
485 Ga0466967_0004914 3300045976 Bacteria 9135
486 Ga0495603_0157041 3300046455 Bacteria 1320
487 Ga0495638_0459686 3300046460 Bacteria 648
488 Ga0495650_0000037 3300046471 Bacteria 390090
489 Ga0495580_0016785 3300046472 Bacteria 5493
490 Ga0495580_0022128 3300046472 Bacteria 4683
491 Ga0495580_0134650 3300046472 Bacteria 1713
492 Ga0495580_0294210 3300046472 Bacteria 1106
493 Ga0495582_0007999 3300046473 Bacteria 5840
494 Ga0495664_0031494 3300046477 Bacteria 3110
495 Ga0495664_0307225 3300046477 Bacteria 957
496 Ga0495628_0187436 3300046516 Bacteria 1563
497 Ga0495628_0229236 3300046516 Bacteria 1393
498 Ga0495630_0174937 3300046517 Bacteria 1636
499 Ga0495630_0262137 3300046517 Bacteria 1320
500 Ga0495643_0205784 3300046522 Bacteria 942
501 Ga0495642_0115027 3300046528 Bacteria 1152
502 Ga0495652_0063290 3300046529 Bacteria 3115
503 Ga0495665_0063330 3300046531 Bacteria 1952
504 Ga0495640_0468915 3300046533 Bacteria 768
505 Ga0495645_0058556 3300046543 Bacteria 2795
506 Ga0495645_0301373 3300046543 Bacteria 1047
507 Ga0495622_0243692 3300046557 Bacteria 792
508 Ga0495635_0247268 3300046663 Bacteria 1203
509 Ga0495599_0038192 3300046678 Bacteria 3017
510 Ga0495623_0096380 3300046679 Bacteria 1808
511 Ga0495623_0149655 3300046679 Bacteria 1381
512 Ga0495658_0047416 3300046683 Bacteria 2420
513 Ga0495613_0036282 3300046689 Bacteria 3656
514 Ga0495613_0136057 3300046689 Bacteria 1758
515 Ga0495613_0213931 3300046689 Bacteria 1355
516 Ga0495613_0404221 3300046689 Bacteria 931
517 Ga0495624_0095541 3300046690 Bacteria 1832
518 Ga0495581_0068294 3300047315 Unclassified 2055
519 Ga0495604_0041478 3300047317 Bacteria 3610
520 Ga0495604_0171537 3300047317 Bacteria 1525
521 Ga0495604_0232699 3300047317 Bacteria 1263
522 Ga0495674_0038308 3300047319 Bacteria 4304
523 Ga0495674_0039914 3300047319 Bacteria 4203
524 Ga0495675_0010036 3300047444 Bacteria 5907
525 Ga0495677_0114965 3300047445 Bacteria 1024
526 Ga0495684_0250216 3300047471 Bacteria 1290
527 Ga0495686_0003149 3300047472 Bacteria 14557
528 Ga0495686_0005279 3300047472 Bacteria 10252
529 Ga0495614_0315535 3300048089 Bacteria 724
530 Ga0496100_0038390 3300048903 Bacteria 3034
531 Ga0496101_0008468 3300048904 Bacteria 6720
532 Ga0496103_0091131 3300048906 Bacteria 1924
533 Ga0496104_0022458 3300048907 Bacteria 5797
534 Ga0496104_0035730 3300048907 Bacteria 4641
535 Ga0496104_0221087 3300048907 Bacteria 1806
536 Ga0496104_0293923 3300048907 Unclassified 1537
537 Ga0496104_0390569 3300048907 Bacteria 1304
538 Ga0496104_0451345 3300048907 Bacteria 1197
539 Ga0496105_0217857 3300048908 Bacteria 1554
540 Ga0496107_0165218 3300048910 Bacteria 1641
541 Ga0496109_0374465 3300048912 Bacteria 1345
542 Ga0496111_0004189 3300048914 Bacteria 9075
543 Ga0496112_0000053 3300048915 Bacteria 79985
544 Ga0496112_0002677 3300048915 Bacteria 14405
545 Ga0496112_0041254 3300048915 Bacteria 4514
546 Ga0496112_0071931 3300048915 Bacteria 3418
547 Ga0496112_0115473 3300048915 Bacteria 2655
548 Ga0496112_0787109 3300048915 Bacteria 876
549 Ga0496113_0000907 3300048916 Bacteria 15648
550 Ga0496113_0025323 3300048916 Bacteria 4228
551 Ga0496114_0006722 3300048917 Bacteria 9061
552 Ga0496114_0139469 3300048917 Bacteria 2098
553 Ga0496115_0013978 3300048918 Bacteria 6076
554 Ga0496115_0248589 3300048918 Bacteria 1465
555 Ga0496126_0001110 3300048929 Bacteria 45105
556 Ga0496126_0016479 3300048929 Bacteria 7386
557 Ga0501032_0156464 3300049569 Bacteria 1497
558 Ga0501033_0357396 3300049570 Bacteria 1022
559 Ga0501034_0323325 3300049571 Bacteria 1475
560 Ga0501036_0163829 3300049572 Bacteria 1874
561 Ga0501037_0207923 3300049573 Bacteria 1381
562 Ga0501043_0142786 3300049579 Bacteria 1874
563 Ga0501047_0102299 3300049581 Bacteria 2744
564 Ga0501073_0197651 3300049589 Bacteria 1391
565 Ga0501080_0360705 3300049742 Bacteria 1311
566 Ga0501044_0000314 3300049823 Bacteria 61262
567 Ga0501044_0110697 3300049823 Bacteria 2754
568 nmdc:mga08x19_3469_c1 3300050514 Bacteria 9399
569 Ga0495612_0133302 3300053078 Bacteria 1074
570 Ga0495619_0311402 3300053085 Bacteria 1090
571 Ga0501084_0701432 3300054114 Bacteria 853
572 Ga0500661_016817 3300055283 Bacteria 1307
573 Ga0500661_036370 3300055283 Bacteria 871

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300035725 Ga0373947_0009334 Ga0373947_0009334_5037_5627 181
2 3300037068 Ga0373925_0069717 Ga0373925_0069717_314_904 181
3 3300046517 Ga0495630_0262137 Ga0495630_0262137_88_678 181
4 3300028379 Ga0268266_10003145 Ga0268266_100031458 187
5 3300031249 Ga0265339_10000214 Ga0265339_1000021420 189
6 3300031712 Ga0265342_10000979 Ga0265342_100009796 189
7 iso_pu_bacteria 2884215851 2884219363 192
8 3300014497 Ga0182008_10024969 Ga0182008_100249692 195
9 3300015261 Ga0182006_1037350 Ga0182006_10373502 195
10 3300003320 rootH2_10047366 rootH2_100473662 196
11 3300005530 Ga0070679_100413891 Ga0070679_1004138912 196
12 3300005563 Ga0068855_100338191 Ga0068855_1003381913 196
13 3300005616 Ga0068852_100529523 Ga0068852_1005295232 196
14 3300010375 Ga0105239_11156770 Ga0105239_111567701 196
15 3300013307 Ga0157372_10129498 Ga0157372_101294985 196
16 3300025920 Ga0207649_10458610 Ga0207649_104586102 196
17 3300025924 Ga0207694_10385172 Ga0207694_103851722 196
18 3300025932 Ga0207690_10164848 Ga0207690_101648482 196
19 3300025949 Ga0207667_10527768 Ga0207667_105277681 196
20 3300026142 Ga0207698_10232460 Ga0207698_102324602 196
21 3300031711 Ga0265314_10144950 Ga0265314_101449502 196
22 3300033180 Ga0307510_10036230 Ga0307510_100362306 196
23 3300042876 Ga0451577_0030308 Ga0451577_0030308_219_842 196
24 3300044712 Ga0453684_0567019 Ga0453684_0567019_26_649 196
25 3300046460 Ga0495638_0459686 Ga0495638_0459686_11_601 196
26 3300047315 Ga0495581_0068294 Ga0495581_0068294_745_1419 196
27 3300047317 Ga0495604_0232699 Ga0495604_0232699_183_779 196
28 3300047472 Ga0495686_0003149 Ga0495686_0003149_4662_5252 196
29 3300048929 Ga0496126_0001110 Ga0496126_0001110_13361_13951 196
30 3300055283 Ga0500661_016817 Ga0500661_016817_608_1198 196
31 3300009093 Ga0105240_10000002 Ga0105240_100000021294 197
32 3300013307 Ga0157372_10032062 Ga0157372_100320622 197
33 3300025913 Ga0207695_10000002 Ga0207695_100000021297 197
34 3300025929 Ga0207664_10532058 Ga0207664_105320581 197
35 3300003322 rootL2_10149945 rootL2_101499453 198
36 3300005539 Ga0068853_100008705 Ga0068853_1000087059 198
37 3300005937 Ga0081455_10092103 Ga0081455_100921034 198
38 3300006358 Ga0068871_100275825 Ga0068871_1002758251 198
39 3300013105 Ga0157369_10005526 Ga0157369_100055267 198
40 3300013307 Ga0157372_10169751 Ga0157372_101697513 198
41 3300025945 Ga0207679_10072043 Ga0207679_100720433 198
42 3300026041 Ga0207639_10022054 Ga0207639_100220542 198
43 3300026142 Ga0207698_10378255 Ga0207698_103782551 198
44 3300028379 Ga0268266_10001930 Ga0268266_1000193013 198
45 3300031247 Ga0265340_10368601 Ga0265340_103686011 198
46 3300033180 Ga0307510_10064651 Ga0307510_100646516 198
47 3300035170 Ga0373943_0100598 Ga0373943_0100598_390_1055 198
48 3300035725 Ga0373947_0425614 Ga0373947_0425614_244_846 198
49 3300037068 Ga0373925_0026308 Ga0373925_0026308_1570_2172 198
50 3300046471 Ga0495650_0000037 Ga0495650_0000037_29397_29999 198
51 3300046689 Ga0495613_0036282 Ga0495613_0036282_2620_3285 198
52 3300046689 Ga0495613_0213931 Ga0495613_0213931_50_736 198
53 3300047472 Ga0495686_0005279 Ga0495686_0005279_5956_6555 198
54 3300048907 Ga0496104_0221087 Ga0496104_0221087_731_1327 198
55 3300048910 Ga0496107_0165218 Ga0496107_0165218_909_1595 198
56 3300048917 Ga0496114_0139469 Ga0496114_0139469_272_868 198
57 3300055283 Ga0500661_036370 Ga0500661_036370_244_840 198
58 3300005355 Ga0070671_100919794 Ga0070671_1009197942 199
59 3300005436 Ga0070713_100349325 Ga0070713_1003493252 199
60 3300005548 Ga0070665_100264736 Ga0070665_1002647363 199
61 3300005564 Ga0070664_101102190 Ga0070664_1011021901 199
62 3300005578 Ga0068854_100699788 Ga0068854_1006997881 199
63 3300005614 Ga0068856_100494149 Ga0068856_1004941492 199
64 3300005616 Ga0068852_100210657 Ga0068852_1002106572 199
65 3300009093 Ga0105240_10841802 Ga0105240_108418021 199
66 3300009545 Ga0105237_10174603 Ga0105237_101746032 199
67 3300009553 Ga0105249_10528645 Ga0105249_105286452 199
68 3300013104 Ga0157370_10173291 Ga0157370_101732912 199
69 3300013105 Ga0157369_10029828 Ga0157369_100298282 199
70 3300013307 Ga0157372_10620941 Ga0157372_106209412 199
71 3300014325 Ga0163163_10110674 Ga0163163_101106743 199
72 3300025913 Ga0207695_10011641 Ga0207695_100116416 199
73 3300025915 Ga0207693_10005077 Ga0207693_100050774 199
74 3300025928 Ga0207700_10029540 Ga0207700_100295403 199
75 3300025931 Ga0207644_10814938 Ga0207644_108149381 199
76 3300025981 Ga0207640_10230126 Ga0207640_102301262 199
77 3300026041 Ga0207639_10121907 Ga0207639_101219073 199
78 3300026078 Ga0207702_10696498 Ga0207702_106964981 199
79 3300026142 Ga0207698_10242551 Ga0207698_102425511 199
80 3300028379 Ga0268266_10165283 Ga0268266_101652833 199
81 3300048907 Ga0496104_0035730 Ga0496104_0035730_187_786 199
82 3300048915 Ga0496112_0041254 Ga0496112_0041254_291_890 199
83 3300048916 Ga0496113_0025323 Ga0496113_0025323_431_1030 199
84 3300005337 Ga0070682_100138802 Ga0070682_1001388022 200
85 3300005338 Ga0068868_100026776 Ga0068868_1000267766 200
86 3300005341 Ga0070691_10315941 Ga0070691_103159411 200
87 3300005344 Ga0070661_100160316 Ga0070661_1001603162 200
88 3300005347 Ga0070668_100166168 Ga0070668_1001661682 200
89 3300005365 Ga0070688_100247663 Ga0070688_1002476631 200
90 3300005434 Ga0070709_10185312 Ga0070709_101853122 200
91 3300005434 Ga0070709_10264171 Ga0070709_102641712 200
92 3300005435 Ga0070714_100000096 Ga0070714_10000009610 200
93 3300005435 Ga0070714_100420921 Ga0070714_1004209212 200
94 3300005436 Ga0070713_100002562 Ga0070713_1000025625 200
95 3300005436 Ga0070713_100004256 Ga0070713_1000042562 200
96 3300005437 Ga0070710_10002286 Ga0070710_100022862 200
97 3300005438 Ga0070701_10265072 Ga0070701_102650721 200
98 3300005439 Ga0070711_100006210 Ga0070711_1000062105 200
99 3300005458 Ga0070681_10000147 Ga0070681_1000014728 200
100 3300005458 Ga0070681_10051723 Ga0070681_100517233 200
101 3300005530 Ga0070679_100006558 Ga0070679_1000065584 200
102 3300005530 Ga0070679_100045430 Ga0070679_1000454304 200
103 3300005530 Ga0070679_100179066 Ga0070679_1001790663 200
104 3300005535 Ga0070684_100048222 Ga0070684_1000482223 200
105 3300005539 Ga0068853_100007558 Ga0068853_1000075581 200
106 3300005546 Ga0070696_100360270 Ga0070696_1003602701 200
107 3300005547 Ga0070693_100120020 Ga0070693_1001200202 200
108 3300005563 Ga0068855_100064251 Ga0068855_1000642512 200
109 3300005563 Ga0068855_100082596 Ga0068855_1000825962 200
110 3300005563 Ga0068855_100202444 Ga0068855_1002024442 200
111 3300005614 Ga0068856_100000609 Ga0068856_10000060919 200
112 3300005616 Ga0068852_100001161 Ga0068852_1000011611 200
113 3300005616 Ga0068852_100152870 Ga0068852_1001528703 200
114 3300005718 Ga0068866_10041104 Ga0068866_100411044 200
115 3300006028 Ga0070717_10027515 Ga0070717_100275152 200
116 3300006028 Ga0070717_10030111 Ga0070717_100301112 200
117 3300006028 Ga0070717_10222965 Ga0070717_102229652 200
118 3300006028 Ga0070717_10373605 Ga0070717_103736051 200
119 3300006163 Ga0070715_10001567 Ga0070715_100015672 200
120 3300006163 Ga0070715_10012648 Ga0070715_100126485 200
121 3300006173 Ga0070716_100026301 Ga0070716_1000263016 200
122 3300006173 Ga0070716_100115093 Ga0070716_1001150932 200
123 3300006175 Ga0070712_100000340 Ga0070712_10000034023 200
124 3300006175 Ga0070712_100002911 Ga0070712_1000029116 200
125 3300006175 Ga0070712_100009532 Ga0070712_1000095322 200
126 3300006175 Ga0070712_100073305 Ga0070712_1000733051 200
127 3300006175 Ga0070712_100107863 Ga0070712_1001078633 200
128 3300006237 Ga0097621_100001157 Ga0097621_1000011573 200
129 3300006358 Ga0068871_100021610 Ga0068871_1000216102 200
130 3300006852 Ga0075433_10022380 Ga0075433_100223801 200
131 3300006914 Ga0075436_100008762 Ga0075436_1000087622 200
132 3300009093 Ga0105240_10002547 Ga0105240_1000254738 200
133 3300009093 Ga0105240_10031044 Ga0105240_100310441 200
134 3300009093 Ga0105240_10093628 Ga0105240_100936282 200
135 3300009098 Ga0105245_10025954 Ga0105245_100259546 200
136 3300009177 Ga0105248_10004472 Ga0105248_1000447211 200
137 3300009177 Ga0105248_10628240 Ga0105248_106282402 200
138 3300009545 Ga0105237_11105553 Ga0105237_111055532 200
139 3300010375 Ga0105239_10008308 Ga0105239_1000830812 200
140 3300012482 Ga0157318_1005835 Ga0157318_10058351 200
141 3300013100 Ga0157373_10003804 Ga0157373_100038041 200
142 3300013104 Ga0157370_10210341 Ga0157370_102103413 200
143 3300013105 Ga0157369_10003399 Ga0157369_100033993 200
144 3300013105 Ga0157369_10412199 Ga0157369_104121991 200
145 3300013296 Ga0157374_10000355 Ga0157374_1000035527 200
146 3300013306 Ga0163162_10004569 Ga0163162_100045696 200
147 3300013307 Ga0157372_10000282 Ga0157372_1000028249 200
148 3300013307 Ga0157372_10011608 Ga0157372_100116086 200
149 3300013307 Ga0157372_10832459 Ga0157372_108324592 200
150 3300014325 Ga0163163_10092292 Ga0163163_100922922 200
151 3300024225 Ga0224572_1006047 Ga0224572_10060472 200
152 3300024227 Ga0228598_1000450 Ga0228598_10004504 200
153 3300024227 Ga0228598_1007264 Ga0228598_10072641 200
154 3300025903 Ga0207680_10092685 Ga0207680_100926851 200
155 3300025906 Ga0207699_10206531 Ga0207699_102065312 200
156 3300025911 Ga0207654_10126544 Ga0207654_101265441 200
157 3300025912 Ga0207707_10001984 Ga0207707_1000198427 200
158 3300025912 Ga0207707_10171917 Ga0207707_101719172 200
159 3300025913 Ga0207695_10004974 Ga0207695_100049748 200
160 3300025913 Ga0207695_10011737 Ga0207695_1001173711 200
161 3300025913 Ga0207695_10050035 Ga0207695_100500352 200
162 3300025913 Ga0207695_10636787 Ga0207695_106367872 200
163 3300025914 Ga0207671_10175256 Ga0207671_101752562 200
164 3300025915 Ga0207693_10000182 Ga0207693_1000018257 200
165 3300025915 Ga0207693_10003469 Ga0207693_100034694 200
166 3300025915 Ga0207693_10010767 Ga0207693_100107672 200
167 3300025915 Ga0207693_10081981 Ga0207693_100819811 200
168 3300025916 Ga0207663_10002131 Ga0207663_100021315 200
169 3300025916 Ga0207663_10033331 Ga0207663_100333314 200
170 3300025916 Ga0207663_10116830 Ga0207663_101168302 200
171 3300025917 Ga0207660_10214837 Ga0207660_102148372 200
172 3300025919 Ga0207657_10004189 Ga0207657_100041891 200
173 3300025921 Ga0207652_10007447 Ga0207652_100074476 200
174 3300025921 Ga0207652_10113121 Ga0207652_101131212 200
175 3300025924 Ga0207694_10001976 Ga0207694_100019762 200
176 3300025927 Ga0207687_10002812 Ga0207687_100028127 200
177 3300025928 Ga0207700_10001771 Ga0207700_100017716 200
178 3300025928 Ga0207700_10001960 Ga0207700_100019605 200
179 3300025928 Ga0207700_10215535 Ga0207700_102155352 200
180 3300025929 Ga0207664_10000087 Ga0207664_1000008722 200
181 3300025929 Ga0207664_10011722 Ga0207664_100117225 200
182 3300025929 Ga0207664_10089269 Ga0207664_100892691 200
183 3300025939 Ga0207665_10019839 Ga0207665_100198395 200
184 3300025941 Ga0207711_10008695 Ga0207711_100086954 200
185 3300025944 Ga0207661_10061674 Ga0207661_100616741 200
186 3300025944 Ga0207661_10194615 Ga0207661_101946151 200
187 3300025944 Ga0207661_10291723 Ga0207661_102917232 200
188 3300025949 Ga0207667_10000377 Ga0207667_1000037738 200
189 3300025949 Ga0207667_10000541 Ga0207667_100005413 200
190 3300025949 Ga0207667_10005696 Ga0207667_100056968 200
191 3300025949 Ga0207667_10074069 Ga0207667_100740693 200
192 3300025961 Ga0207712_10006856 Ga0207712_100068565 200
193 3300025972 Ga0207668_10004431 Ga0207668_100044315 200
194 3300026023 Ga0207677_10015197 Ga0207677_100151977 200
195 3300026078 Ga0207702_10000561 Ga0207702_1000056122 200
196 3300026078 Ga0207702_10297313 Ga0207702_102973132 200
197 3300026116 Ga0207674_10010667 Ga0207674_1001066710 200
198 3300026142 Ga0207698_10016707 Ga0207698_1001670710 200
199 3300027512 Ga0209179_1059039 Ga0209179_10590391 200
200 3300028023 Ga0265357_1003443 Ga0265357_10034433 200
201 3300028558 Ga0265326_10033438 Ga0265326_100334382 200
202 3300028800 Ga0265338_10111851 Ga0265338_101118512 200
203 3300028800 Ga0265338_10126385 Ga0265338_101263852 200
204 3300028800 Ga0265338_10150625 Ga0265338_101506252 200
205 3300030763 Ga0265763_1001508 Ga0265763_10015083 200
206 3300031235 Ga0265330_10004432 Ga0265330_100044326 200
207 3300031247 Ga0265340_10051251 Ga0265340_100512513 200
208 3300031249 Ga0265339_10027784 Ga0265339_100277842 200
209 3300031344 Ga0265316_10572490 Ga0265316_105724901 200
210 3300031595 Ga0265313_10038907 Ga0265313_100389072 200
211 3300031711 Ga0265314_10034888 Ga0265314_100348884 200
212 3300031711 Ga0265314_10264902 Ga0265314_102649021 200
213 3300031712 Ga0265342_10050049 Ga0265342_100500492 200
214 3300031712 Ga0265342_10096345 Ga0265342_100963451 200
215 3300035084 Ga0373928_0074654 Ga0373928_0074654_212_814 200
216 3300035111 Ga0373923_0189539 Ga0373923_0189539_48_650 200
217 3300035113 Ga0373936_0008282 Ga0373936_0008282_140_742 200
218 3300035115 Ga0373941_0090618 Ga0373941_0090618_74_745 200
219 3300035116 Ga0373945_0003446 Ga0373945_0003446_2446_3048 200
220 3300035170 Ga0373943_0002800 Ga0373943_0002800_5527_6129 200
221 3300035171 Ga0373946_0029158 Ga0373946_0029158_910_1512 200
222 3300035172 Ga0373955_0102027 Ga0373955_0102027_369_971 200
223 3300035242 Ga0373962_0192348 Ga0373962_0192348_62_664 200
224 3300035691 Ga0373931_0037689 Ga0373931_0037689_1615_2286 200
225 3300035692 Ga0373935_0015243 Ga0373935_0015243_2287_2889 200
226 3300035692 Ga0373935_0113767 Ga0373935_0113767_537_1139 200
227 3300035695 Ga0373927_0010054 Ga0373927_0010054_5263_5865 200
228 3300035695 Ga0373927_0022049 Ga0373927_0022049_873_1475 200
229 3300035724 Ga0373933_0019579 Ga0373933_0019579_3164_3766 200
230 3300035724 Ga0373933_0041075 Ga0373933_0041075_246_848 200
231 3300035724 Ga0373933_0046964 Ga0373933_0046964_303_905 200
232 3300035725 Ga0373947_0003669 Ga0373947_0003669_1896_2498 200
233 3300035725 Ga0373947_0036081 Ga0373947_0036081_1557_2159 200
234 3300035725 Ga0373947_0192283 Ga0373947_0192283_93_695 200
235 3300036401 Ga0373937_0097862 Ga0373937_0097862_387_989 200
236 3300036401 Ga0373937_0119299 Ga0373937_0119299_1762_2364 200
237 3300036401 Ga0373937_0438269 Ga0373937_0438269_498_1124 200
238 3300036401 Ga0373937_0988024 Ga0373937_0988024_170_772 200
239 3300037068 Ga0373925_0002473 Ga0373925_0002473_6499_7101 200
240 3300037068 Ga0373925_0072838 Ga0373925_0072838_1397_1999 200
241 3300037068 Ga0373925_0127488 Ga0373925_0127488_328_930 200
242 3300039438 Ga0436360_1073532 Ga0436360_1073532_67_708 200
243 3300039453 Ga0436362_0325737 Ga0436362_0325737_394_1014 200
244 3300044693 Ga0466961_0073960 Ga0466961_0073960_762_1364 200
245 3300044842 Ga0466957_0165821 Ga0466957_0165821_401_1003 200
246 3300045836 Ga0466958_0088139 Ga0466958_0088139_10_612 200
247 3300045836 Ga0466958_0485978 Ga0466958_0485978_23_625 200
248 3300045976 Ga0466967_0004914 Ga0466967_0004914_1198_1848 200
249 3300046455 Ga0495603_0157041 Ga0495603_0157041_309_911 200
250 3300046472 Ga0495580_0016785 Ga0495580_0016785_3567_4169 200
251 3300046472 Ga0495580_0022128 Ga0495580_0022128_3500_4102 200
252 3300046472 Ga0495580_0294210 Ga0495580_0294210_292_894 200
253 3300046477 Ga0495664_0031494 Ga0495664_0031494_1279_1881 200
254 3300046477 Ga0495664_0307225 Ga0495664_0307225_294_896 200
255 3300046516 Ga0495628_0187436 Ga0495628_0187436_41_643 200
256 3300046517 Ga0495630_0174937 Ga0495630_0174937_400_1002 200
257 3300046528 Ga0495642_0115027 Ga0495642_0115027_274_876 200
258 3300046529 Ga0495652_0063290 Ga0495652_0063290_108_710 200
259 3300046531 Ga0495665_0063330 Ga0495665_0063330_107_709 200
260 3300046543 Ga0495645_0058556 Ga0495645_0058556_846_1481 200
261 3300046557 Ga0495622_0243692 Ga0495622_0243692_65_667 200
262 3300046678 Ga0495599_0038192 Ga0495599_0038192_379_981 200
263 3300046679 Ga0495623_0096380 Ga0495623_0096380_967_1602 200
264 3300046679 Ga0495623_0149655 Ga0495623_0149655_431_1033 200
265 3300046689 Ga0495613_0136057 Ga0495613_0136057_423_1025 200
266 3300046689 Ga0495613_0404221 Ga0495613_0404221_319_921 200
267 3300047319 Ga0495674_0039914 Ga0495674_0039914_2405_3007 200
268 3300047445 Ga0495677_0114965 Ga0495677_0114965_87_689 200
269 3300047471 Ga0495684_0250216 Ga0495684_0250216_165_767 200
270 3300048906 Ga0496103_0091131 Ga0496103_0091131_1074_1763 200
271 3300048907 Ga0496104_0022458 Ga0496104_0022458_371_973 200
272 3300048907 Ga0496104_0293923 Ga0496104_0293923_757_1440 200
273 3300048907 Ga0496104_0390569 Ga0496104_0390569_433_1035 200
274 3300048908 Ga0496105_0217857 Ga0496105_0217857_461_1063 200
275 3300048914 Ga0496111_0004189 Ga0496111_0004189_6266_6922 200
276 3300048915 Ga0496112_0002677 Ga0496112_0002677_10731_11414 200
277 3300048915 Ga0496112_0071931 Ga0496112_0071931_1238_1909 200
278 3300048918 Ga0496115_0248589 Ga0496115_0248589_636_1238 200
279 3300048929 Ga0496126_0016479 Ga0496126_0016479_2670_3272 200
280 3300053078 Ga0495612_0133302 Ga0495612_0133302_156_827 200
281 3300000546 LJNas_1009679 LJNas_10096791 201
282 3300005329 Ga0070683_100090670 Ga0070683_1000906702 201
283 3300005530 Ga0070679_100570067 Ga0070679_1005700671 201
284 3300005539 Ga0068853_100377051 Ga0068853_1003770512 201
285 3300005616 Ga0068852_100003078 Ga0068852_1000030788 201
286 3300009093 Ga0105240_10000213 Ga0105240_1000021377 201
287 3300009093 Ga0105240_10014750 Ga0105240_100147509 201
288 3300009545 Ga0105237_10182162 Ga0105237_101821621 201
289 3300013100 Ga0157373_10119358 Ga0157373_101193582 201
290 3300013104 Ga0157370_10000058 Ga0157370_1000005876 201
291 3300013105 Ga0157369_10000381 Ga0157369_1000038127 201
292 3300013307 Ga0157372_10000622 Ga0157372_1000062210 201
293 3300025261 Ga0209233_1020613 Ga0209233_10206131 201
294 3300025912 Ga0207707_10028982 Ga0207707_100289822 201
295 3300025913 Ga0207695_10000191 Ga0207695_10000191125 201
296 3300025913 Ga0207695_10007323 Ga0207695_100073233 201
297 3300025913 Ga0207695_10037748 Ga0207695_100377483 201
298 3300025914 Ga0207671_10111175 Ga0207671_101111751 201
299 3300025949 Ga0207667_10026110 Ga0207667_100261103 201
300 3300026041 Ga0207639_11173652 Ga0207639_111736521 201
301 3300026142 Ga0207698_10000070 Ga0207698_1000007037 201
302 3300005330 Ga0070690_100181545 Ga0070690_1001815452 202
303 3300005335 Ga0070666_10064026 Ga0070666_100640261 202
304 3300005436 Ga0070713_100602692 Ga0070713_1006026921 202
305 3300005614 Ga0068856_100072459 Ga0068856_1000724591 202
306 3300009177 Ga0105248_10456599 Ga0105248_104565992 202
307 3300025913 Ga0207695_10008737 Ga0207695_100087372 202
308 3300025924 Ga0207694_10103208 Ga0207694_101032082 202
309 3300025924 Ga0207694_10130475 Ga0207694_101304753 202
310 3300025928 Ga0207700_10578386 Ga0207700_105783861 202
311 3300025949 Ga0207667_10005182 Ga0207667_100051822 202
312 3300025986 Ga0207658_10473736 Ga0207658_104737361 202
313 3300026088 Ga0207641_10114978 Ga0207641_101149782 202
314 3300005329 Ga0070683_100012931 Ga0070683_1000129314 203
315 3300005338 Ga0068868_100025862 Ga0068868_1000258622 203
316 3300005355 Ga0070671_100293083 Ga0070671_1002930831 203
317 3300005436 Ga0070713_100086922 Ga0070713_1000869222 203
318 3300005439 Ga0070711_100103485 Ga0070711_1001034853 203
319 3300005459 Ga0068867_100058040 Ga0068867_1000580402 203
320 3300005530 Ga0070679_100235043 Ga0070679_1002350432 203
321 3300005563 Ga0068855_100001009 Ga0068855_10000100911 203
322 3300005564 Ga0070664_100818152 Ga0070664_1008181521 203
323 3300005614 Ga0068856_100000813 Ga0068856_10000081317 203
324 3300005615 Ga0070702_100098210 Ga0070702_1000982102 203
325 3300005616 Ga0068852_100401946 Ga0068852_1004019462 203
326 3300005618 Ga0068864_100138961 Ga0068864_1001389612 203
327 3300005841 Ga0068863_100542662 Ga0068863_1005426622 203
328 3300005842 Ga0068858_100052858 Ga0068858_1000528582 203
329 3300006028 Ga0070717_10327614 Ga0070717_103276141 203
330 3300006237 Ga0097621_100000060 Ga0097621_10000006017 203
331 3300006358 Ga0068871_100000190 Ga0068871_10000019035 203
332 3300009176 Ga0105242_11233311 Ga0105242_112333111 203
333 3300009177 Ga0105248_10018174 Ga0105248_100181743 203
334 3300013105 Ga0157369_10024476 Ga0157369_100244764 203
335 3300013296 Ga0157374_10000359 Ga0157374_1000035924 203
336 3300013296 Ga0157374_10006940 Ga0157374_100069403 203
337 3300013296 Ga0157374_10449680 Ga0157374_104496802 203
338 3300013297 Ga0157378_10000092 Ga0157378_1000009262 203
339 3300013307 Ga0157372_10001281 Ga0157372_1000128125 203
340 3300025898 Ga0207692_10421609 Ga0207692_104216091 203
341 3300025904 Ga0207647_10036189 Ga0207647_100361892 203
342 3300025913 Ga0207695_10472848 Ga0207695_104728482 203
343 3300025921 Ga0207652_10214149 Ga0207652_102141492 203
344 3300025928 Ga0207700_10550893 Ga0207700_105508932 203
345 3300025945 Ga0207679_10132082 Ga0207679_101320822 203
346 3300025949 Ga0207667_10002508 Ga0207667_1000250823 203
347 3300025981 Ga0207640_10243147 Ga0207640_102431471 203
348 3300026023 Ga0207677_10014728 Ga0207677_100147282 203
349 3300026035 Ga0207703_10028925 Ga0207703_100289252 203
350 3300026078 Ga0207702_10000175 Ga0207702_1000017531 203
351 3300026078 Ga0207702_10000583 Ga0207702_1000058313 203
352 3300026089 Ga0207648_10049988 Ga0207648_100499881 203
353 3300026095 Ga0207676_10161373 Ga0207676_101613731 203
354 3300028379 Ga0268266_10072994 Ga0268266_100729943 203
355 3300028800 Ga0265338_10054622 Ga0265338_100546223 203
356 3300031235 Ga0265330_10169623 Ga0265330_101696231 203
357 3300031247 Ga0265340_10009761 Ga0265340_100097614 203
358 3300031711 Ga0265314_10294734 Ga0265314_102947341 203
359 3300031712 Ga0265342_10084011 Ga0265342_100840112 203
360 3300033546 Ga0316213_1003734 Ga0316213_10037341 203
361 3300033547 Ga0316212_1002904 Ga0316212_10029042 203
362 3300035086 Ga0373934_0030138 Ga0373934_0030138_1483_2094 203
363 3300035695 Ga0373927_0472480 Ga0373927_0472480_168_779 203
364 3300037853 Ga0436364_0176799 Ga0436364_0176799_193_804 203
365 3300039453 Ga0436362_0698378 Ga0436362_0698378_262_873 203
366 3300046472 Ga0495580_0134650 Ga0495580_0134650_260_871 203
367 3300046516 Ga0495628_0229236 Ga0495628_0229236_122_766 203
368 3300046522 Ga0495643_0205784 Ga0495643_0205784_281_928 203
369 3300046533 Ga0495640_0468915 Ga0495640_0468915_34_681 203
370 3300046543 Ga0495645_0301373 Ga0495645_0301373_51_695 203
371 3300047317 Ga0495604_0171537 Ga0495604_0171537_838_1449 203
372 3300048915 Ga0496112_0787109 Ga0496112_0787109_206_817 203
373 3300049569 Ga0501032_0156464 Ga0501032_0156464_688_1299 203
374 3300049570 Ga0501033_0357396 Ga0501033_0357396_12_623 203
375 3300049571 Ga0501034_0323325 Ga0501034_0323325_71_682 203
376 3300049572 Ga0501036_0163829 Ga0501036_0163829_839_1450 203
377 3300049573 Ga0501037_0207923 Ga0501037_0207923_137_748 203
378 3300049579 Ga0501043_0142786 Ga0501043_0142786_22_633 203
379 3300049581 Ga0501047_0102299 Ga0501047_0102299_1289_1900 203
380 3300049589 Ga0501073_0197651 Ga0501073_0197651_215_835 203
381 3300049742 Ga0501080_0360705 Ga0501080_0360705_136_747 203
382 3300049823 Ga0501044_0000314 Ga0501044_0000314_42053_42673 203
383 3300049823 Ga0501044_0110697 Ga0501044_0110697_835_1446 203
384 3300054114 Ga0501084_0701432 Ga0501084_0701432_227_838 203
385 3300028379 Ga0268266_10888826 Ga0268266_108888262 204
386 3300005456 Ga0070678_100233529 Ga0070678_1002335291 205
387 3300006358 Ga0068871_100004608 Ga0068871_1000046087 205
388 3300009176 Ga0105242_10441410 Ga0105242_104414101 205
389 3300012478 Ga0157328_1003686 Ga0157328_10036861 205
390 3300046473 Ga0495582_0007999 Ga0495582_0007999_582_1202 205
391 3300046683 Ga0495658_0047416 Ga0495658_0047416_1155_1775 205
392 3300047317 Ga0495604_0041478 Ga0495604_0041478_857_1507 205
393 3300005327 Ga0070658_10219871 Ga0070658_102198712 206
394 3300005338 Ga0068868_100011939 Ga0068868_1000119392 206
395 3300005354 Ga0070675_100316223 Ga0070675_1003162232 206
396 3300005434 Ga0070709_10703400 Ga0070709_107034001 206
397 3300005435 Ga0070714_100111328 Ga0070714_1001113283 206
398 3300005436 Ga0070713_100012208 Ga0070713_1000122081 206
399 3300005439 Ga0070711_100181713 Ga0070711_1001817132 206
400 3300005535 Ga0070684_100146853 Ga0070684_1001468533 206
401 3300005539 Ga0068853_100001002 Ga0068853_10000100215 206
402 3300005539 Ga0068853_100401186 Ga0068853_1004011861 206
403 3300005563 Ga0068855_100030086 Ga0068855_1000300865 206
404 3300005563 Ga0068855_100937603 Ga0068855_1009376031 206
405 3300005577 Ga0068857_100663978 Ga0068857_1006639782 206
406 3300005614 Ga0068856_100084851 Ga0068856_1000848512 206
407 3300005616 Ga0068852_100009777 Ga0068852_1000097774 206
408 3300005616 Ga0068852_100130431 Ga0068852_1001304312 206
409 3300005616 Ga0068852_100478929 Ga0068852_1004789292 206
410 3300005834 Ga0068851_10018526 Ga0068851_100185262 206
411 3300006028 Ga0070717_10317545 Ga0070717_103175452 206
412 3300006237 Ga0097621_100078645 Ga0097621_1000786451 206
413 3300006358 Ga0068871_100012840 Ga0068871_1000128402 206
414 3300009093 Ga0105240_10148738 Ga0105240_101487381 206
415 3300009093 Ga0105240_10171859 Ga0105240_101718593 206
416 3300009093 Ga0105240_10281083 Ga0105240_102810832 206
417 3300009098 Ga0105245_10051029 Ga0105245_100510292 206
418 3300009174 Ga0105241_10000055 Ga0105241_1000005560 206
419 3300009174 Ga0105241_10000338 Ga0105241_1000033811 206
420 3300009174 Ga0105241_10007684 Ga0105241_100076849 206
421 3300009174 Ga0105241_10202162 Ga0105241_102021622 206
422 3300009545 Ga0105237_10043368 Ga0105237_100433683 206
423 3300009545 Ga0105237_10124815 Ga0105237_101248152 206
424 3300009545 Ga0105237_10175557 Ga0105237_101755573 206
425 3300009551 Ga0105238_10012644 Ga0105238_100126449 206
426 3300009551 Ga0105238_10074609 Ga0105238_100746093 206
427 3300009551 Ga0105238_10271324 Ga0105238_102713242 206
428 3300010375 Ga0105239_10134156 Ga0105239_101341563 206
429 3300010375 Ga0105239_10405556 Ga0105239_104055562 206
430 3300013102 Ga0157371_10363751 Ga0157371_103637512 206
431 3300013105 Ga0157369_10006528 Ga0157369_100065289 206
432 3300013105 Ga0157369_10039943 Ga0157369_100399433 206
433 3300013105 Ga0157369_10173049 Ga0157369_101730492 206
434 3300013105 Ga0157369_10444925 Ga0157369_104449253 206
435 3300013296 Ga0157374_10108295 Ga0157374_101082952 206
436 3300013297 Ga0157378_10021416 Ga0157378_100214162 206
437 3300013297 Ga0157378_10073962 Ga0157378_100739623 206
438 3300013307 Ga0157372_10082716 Ga0157372_100827162 206
439 3300013307 Ga0157372_10100095 Ga0157372_101000954 206
440 3300013307 Ga0157372_10223956 Ga0157372_102239562 206
441 3300013308 Ga0157375_10049389 Ga0157375_100493895 206
442 3300013308 Ga0157375_10364669 Ga0157375_103646692 206
443 3300014325 Ga0163163_10015690 Ga0163163_100156902 206
444 3300014969 Ga0157376_10118789 Ga0157376_101187892 206
445 3300025321 Ga0207656_10104674 Ga0207656_101046742 206
446 3300025898 Ga0207692_10081280 Ga0207692_100812803 206
447 3300025909 Ga0207705_10401801 Ga0207705_104018012 206
448 3300025911 Ga0207654_10000027 Ga0207654_1000002717 206
449 3300025911 Ga0207654_10109197 Ga0207654_101091972 206
450 3300025911 Ga0207654_10216082 Ga0207654_102160822 206
451 3300025913 Ga0207695_10003674 Ga0207695_100036741 206
452 3300025913 Ga0207695_10116776 Ga0207695_101167762 206
453 3300025913 Ga0207695_10234074 Ga0207695_102340742 206
454 3300025914 Ga0207671_10051482 Ga0207671_100514824 206
455 3300025914 Ga0207671_10207195 Ga0207671_102071952 206
456 3300025924 Ga0207694_10000160 Ga0207694_1000016038 206
457 3300025924 Ga0207694_10202570 Ga0207694_102025702 206
458 3300025927 Ga0207687_10670123 Ga0207687_106701232 206
459 3300025928 Ga0207700_10014215 Ga0207700_100142153 206
460 3300025949 Ga0207667_10037489 Ga0207667_100374894 206
461 3300026023 Ga0207677_10030966 Ga0207677_100309663 206
462 3300026041 Ga0207639_10000145 Ga0207639_1000014514 206
463 3300026078 Ga0207702_10277235 Ga0207702_102772353 206
464 3300046663 Ga0495635_0247268 Ga0495635_0247268_317_937 206
465 3300046690 Ga0495624_0095541 Ga0495624_0095541_202_858 206
466 3300048903 Ga0496100_0038390 Ga0496100_0038390_1673_2293 206
467 3300048904 Ga0496101_0008468 Ga0496101_0008468_1525_2145 206
468 3300048907 Ga0496104_0451345 Ga0496104_0451345_14_634 206
469 3300048912 Ga0496109_0374465 Ga0496109_0374465_210_830 206
470 3300048917 Ga0496114_0006722 Ga0496114_0006722_6732_7352 206
471 3300048918 Ga0496115_0013978 Ga0496115_0013978_4642_5262 206
472 3300050514 nmdc:mga08x19_3469_c1 nmdc:mga08x19_3469_c1_2702_3322 206
473 3300053085 Ga0495619_0311402 Ga0495619_0311402_389_1009 206
474 3300000546 LJNas_1000379 LJNas_10003796 207
475 3300005334 Ga0068869_100073489 Ga0068869_1000734893 207
476 3300005336 Ga0070680_100037897 Ga0070680_1000378972 207
477 3300005337 Ga0070682_100161032 Ga0070682_1001610322 207
478 3300005338 Ga0068868_100059666 Ga0068868_1000596661 207
479 3300005340 Ga0070689_100335502 Ga0070689_1003355022 207
480 3300005343 Ga0070687_100072759 Ga0070687_1000727593 207
481 3300005347 Ga0070668_100037146 Ga0070668_1000371461 207
482 3300005355 Ga0070671_100008953 Ga0070671_1000089535 207
483 3300005355 Ga0070671_100214360 Ga0070671_1002143602 207
484 3300005441 Ga0070700_100545959 Ga0070700_1005459591 207
485 3300005456 Ga0070678_100175711 Ga0070678_1001757112 207
486 3300005457 Ga0070662_100008074 Ga0070662_1000080749 207
487 3300005457 Ga0070662_100032341 Ga0070662_1000323412 207
488 3300005468 Ga0070707_100126787 Ga0070707_1001267874 207
489 3300005539 Ga0068853_100015608 Ga0068853_1000156082 207
490 3300005544 Ga0070686_100402374 Ga0070686_1004023742 207
491 3300005548 Ga0070665_100037113 Ga0070665_1000371132 207
492 3300005548 Ga0070665_100212429 Ga0070665_1002124292 207
493 3300005563 Ga0068855_100157926 Ga0068855_1001579262 207
494 3300005563 Ga0068855_100464076 Ga0068855_1004640761 207
495 3300005614 Ga0068856_100015336 Ga0068856_1000153367 207
496 3300005614 Ga0068856_100041434 Ga0068856_1000414342 207
497 3300005616 Ga0068852_100155809 Ga0068852_1001558092 207
498 3300005617 Ga0068859_100012318 Ga0068859_1000123182 207
499 3300005617 Ga0068859_100030601 Ga0068859_1000306012 207
500 3300005842 Ga0068858_100072019 Ga0068858_1000720193 207
501 3300005843 Ga0068860_100001835 Ga0068860_10000183516 207
502 3300005844 Ga0068862_100115746 Ga0068862_1001157462 207
503 3300006237 Ga0097621_100040541 Ga0097621_1000405412 207
504 3300006237 Ga0097621_100356356 Ga0097621_1003563562 207
505 3300006358 Ga0068871_100014953 Ga0068871_1000149535 207
506 3300006358 Ga0068871_100093201 Ga0068871_1000932012 207
507 3300006881 Ga0068865_100104573 Ga0068865_1001045732 207
508 3300006931 Ga0097620_100012320 Ga0097620_1000123202 207
509 3300006931 Ga0097620_100030601 Ga0097620_1000306012 207
510 3300009093 Ga0105240_10000683 Ga0105240_1000068323 207
511 3300009093 Ga0105240_10008749 Ga0105240_100087495 207
512 3300009098 Ga0105245_10004131 Ga0105245_100041317 207
513 3300009098 Ga0105245_10511140 Ga0105245_105111401 207
514 3300009174 Ga0105241_10049438 Ga0105241_100494382 207
515 3300009174 Ga0105241_10292669 Ga0105241_102926691 207
516 3300009177 Ga0105248_10001001 Ga0105248_1000100112 207
517 3300009177 Ga0105248_11255223 Ga0105248_112552231 207
518 3300009551 Ga0105238_10000352 Ga0105238_100003527 207
519 3300009553 Ga0105249_10015382 Ga0105249_100153825 207
520 3300010375 Ga0105239_10000375 Ga0105239_1000037529 207
521 3300013102 Ga0157371_10061088 Ga0157371_100610882 207
522 3300013104 Ga0157370_10544957 Ga0157370_105449571 207
523 3300013296 Ga0157374_10015562 Ga0157374_100155622 207
524 3300013297 Ga0157378_10188086 Ga0157378_101880862 207
525 3300013307 Ga0157372_10058079 Ga0157372_100580794 207
526 3300014745 Ga0157377_10049749 Ga0157377_100497492 207
527 3300014969 Ga0157376_10054623 Ga0157376_100546233 207
528 3300017792 Ga0163161_10026127 Ga0163161_100261273 207
529 3300025315 Ga0207697_10010658 Ga0207697_100106583 207
530 3300025911 Ga0207654_10022696 Ga0207654_100226962 207
531 3300025911 Ga0207654_10436412 Ga0207654_104364121 207
532 3300025913 Ga0207695_10000108 Ga0207695_1000010830 207
533 3300025913 Ga0207695_10000345 Ga0207695_1000034530 207
534 3300025913 Ga0207695_10006642 Ga0207695_1000664212 207
535 3300025918 Ga0207662_10008307 Ga0207662_100083072 207
536 3300025921 Ga0207652_10008176 Ga0207652_100081768 207
537 3300025922 Ga0207646_10614531 Ga0207646_106145312 207
538 3300025924 Ga0207694_10000380 Ga0207694_1000038015 207
539 3300025925 Ga0207650_10000646 Ga0207650_100006461 207
540 3300025927 Ga0207687_10047561 Ga0207687_100475612 207
541 3300025929 Ga0207664_10019681 Ga0207664_100196812 207
542 3300025931 Ga0207644_10011846 Ga0207644_100118465 207
543 3300025931 Ga0207644_10106095 Ga0207644_101060952 207
544 3300025932 Ga0207690_10207049 Ga0207690_102070492 207
545 3300025936 Ga0207670_10275551 Ga0207670_102755511 207
546 3300025941 Ga0207711_10000859 Ga0207711_100008597 207
547 3300025941 Ga0207711_10108839 Ga0207711_101088392 207
548 3300026023 Ga0207677_10025642 Ga0207677_100256423 207
549 3300026035 Ga0207703_10069711 Ga0207703_100697113 207
550 3300026041 Ga0207639_10253394 Ga0207639_102533942 207
551 3300026067 Ga0207678_10083540 Ga0207678_100835402 207
552 3300026078 Ga0207702_10009227 Ga0207702_100092274 207
553 3300026078 Ga0207702_10049937 Ga0207702_100499373 207
554 3300026078 Ga0207702_10323065 Ga0207702_103230653 207
555 3300026088 Ga0207641_10000021 Ga0207641_1000002142 207
556 3300026088 Ga0207641_10204079 Ga0207641_102040792 207
557 3300026095 Ga0207676_10000518 Ga0207676_100005184 207
558 3300028017 Ga0265356_1000510 Ga0265356_10005103 207
559 3300028379 Ga0268266_10050140 Ga0268266_100501402 207
560 3300028379 Ga0268266_10571379 Ga0268266_105713791 207
561 3300028380 Ga0268265_10108992 Ga0268265_101089921 207
562 3300028381 Ga0268264_10006325 Ga0268264_100063255 207
563 3300028381 Ga0268264_10036874 Ga0268264_100368742 207
564 3300028800 Ga0265338_10001846 Ga0265338_1000184618 207
565 3300031249 Ga0265339_10002593 Ga0265339_1000259313 207
566 3300031344 Ga0265316_10007178 Ga0265316_100071783 207
567 3300031711 Ga0265314_10002820 Ga0265314_1000282016 207
568 3300037466 Ga0395898_0137829 Ga0395898_0137829_40_675 207
569 3300047319 Ga0495674_0038308 Ga0495674_0038308_1907_2536 207
570 3300047444 Ga0495675_0010036 Ga0495675_0010036_245_874 207
571 3300048089 Ga0495614_0315535 Ga0495614_0315535_46_684 207
572 3300048915 Ga0496112_0000053 Ga0496112_0000053_2910_3545 207
573 3300048915 Ga0496112_0115473 Ga0496112_0115473_1442_2065 207
574 3300048916 Ga0496113_0000907 Ga0496113_0000907_588_1223 207

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03449

GreA_GreB_N

Transcription elongation factor, N-terminal

20

90

0.99

PF01272

GreA_GreB

Transcription elongation factor, GreA/GreB, C-term

102

177

0.95

Feature Viewer

pLDDT pTM Quality
81.45 0.47 Low
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map