F465303

General Info

Members Datasets Scaffolds Average Seq Length
574 214 1148 145

Family's Representative Sequence

Representative Sequence 3300009148|Ga0105243_10137517|Ga0105243_101375173
Length 165
Sequence VKTATDAGVPSKSLATWIAIVGGSLGLHHVYLGRRRWLALLYPVPTLLGLVGVFRMRNLGQDDHASWLLIPLLGATLSVGMLCAIVIGLTSDARWARRHVAEAAQADQDDESPPGTVATGWIPVLGVILALMVGGAVLMGTVAFSAQKFFEWRAESGRPVSEIHK

Samples

Sample ID Description Type Environment
1 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
2 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
3 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
4 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
5 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
6 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
13 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
14 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
15 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
16 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
17 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
18 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
19 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
20 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
21 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
22 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
23 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
24 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
25 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
26 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
27 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
28 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
29 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
30 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
31 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
32 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
33 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
34 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
35 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
36 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
37 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
38 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
39 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
40 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
41 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
42 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
43 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
44 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
45 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
46 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
47 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
48 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
49 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
50 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
51 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
52 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
53 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
54 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
55 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
56 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
57 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
58 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
59 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
60 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
61 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
62 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
63 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
64 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
65 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
66 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
67 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
68 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
69 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
70 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
71 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
72 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
73 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
74 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
75 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
76 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
77 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
78 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
79 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
80 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
81 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
82 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
83 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
84 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
85 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
86 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
87 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
88 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
89 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
90 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
91 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
92 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
93 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
94 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
95 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
96 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
147 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
151 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
152 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
153 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
154 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
155 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
156 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
157 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
158 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
159 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
160 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
161 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
162 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
163 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
164 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
165 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
166 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
167 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
168 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
169 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
170 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
171 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
172 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
173 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
174 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
175 3300042121 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 Metagenome Rhizosphere
176 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
177 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
178 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
179 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
180 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
181 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
182 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
183 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
184 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
185 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
186 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
187 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
188 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
189 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
190 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
191 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
192 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
193 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
194 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
195 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
196 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
197 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
198 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
199 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
200 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
201 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
202 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
203 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
204 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
205 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
206 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
207 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
208 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
209 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
210 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
211 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
212 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
213 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
214 2643221644 Rhizobacter sp. Root1221 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.83
Metatranscriptomes 0
Isolates 0.17

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.22
Nodule 0
Rhizoplane 4.01
Rhizosphere 93.38
Stem 0
Stem Tuber 0
Unclassified 0.87

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105243_10137517 3300009148 Bacteria 2080
2 rootH1_10023343 3300003316 Bacteria 1472
3 rootH1_10076455 3300003323 Bacteria 1141
4 Ga0055525_1000038 3300003759 Bacteria 297540
5 Ga0055526_1010196 3300003771 Bacteria 4403
6 Ga0055524_1000510 3300003775 Bacteria 29983
7 Ga0070658_10175324 3300005327 Bacteria 1803
8 Ga0070658_11089590 3300005327 Bacteria 695
9 Ga0070676_10014860 3300005328 Bacteria 4285
10 Ga0070683_100031806 3300005329 Bacteria 4801
11 Ga0070683_100790485 3300005329 Bacteria 909
12 Ga0070683_101223212 3300005329 Bacteria 722
13 Ga0070690_100025986 3300005330 Bacteria 3608
14 Ga0070690_100058813 3300005330 Bacteria 2469
15 Ga0070670_100004764 3300005331 Bacteria 11392
16 Ga0070670_100034202 3300005331 Bacteria 4374
17 Ga0070670_100051226 3300005331 Bacteria 3546
18 Ga0070670_100154253 3300005331 Bacteria 1988
19 Ga0070670_100189689 3300005331 Bacteria 1785
20 Ga0070670_100719401 3300005331 Bacteria 898
21 Ga0070670_101771270 3300005331 Bacteria 568
22 Ga0070677_10010433 3300005333 Bacteria 3178
23 Ga0070677_10023342 3300005333 Bacteria 2289
24 Ga0070677_10077000 3300005333 Bacteria 1418
25 Ga0070677_10132369 3300005333 Bacteria 1140
26 Ga0070677_10176282 3300005333 Bacteria 1015
27 Ga0070677_10220038 3300005333 Bacteria 927
28 Ga0068869_100006027 3300005334 Bacteria 7667
29 Ga0068869_100068206 3300005334 Bacteria 2626
30 Ga0068869_101057312 3300005334 Bacteria 709
31 Ga0070666_10031672 3300005335 Bacteria 3491
32 Ga0070666_10166202 3300005335 Bacteria 1543
33 Ga0070666_10320465 3300005335 Bacteria 1106
34 Ga0070666_10469593 3300005335 Bacteria 910
35 Ga0070666_10764402 3300005335 Bacteria 711
36 Ga0070666_10768111 3300005335 Bacteria 709
37 Ga0070680_100063571 3300005336 Bacteria 3023
38 Ga0068868_100007250 3300005338 Bacteria 7885
39 Ga0068868_100007330 3300005338 Bacteria 7853
40 Ga0068868_100472908 3300005338 Bacteria 1093
41 Ga0068868_100955617 3300005338 Bacteria 782
42 Ga0068868_101523107 3300005338 Bacteria 627
43 Ga0070660_100056839 3300005339 Bacteria 3028
44 Ga0070660_100227288 3300005339 Bacteria 1518
45 Ga0070660_100338720 3300005339 Bacteria 1237
46 Ga0070660_100823821 3300005339 Bacteria 781
47 Ga0070689_100049894 3300005340 Bacteria 3232
48 Ga0070689_100622508 3300005340 Bacteria 937
49 Ga0070689_101240181 3300005340 Bacteria 670
50 Ga0070687_100035636 3300005343 Bacteria 2473
51 Ga0070661_100125423 3300005344 Bacteria 1926
52 Ga0070661_100216549 3300005344 Bacteria 1467
53 Ga0070661_100305393 3300005344 Bacteria 1239
54 Ga0070661_100339483 3300005344 Bacteria 1176
55 Ga0070668_100021445 3300005347 Bacteria 4880
56 Ga0070668_100029372 3300005347 Bacteria 4176
57 Ga0070668_100109791 3300005347 Bacteria 2194
58 Ga0070669_100030757 3300005353 Bacteria 3875
59 Ga0070669_100094865 3300005353 Bacteria 2242
60 Ga0070669_100216675 3300005353 Bacteria 1512
61 Ga0070669_100698034 3300005353 Bacteria 857
62 Ga0070675_100002913 3300005354 Bacteria 12900
63 Ga0070675_100031478 3300005354 Bacteria 4289
64 Ga0070675_100054541 3300005354 Bacteria 3289
65 Ga0070675_100157873 3300005354 Bacteria 1948
66 Ga0070675_100255222 3300005354 Bacteria 1535
67 Ga0070675_100304644 3300005354 Bacteria 1404
68 Ga0070675_100425713 3300005354 Bacteria 1187
69 Ga0070675_101529209 3300005354 Bacteria 616
70 Ga0070671_100008663 3300005355 Bacteria 8162
71 Ga0070671_100017107 3300005355 Bacteria 5867
72 Ga0070671_100202270 3300005355 Bacteria 1684
73 Ga0070671_100424060 3300005355 Bacteria 1139
74 Ga0070671_100453361 3300005355 Bacteria 1100
75 Ga0070671_100731252 3300005355 Bacteria 859
76 Ga0070674_100029218 3300005356 Bacteria 3628
77 Ga0070674_100064420 3300005356 Bacteria 2568
78 Ga0070674_100190740 3300005356 Bacteria 1577
79 Ga0070674_100526227 3300005356 Bacteria 988
80 Ga0070674_100549625 3300005356 Bacteria 969
81 Ga0070673_100027451 3300005364 Bacteria 4221
82 Ga0070673_100267450 3300005364 Bacteria 1495
83 Ga0070673_100288069 3300005364 Bacteria 1442
84 Ga0070673_100354152 3300005364 Bacteria 1303
85 Ga0070688_100542578 3300005365 Bacteria 883
86 Ga0070659_100026476 3300005366 Bacteria 4463
87 Ga0070659_100135654 3300005366 Bacteria 2001
88 Ga0070659_100481045 3300005366 Bacteria 1056
89 Ga0070667_100004388 3300005367 Bacteria 11903
90 Ga0070667_100053630 3300005367 Bacteria 3403
91 Ga0070667_100251642 3300005367 Bacteria 1580
92 Ga0070667_100276275 3300005367 Bacteria 1507
93 Ga0070667_100560186 3300005367 Bacteria 1051
94 Ga0070667_101710315 3300005367 Bacteria 592
95 Ga0070705_100650564 3300005440 Bacteria 822
96 Ga0070663_100002045 3300005455 Bacteria 11280
97 Ga0070663_100585543 3300005455 Bacteria 937
98 Ga0070663_100618545 3300005455 Bacteria 913
99 Ga0070678_100034228 3300005456 Bacteria 3536
100 Ga0070678_100078197 3300005456 Bacteria 2498
101 Ga0070678_100089141 3300005456 Bacteria 2360
102 Ga0070678_100126140 3300005456 Bacteria 2026
103 Ga0070678_100134691 3300005456 Bacteria 1968
104 Ga0070678_100139734 3300005456 Bacteria 1936
105 Ga0070678_100348534 3300005456 Bacteria 1272
106 Ga0070678_100361158 3300005456 Bacteria 1251
107 Ga0070662_100023184 3300005457 Bacteria 4261
108 Ga0070662_100485718 3300005457 Bacteria 1029
109 Ga0070662_100545023 3300005457 Bacteria 971
110 Ga0070662_100734347 3300005457 Bacteria 837
111 Ga0068867_100070968 3300005459 Bacteria 2605
112 Ga0068867_100071044 3300005459 Bacteria 2603
113 Ga0068867_100095372 3300005459 Bacteria 2263
114 Ga0068867_100487256 3300005459 Bacteria 1057
115 Ga0068867_100528113 3300005459 Bacteria 1019
116 Ga0068867_100680243 3300005459 Bacteria 906
117 Ga0068867_101160900 3300005459 Bacteria 707
118 Ga0070685_10176584 3300005466 Bacteria 1372
119 Ga0070685_10227895 3300005466 Bacteria 1224
120 Ga0070679_100021313 3300005530 Bacteria 6325
121 Ga0070684_100063896 3300005535 Bacteria 3228
122 Ga0070684_100174632 3300005535 Bacteria 1952
123 Ga0068853_100016917 3300005539 Bacteria 6011
124 Ga0068853_100696866 3300005539 Bacteria 969
125 Ga0068853_100715579 3300005539 Bacteria 956
126 Ga0070672_100009036 3300005543 Bacteria 6851
127 Ga0070672_100013676 3300005543 Bacteria 5738
128 Ga0070672_100039130 3300005543 Bacteria 3630
129 Ga0070672_100108581 3300005543 Bacteria 2259
130 Ga0070672_100110940 3300005543 Bacteria 2235
131 Ga0070672_100219672 3300005543 Bacteria 1594
132 Ga0070672_100477259 3300005543 Bacteria 1076
133 Ga0070672_100576544 3300005543 Bacteria 978
134 Ga0070672_100592997 3300005543 Bacteria 964
135 Ga0070686_100119616 3300005544 Bacteria 1806
136 Ga0070686_101279530 3300005544 Bacteria 612
137 Ga0070693_100229412 3300005547 Bacteria 1221
138 Ga0070693_100233410 3300005547 Bacteria 1212
139 Ga0070693_100324340 3300005547 Bacteria 1046
140 Ga0070693_101058516 3300005547 Bacteria 617
141 Ga0070665_100272154 3300005548 Bacteria 1695
142 Ga0070665_100749470 3300005548 Bacteria 990
143 Ga0070665_100793764 3300005548 Bacteria 960
144 Ga0070665_101728176 3300005548 Bacteria 633
145 Ga0068855_100187695 3300005563 Bacteria 2334
146 Ga0068855_100282473 3300005563 Bacteria 1843
147 Ga0070664_100060332 3300005564 Bacteria 3229
148 Ga0070664_100115377 3300005564 Bacteria 2347
149 Ga0070664_100298503 3300005564 Bacteria 1455
150 Ga0070664_101068930 3300005564 Bacteria 759
151 Ga0068857_100209435 3300005577 Bacteria 1778
152 Ga0068854_100009962 3300005578 Bacteria 6152
153 Ga0068854_100065117 3300005578 Bacteria 2649
154 Ga0068854_100907052 3300005578 Bacteria 775
155 Ga0068856_100090006 3300005614 Bacteria 3052
156 Ga0070702_100826051 3300005615 Bacteria 719
157 Ga0068852_100007663 3300005616 Bacteria 7896
158 Ga0068852_100073705 3300005616 Bacteria 3004
159 Ga0068852_100084612 3300005616 Bacteria 2823
160 Ga0068852_100424201 3300005616 Bacteria 1312
161 Ga0068852_100440324 3300005616 Bacteria 1288
162 Ga0068852_101413527 3300005616 Bacteria 718
163 Ga0068859_100028376 3300005617 Bacteria 5610
164 Ga0068859_100135444 3300005617 Bacteria 2536
165 Ga0068859_100723670 3300005617 Bacteria 1085
166 Ga0068864_100001822 3300005618 Bacteria 17497
167 Ga0068864_100017069 3300005618 Bacteria 6050
168 Ga0068864_100046435 3300005618 Bacteria 3726
169 Ga0068864_100089952 3300005618 Bacteria 2706
170 Ga0068861_100000757 3300005719 Bacteria 19364
171 Ga0068861_100301307 3300005719 Bacteria 1388
172 Ga0068861_100499223 3300005719 Unclassified 1100
173 Ga0068861_100853321 3300005719 Bacteria 859
174 Ga0068851_10064815 3300005834 Bacteria 1878
175 Ga0068851_10194119 3300005834 Bacteria 1130
176 Ga0068851_11023627 3300005834 Bacteria 522
177 Ga0068870_10183416 3300005840 Bacteria 1258
178 Ga0068863_100043065 3300005841 Bacteria 4286
179 Ga0068863_100053520 3300005841 Bacteria 3826
180 Ga0068863_100084171 3300005841 Bacteria 3014
181 Ga0068863_100099315 3300005841 Bacteria 2765
182 Ga0068863_100315660 3300005841 Bacteria 1517
183 Ga0068863_100657400 3300005841 Bacteria 1040
184 Ga0068863_100745813 3300005841 Bacteria 975
185 Ga0068858_100003791 3300005842 Bacteria 14951
186 Ga0068858_100004338 3300005842 Bacteria 13920
187 Ga0068858_100019626 3300005842 Bacteria 6319
188 Ga0068858_100037975 3300005842 Bacteria 4466
189 Ga0068858_100618030 3300005842 Bacteria 1052
190 Ga0068860_100004033 3300005843 Bacteria 15080
191 Ga0068860_100033406 3300005843 Bacteria 4936
192 Ga0068860_100235775 3300005843 Bacteria 1779
193 Ga0070715_10086558 3300006163 Bacteria 1433
194 Ga0097621_100024119 3300006237 Bacteria 4747
195 Ga0097621_100108629 3300006237 Bacteria 2342
196 Ga0097621_100170721 3300006237 Bacteria 1874
197 Ga0068871_100137485 3300006358 Bacteria 2076
198 Ga0068871_100321538 3300006358 Bacteria 1363
199 Ga0068871_100517949 3300006358 Bacteria 1077
200 Ga0068871_101124736 3300006358 Bacteria 735
201 Ga0075434_100166543 3300006871 Bacteria 2224
202 Ga0068865_100222079 3300006881 Bacteria 1477
203 Ga0068865_100246655 3300006881 Bacteria 1408
204 Ga0097620_100028376 3300006931 Bacteria 5610
205 Ga0097620_100135435 3300006931 Bacteria 2536
206 Ga0097620_100723676 3300006931 Bacteria 1085
207 Ga0105240_11876372 3300009093 Bacteria 624
208 Ga0111539_10534364 3300009094 Bacteria 1366
209 Ga0105245_10668103 3300009098 Bacteria 1070
210 Ga0105243_10033813 3300009148 Bacteria 3954
211 Ga0105241_11467653 3300009174 Bacteria 655
212 Ga0105242_10523722 3300009176 Bacteria 1132
213 Ga0105242_10629411 3300009176 Bacteria 1041
214 Ga0105248_10022083 3300009177 Bacteria 7051
215 Ga0105248_10081871 3300009177 Bacteria 3629
216 Ga0105248_10209361 3300009177 Bacteria 2197
217 Ga0105248_10368514 3300009177 Bacteria 1617
218 Ga0105248_10777678 3300009177 Bacteria 1080
219 Ga0105248_10800401 3300009177 Bacteria 1064
220 Ga0105248_10813878 3300009177 Bacteria 1054
221 Ga0105248_10958023 3300009177 Bacteria 966
222 Ga0105248_11161901 3300009177 Bacteria 873
223 Ga0105248_11431423 3300009177 Bacteria 782
224 Ga0105248_11569919 3300009177 Bacteria 745
225 Ga0105237_10202760 3300009545 Bacteria 1984
226 Ga0105238_10059079 3300009551 Bacteria 3842
227 Ga0105238_10081408 3300009551 Bacteria 3227
228 Ga0105249_10034243 3300009553 Bacteria 4601
229 Ga0105249_10044015 3300009553 Bacteria 4060
230 Ga0105239_10164797 3300010375 Bacteria 2478
231 Ga0157373_10038721 3300013100 Bacteria 3416
232 Ga0157371_10180240 3300013102 Bacteria 1511
233 Ga0157371_10207035 3300013102 Bacteria 1407
234 Ga0157370_10633773 3300013104 Bacteria 978
235 Ga0157369_10477794 3300013105 Bacteria 1290
236 Ga0157369_10556672 3300013105 Bacteria 1185
237 Ga0157374_10036720 3300013296 Bacteria 4491
238 Ga0157374_10385984 3300013296 Bacteria 1395
239 Ga0157374_10485991 3300013296 Bacteria 1238
240 Ga0157374_10496992 3300013296 Bacteria 1224
241 Ga0157374_11983319 3300013296 Bacteria 608
242 Ga0157378_10056830 3300013297 Bacteria 3487
243 Ga0157378_10225564 3300013297 Bacteria 1783
244 Ga0163162_10012542 3300013306 Bacteria 8279
245 Ga0163162_10014444 3300013306 Bacteria 7715
246 Ga0163162_10022860 3300013306 Bacteria 6165
247 Ga0163162_10125246 3300013306 Bacteria 2675
248 Ga0163162_11866897 3300013306 Bacteria 687
249 Ga0157372_10016161 3300013307 Bacteria 8007
250 Ga0157372_10167119 3300013307 Bacteria 2544
251 Ga0157372_11601613 3300013307 Bacteria 750
252 Ga0157375_10012775 3300013308 Bacteria 7455
253 Ga0157375_10055359 3300013308 Bacteria 3911
254 Ga0157375_10087197 3300013308 Bacteria 3173
255 Ga0157375_10526352 3300013308 Bacteria 1345
256 Ga0157375_11297456 3300013308 Bacteria 856
257 Ga0157375_11607300 3300013308 Bacteria 769
258 Ga0157375_12270315 3300013308 Bacteria 647
259 Ga0157375_12414126 3300013308 Bacteria 627
260 Ga0163163_10150177 3300014325 Bacteria 2374
261 Ga0163163_11863478 3300014325 Bacteria 661
262 Ga0157380_10021608 3300014326 Bacteria 4829
263 Ga0157380_10134265 3300014326 Bacteria 2116
264 Ga0157380_10363508 3300014326 Bacteria 1359
265 Ga0157380_10670428 3300014326 Bacteria 1037
266 Ga0157380_12035534 3300014326 Bacteria 636
267 Ga0157380_12541904 3300014326 Bacteria 578
268 Ga0157377_10010702 3300014745 Bacteria 4549
269 Ga0157377_10577961 3300014745 Bacteria 798
270 Ga0157377_10670540 3300014745 Bacteria 749
271 Ga0157379_10005388 3300014968 Bacteria 10986
272 Ga0157379_10008057 3300014968 Bacteria 9149
273 Ga0157379_10024645 3300014968 Bacteria 5340
274 Ga0157379_10048970 3300014968 Bacteria 3772
275 Ga0157379_10282749 3300014968 Bacteria 1510
276 Ga0157376_10029054 3300014969 Bacteria 4402
277 Ga0157376_10087726 3300014969 Bacteria 2685
278 Ga0157376_10182194 3300014969 Bacteria 1921
279 Ga0157376_10479036 3300014969 Bacteria 1219
280 Ga0157376_10556354 3300014969 Bacteria 1136
281 Ga0157376_11457986 3300014969 Bacteria 717
282 Ga0182007_10078730 3300015262 Bacteria 1081
283 Ga0163161_10020402 3300017792 Bacteria 4651
284 Ga0163161_10088543 3300017792 Bacteria 2288
285 Ga0163161_10227860 3300017792 Bacteria 1445
286 Ga0163161_10351578 3300017792 Bacteria 1172
287 Ga0163161_10394612 3300017792 Bacteria 1108
288 Ga0163161_11890795 3300017792 Unclassified 531
289 Ga0213872_10000018 3300021361 Bacteria 175951
290 Ga0213874_10100954 3300021377 Bacteria 959
291 Ga0209674_114470 3300025226 Bacteria 705
292 Ga0209563_100005 3300025230 Bacteria 1774893
293 Ga0209564_1000003 3300025295 Bacteria 1585848
294 Ga0209257_1045404 3300025304 Bacteria 1276
295 Ga0207656_10342866 3300025321 Bacteria 745
296 Ga0207656_10443781 3300025321 Bacteria 655
297 Ga0207656_10458227 3300025321 Bacteria 645
298 Ga0207682_10008329 3300025893 Bacteria 4101
299 Ga0207682_10015553 3300025893 Bacteria 2963
300 Ga0207682_10102781 3300025893 Bacteria 1251
301 Ga0207682_10104122 3300025893 Bacteria 1243
302 Ga0207682_10176184 3300025893 Bacteria 975
303 Ga0207682_10232930 3300025893 Bacteria 854
304 Ga0207642_10017450 3300025899 Bacteria 2731
305 Ga0207688_10021937 3300025901 Bacteria 3492
306 Ga0207688_10056594 3300025901 Bacteria 2203
307 Ga0207680_10013987 3300025903 Bacteria 4138
308 Ga0207680_10032671 3300025903 Bacteria 2960
309 Ga0207680_10260846 3300025903 Bacteria 1199
310 Ga0207680_10839231 3300025903 Bacteria 659
311 Ga0207645_10020411 3300025907 Bacteria 4337
312 Ga0207645_10031014 3300025907 Bacteria 3443
313 Ga0207645_10036750 3300025907 Bacteria 3145
314 Ga0207643_10164256 3300025908 Bacteria 1337
315 Ga0207643_10555031 3300025908 Bacteria 737
316 Ga0207705_10347357 3300025909 Bacteria 1142
317 Ga0207705_10912828 3300025909 Bacteria 680
318 Ga0207654_10998937 3300025911 Bacteria 608
319 Ga0207695_10119041 3300025913 Bacteria 2611
320 Ga0207695_10358171 3300025913 Bacteria 1345
321 Ga0207660_10021246 3300025917 Bacteria 4364
322 Ga0207662_10020021 3300025918 Bacteria 3815
323 Ga0207657_10064285 3300025919 Bacteria 3132
324 Ga0207657_10207653 3300025919 Bacteria 1573
325 Ga0207657_10555802 3300025919 Bacteria 897
326 Ga0207649_10101996 3300025920 Bacteria 1901
327 Ga0207649_10445821 3300025920 Bacteria 976
328 Ga0207649_10464478 3300025920 Bacteria 957
329 Ga0207649_10908021 3300025920 Bacteria 691
330 Ga0207652_10008328 3300025921 Bacteria 8336
331 Ga0207681_10002043 3300025923 Bacteria 12940
332 Ga0207681_10033865 3300025923 Bacteria 3354
333 Ga0207681_10138395 3300025923 Bacteria 1810
334 Ga0207681_10382309 3300025923 Bacteria 1133
335 Ga0207694_10236128 3300025924 Bacteria 1493
336 Ga0207694_10345605 3300025924 Bacteria 1231
337 Ga0207650_10001150 3300025925 Bacteria 19435
338 Ga0207650_10019718 3300025925 Bacteria 4743
339 Ga0207650_10092418 3300025925 Bacteria 2314
340 Ga0207650_10213250 3300025925 Bacteria 1551
341 Ga0207650_10236108 3300025925 Bacteria 1476
342 Ga0207650_10237400 3300025925 Bacteria 1472
343 Ga0207650_10647512 3300025925 Bacteria 891
344 Ga0207650_11168055 3300025925 Bacteria 655
345 Ga0207659_10000313 3300025926 Bacteria 29491
346 Ga0207659_10021737 3300025926 Bacteria 4265
347 Ga0207659_10084134 3300025926 Bacteria 2360
348 Ga0207659_10117331 3300025926 Bacteria 2034
349 Ga0207659_10250866 3300025926 Bacteria 1436
350 Ga0207659_11378313 3300025926 Bacteria 605
351 Ga0207687_10562730 3300025927 Bacteria 957
352 Ga0207687_10796177 3300025927 Bacteria 806
353 Ga0207644_10005994 3300025931 Bacteria 7920
354 Ga0207644_10015906 3300025931 Bacteria 5058
355 Ga0207644_10311413 3300025931 Bacteria 1271
356 Ga0207644_10429695 3300025931 Bacteria 1083
357 Ga0207644_10479265 3300025931 Bacteria 1024
358 Ga0207690_10024909 3300025932 Bacteria 3751
359 Ga0207690_10103612 3300025932 Bacteria 2037
360 Ga0207690_10178849 3300025932 Bacteria 1595
361 Ga0207706_10002060 3300025933 Bacteria 19704
362 Ga0207706_10044064 3300025933 Bacteria 3954
363 Ga0207706_10051513 3300025933 Bacteria 3635
364 Ga0207706_10519851 3300025933 Bacteria 1026
365 Ga0207686_10228754 3300025934 Bacteria 1347
366 Ga0207686_10616572 3300025934 Bacteria 855
367 Ga0207670_10045288 3300025936 Bacteria 2916
368 Ga0207670_10482207 3300025936 Bacteria 1004
369 Ga0207669_10129324 3300025937 Bacteria 1732
370 Ga0207669_10215724 3300025937 Bacteria 1404
371 Ga0207669_10326427 3300025937 Bacteria 1176
372 Ga0207669_10426537 3300025937 Bacteria 1045
373 Ga0207704_10008974 3300025938 Bacteria 4805
374 Ga0207704_10733340 3300025938 Bacteria 820
375 Ga0207704_10903558 3300025938 Bacteria 743
376 Ga0207704_11093156 3300025938 Bacteria 677
377 Ga0207691_10005968 3300025940 Bacteria 11764
378 Ga0207691_10024477 3300025940 Bacteria 5677
379 Ga0207691_10042085 3300025940 Bacteria 4213
380 Ga0207691_10128509 3300025940 Bacteria 2240
381 Ga0207691_10142556 3300025940 Bacteria 2110
382 Ga0207691_10268024 3300025940 Bacteria 1471
383 Ga0207691_10281783 3300025940 Bacteria 1430
384 Ga0207691_10342612 3300025940 Bacteria 1279
385 Ga0207691_10684232 3300025940 Bacteria 865
386 Ga0207691_10925120 3300025940 Bacteria 729
387 Ga0207711_10029651 3300025941 Bacteria 4616
388 Ga0207711_10063030 3300025941 Bacteria 3199
389 Ga0207711_10109354 3300025941 Bacteria 2456
390 Ga0207711_10252538 3300025941 Bacteria 1619
391 Ga0207711_10455958 3300025941 Bacteria 1190
392 Ga0207711_10654051 3300025941 Bacteria 980
393 Ga0207689_10000919 3300025942 Bacteria 28269
394 Ga0207689_10028119 3300025942 Bacteria 4702
395 Ga0207689_10675186 3300025942 Bacteria 871
396 Ga0207661_10245559 3300025944 Bacteria 1590
397 Ga0207679_10340823 3300025945 Bacteria 1303
398 Ga0207679_10395117 3300025945 Bacteria 1215
399 Ga0207679_11195197 3300025945 Bacteria 698
400 Ga0207667_10173903 3300025949 Bacteria 2213
401 Ga0207667_11536149 3300025949 Unclassified 636
402 Ga0207651_10000600 3300025960 Bacteria 15181
403 Ga0207651_10601684 3300025960 Unclassified 961
404 Ga0207712_10092618 3300025961 Bacteria 2228
405 Ga0207712_10102163 3300025961 Bacteria 2134
406 Ga0207668_10003052 3300025972 Bacteria 9816
407 Ga0207668_10044827 3300025972 Bacteria 3012
408 Ga0207668_10085729 3300025972 Bacteria 2299
409 Ga0207668_10327845 3300025972 Bacteria 1273
410 Ga0207640_10071608 3300025981 Bacteria 2335
411 Ga0207640_10131167 3300025981 Bacteria 1812
412 Ga0207640_10165065 3300025981 Bacteria 1643
413 Ga0207640_10704600 3300025981 Bacteria 866
414 Ga0207658_10000812 3300025986 Bacteria 26147
415 Ga0207658_10010815 3300025986 Bacteria 6208
416 Ga0207658_10307448 3300025986 Bacteria 1368
417 Ga0207658_10720704 3300025986 Bacteria 902
418 Ga0207658_10833153 3300025986 Bacteria 838
419 Ga0207658_11245991 3300025986 Bacteria 680
420 Ga0207658_11942207 3300025986 Bacteria 536
421 Ga0207677_10003852 3300026023 Bacteria 7986
422 Ga0207677_10004132 3300026023 Bacteria 7767
423 Ga0207677_10197248 3300026023 Bacteria 1597
424 Ga0207677_10522371 3300026023 Bacteria 1030
425 Ga0207677_10539666 3300026023 Bacteria 1015
426 Ga0207677_10679893 3300026023 Bacteria 911
427 Ga0207703_10000929 3300026035 Bacteria 28489
428 Ga0207703_10001541 3300026035 Bacteria 20913
429 Ga0207703_10029734 3300026035 Bacteria 4312
430 Ga0207703_10058830 3300026035 Bacteria 3138
431 Ga0207703_10545621 3300026035 Bacteria 1093
432 Ga0207639_10011019 3300026041 Bacteria 6269
433 Ga0207639_10878392 3300026041 Bacteria 837
434 Ga0207639_10921032 3300026041 Bacteria 817
435 Ga0207639_11555652 3300026041 Bacteria 620
436 Ga0207678_10005670 3300026067 Bacteria 11156
437 Ga0207678_11074831 3300026067 Bacteria 712
438 Ga0207678_11347317 3300026067 Bacteria 631
439 Ga0207702_10023989 3300026078 Bacteria 5061
440 Ga0207702_10171048 3300026078 Bacteria 1992
441 Ga0207641_10033658 3300026088 Bacteria 4257
442 Ga0207641_10037046 3300026088 Bacteria 4072
443 Ga0207641_10090017 3300026088 Bacteria 2682
444 Ga0207641_10149054 3300026088 Bacteria 2117
445 Ga0207641_10244785 3300026088 Bacteria 1672
446 Ga0207641_10574276 3300026088 Bacteria 1102
447 Ga0207648_10084101 3300026089 Bacteria 2775
448 Ga0207648_10230829 3300026089 Bacteria 1646
449 Ga0207648_10275222 3300026089 Bacteria 1505
450 Ga0207648_10469751 3300026089 Bacteria 1148
451 Ga0207648_10817297 3300026089 Bacteria 868
452 Ga0207648_10990746 3300026089 Bacteria 787
453 Ga0207676_10024108 3300026095 Bacteria 4499
454 Ga0207676_10073922 3300026095 Bacteria 2744
455 Ga0207676_10160775 3300026095 Bacteria 1945
456 Ga0207676_10514698 3300026095 Bacteria 1138
457 Ga0207674_10209855 3300026116 Bacteria 1897
458 Ga0207674_10288556 3300026116 Bacteria 1589
459 Ga0207675_100000956 3300026118 Bacteria 28809
460 Ga0207683_10010865 3300026121 Bacteria 7765
461 Ga0207683_10063700 3300026121 Bacteria 3248
462 Ga0207683_10110313 3300026121 Bacteria 2463
463 Ga0207683_10113189 3300026121 Bacteria 2430
464 Ga0207683_10158397 3300026121 Bacteria 2046
465 Ga0207683_10187000 3300026121 Bacteria 1879
466 Ga0207683_10371138 3300026121 Bacteria 1315
467 Ga0207683_10528114 3300026121 Bacteria 1091
468 Ga0207683_10661173 3300026121 Bacteria 968
469 Ga0207683_10887908 3300026121 Bacteria 828
470 Ga0207698_10114183 3300026142 Bacteria 2271
471 Ga0207698_10241234 3300026142 Bacteria 1647
472 Ga0207698_10294853 3300026142 Bacteria 1507
473 Ga0207698_10320561 3300026142 Bacteria 1451
474 Ga0207698_10529024 3300026142 Bacteria 1152
475 Ga0207698_10532484 3300026142 Bacteria 1148
476 Ga0207698_10662854 3300026142 Bacteria 1035
477 Ga0207428_10455903 3300027907 Bacteria 932
478 Ga0268266_10331091 3300028379 Bacteria 1427
479 Ga0268265_10634052 3300028380 Bacteria 1025
480 Ga0268264_10002170 3300028381 Bacteria 17490
481 Ga0268264_10185441 3300028381 Bacteria 1893
482 Ga0268264_10209821 3300028381 Bacteria 1787
483 Ga0268264_11809297 3300028381 Bacteria 621
484 Ga0307408_100051568 3300031548 Bacteria 2964
485 Ga0307410_10569189 3300031852 Bacteria 941
486 Ga0307406_10129229 3300031901 Bacteria 1771
487 Ga0307412_10968417 3300031911 Bacteria 750
488 Ga0307409_100001376 3300031995 Bacteria 11862
489 Ga0307416_100006785 3300032002 Bacteria 7199
490 Ga0307415_100006664 3300032126 Bacteria 6250
491 Ga0307507_10568720 3300033179 Bacteria 593
492 Ga0373938_0018611 3300034957 Bacteria 1380
493 Ga0373926_0179201 3300035083 Bacteria 812
494 Ga0373928_0049242 3300035084 Bacteria 990
495 Ga0373936_0141969 3300035113 Bacteria 1037
496 Ga0373939_0112456 3300035114 Bacteria 950
497 Ga0373945_0043125 3300035116 Bacteria 1636
498 Ga0373943_0231701 3300035170 Bacteria 1032
499 Ga0373924_0092603 3300035410 Bacteria 1294
500 Ga0373931_0005543 3300035691 Bacteria 5849
501 Ga0373935_0118199 3300035692 Bacteria 1768
502 Ga0373935_0969126 3300035692 Bacteria 631
503 Ga0373927_0646620 3300035695 Bacteria 699
504 Ga0373947_0153594 3300035725 Bacteria 1484
505 Ga0373937_0048281 3300036401 Bacteria 3896
506 Ga0373937_0209174 3300036401 Bacteria 1835
507 Ga0373925_0100667 3300037068 Bacteria 2221
508 Ga0373925_0135769 3300037068 Bacteria 1922
509 Ga0436365_1337200 3300039437 Bacteria 2693
510 Ga0436365_1746291 3300039437 Bacteria 1550
511 Ga0436361_0311722 3300039447 Bacteria 807
512 Ga0436361_0677882 3300039447 Bacteria 228834
513 Ga0436363_0917622 3300039450 Bacteria 1744
514 Ga0450919_000063 3300042121 Bacteria 9770
515 Ga0450920_048210 3300042122 Bacteria 853
516 Ga0439458_0035456 3300042157 Bacteria 1199
517 Ga0451577_1146881 3300042876 Bacteria 694
518 Ga0453684_0569047 3300044712 Bacteria 1246
519 Ga0451576_0187750 3300045051 Bacteria 2158
520 Ga0451576_0944702 3300045051 Bacteria 904
521 Ga0495592_0874061 3300046454 Unclassified 530
522 Ga0495629_0150699 3300046459 Bacteria 1616
523 Ga0495629_0210294 3300046459 Bacteria 1344
524 Ga0495628_0365977 3300046516 Bacteria 1058
525 Ga0495630_0854939 3300046517 Bacteria 694
526 Ga0495642_0267357 3300046528 Bacteria 748
527 Ga0495598_0005228 3300046537 Bacteria 2863
528 Ga0495621_0014281 3300046539 Bacteria 2511
529 Ga0495621_0051483 3300046539 Bacteria 1474
530 Ga0495667_0336446 3300046559 Bacteria 955
531 Ga0495657_0402645 3300046675 Bacteria 805
532 Ga0495599_0488424 3300046678 Bacteria 726
533 Ga0495647_0016908 3300046681 Bacteria 2575
534 Ga0495647_0078157 3300046681 Bacteria 1337
535 Ga0495647_0276844 3300046681 Bacteria 752
536 Ga0495658_0101859 3300046683 Bacteria 1715
537 Ga0495658_0240981 3300046683 Bacteria 1136
538 Ga0495658_0250236 3300046683 Bacteria 1114
539 Ga0495658_0276898 3300046683 Bacteria 1058
540 Ga0495613_0272545 3300046689 Bacteria 1177
541 Ga0495600_0218774 3300046809 Bacteria 1219
542 Ga0495684_0131409 3300047471 Bacteria 1880
543 Ga0495684_0298628 3300047471 Bacteria 1157
544 Ga0496100_0062635 3300048903 Bacteria 2455
545 Ga0496100_0317945 3300048903 Bacteria 1169
546 Ga0496101_0107171 3300048904 Bacteria 2099
547 Ga0496101_0294350 3300048904 Bacteria 1270
548 Ga0496101_1156837 3300048904 Bacteria 607
549 Ga0496102_0050677 3300048905 Bacteria 3781
550 Ga0496104_0324693 3300048907 Bacteria 1452
551 Ga0496105_0218799 3300048908 Bacteria 1551
552 Ga0496105_0611696 3300048908 Bacteria 845
553 Ga0496106_0061816 3300048909 Bacteria 2842
554 Ga0496108_0036447 3300048911 Bacteria 4092
555 Ga0496108_0174344 3300048911 Bacteria 1861
556 Ga0496108_0279685 3300048911 Bacteria 1453
557 Ga0496108_0386381 3300048911 Bacteria 1222
558 Ga0496109_0028476 3300048912 Bacteria 4996
559 Ga0496109_0043227 3300048912 Bacteria 4084
560 Ga0496109_1248574 3300048912 Bacteria 679
561 Ga0496110_0013837 3300048913 Bacteria 6686
562 Ga0496111_0015214 3300048914 Bacteria 5275
563 Ga0496111_0548788 3300048914 Bacteria 849
564 Ga0496114_0085754 3300048917 Bacteria 2668
565 Ga0496114_0107614 3300048917 Bacteria 2386
566 Ga0496115_0041667 3300048918 Bacteria 3655
567 Ga0501034_0058447 3300049571 Bacteria 3876
568 nmdc:mga08y16_437046_c1 3300050511 Bacteria 1336
569 nmdc:mga0n895_783597_c1 3300050512 Bacteria 945
570 Ga0495601_0042029 3300053077 Bacteria 2867
571 Ga0495595_0210414 3300053084 Bacteria 969
572 Ga0495619_0012300 3300053085 Bacteria 5386
573 Ga0495619_0360631 3300053085 Bacteria 1005
574 2644248751 2643221644 Bacteria 6865017
575 Ga0105243_10137517
576 rootH1_10023343
577 rootH1_10076455
578 Ga0055525_1000038
579 Ga0055526_1010196
580 Ga0055524_1000510
581 Ga0070658_10175324
582 Ga0070658_11089590
583 Ga0070676_10014860
584 Ga0070683_100031806
585 Ga0070683_100790485
586 Ga0070683_101223212
587 Ga0070690_100025986
588 Ga0070690_100058813
589 Ga0070670_100004764
590 Ga0070670_100034202
591 Ga0070670_100051226
592 Ga0070670_100154253
593 Ga0070670_100189689
594 Ga0070670_100719401
595 Ga0070670_101771270
596 Ga0070677_10010433
597 Ga0070677_10023342
598 Ga0070677_10077000
599 Ga0070677_10132369
600 Ga0070677_10176282
601 Ga0070677_10220038
602 Ga0068869_100006027
603 Ga0068869_100068206
604 Ga0068869_101057312
605 Ga0070666_10031672
606 Ga0070666_10166202
607 Ga0070666_10320465
608 Ga0070666_10469593
609 Ga0070666_10764402
610 Ga0070666_10768111
611 Ga0070680_100063571
612 Ga0068868_100007250
613 Ga0068868_100007330
614 Ga0068868_100472908
615 Ga0068868_100955617
616 Ga0068868_101523107
617 Ga0070660_100056839
618 Ga0070660_100227288
619 Ga0070660_100338720
620 Ga0070660_100823821
621 Ga0070689_100049894
622 Ga0070689_100622508
623 Ga0070689_101240181
624 Ga0070687_100035636
625 Ga0070661_100125423
626 Ga0070661_100216549
627 Ga0070661_100305393
628 Ga0070661_100339483
629 Ga0070668_100021445
630 Ga0070668_100029372
631 Ga0070668_100109791
632 Ga0070669_100030757
633 Ga0070669_100094865
634 Ga0070669_100216675
635 Ga0070669_100698034
636 Ga0070675_100002913
637 Ga0070675_100031478
638 Ga0070675_100054541
639 Ga0070675_100157873
640 Ga0070675_100255222
641 Ga0070675_100304644
642 Ga0070675_100425713
643 Ga0070675_101529209
644 Ga0070671_100008663
645 Ga0070671_100017107
646 Ga0070671_100202270
647 Ga0070671_100424060
648 Ga0070671_100453361
649 Ga0070671_100731252
650 Ga0070674_100029218
651 Ga0070674_100064420
652 Ga0070674_100190740
653 Ga0070674_100526227
654 Ga0070674_100549625
655 Ga0070673_100027451
656 Ga0070673_100267450
657 Ga0070673_100288069
658 Ga0070673_100354152
659 Ga0070688_100542578
660 Ga0070659_100026476
661 Ga0070659_100135654
662 Ga0070659_100481045
663 Ga0070667_100004388
664 Ga0070667_100053630
665 Ga0070667_100251642
666 Ga0070667_100276275
667 Ga0070667_100560186
668 Ga0070667_101710315
669 Ga0070705_100650564
670 Ga0070663_100002045
671 Ga0070663_100585543
672 Ga0070663_100618545
673 Ga0070678_100034228
674 Ga0070678_100078197
675 Ga0070678_100089141
676 Ga0070678_100126140
677 Ga0070678_100134691
678 Ga0070678_100139734
679 Ga0070678_100348534
680 Ga0070678_100361158
681 Ga0070662_100023184
682 Ga0070662_100485718
683 Ga0070662_100545023
684 Ga0070662_100734347
685 Ga0068867_100070968
686 Ga0068867_100071044
687 Ga0068867_100095372
688 Ga0068867_100487256
689 Ga0068867_100528113
690 Ga0068867_100680243
691 Ga0068867_101160900
692 Ga0070685_10176584
693 Ga0070685_10227895
694 Ga0070679_100021313
695 Ga0070684_100063896
696 Ga0070684_100174632
697 Ga0068853_100016917
698 Ga0068853_100696866
699 Ga0068853_100715579
700 Ga0070672_100009036
701 Ga0070672_100013676
702 Ga0070672_100039130
703 Ga0070672_100108581
704 Ga0070672_100110940
705 Ga0070672_100219672
706 Ga0070672_100477259
707 Ga0070672_100576544
708 Ga0070672_100592997
709 Ga0070686_100119616
710 Ga0070686_101279530
711 Ga0070693_100229412
712 Ga0070693_100233410
713 Ga0070693_100324340
714 Ga0070693_101058516
715 Ga0070665_100272154
716 Ga0070665_100749470
717 Ga0070665_100793764
718 Ga0070665_101728176
719 Ga0068855_100187695
720 Ga0068855_100282473
721 Ga0070664_100060332
722 Ga0070664_100115377
723 Ga0070664_100298503
724 Ga0070664_101068930
725 Ga0068857_100209435
726 Ga0068854_100009962
727 Ga0068854_100065117
728 Ga0068854_100907052
729 Ga0068856_100090006
730 Ga0070702_100826051
731 Ga0068852_100007663
732 Ga0068852_100073705
733 Ga0068852_100084612
734 Ga0068852_100424201
735 Ga0068852_100440324
736 Ga0068852_101413527
737 Ga0068859_100028376
738 Ga0068859_100135444
739 Ga0068859_100723670
740 Ga0068864_100001822
741 Ga0068864_100017069
742 Ga0068864_100046435
743 Ga0068864_100089952
744 Ga0068861_100000757
745 Ga0068861_100301307
746 Ga0068861_100499223
747 Ga0068861_100853321
748 Ga0068851_10064815
749 Ga0068851_10194119
750 Ga0068851_11023627
751 Ga0068870_10183416
752 Ga0068863_100043065
753 Ga0068863_100053520
754 Ga0068863_100084171
755 Ga0068863_100099315
756 Ga0068863_100315660
757 Ga0068863_100657400
758 Ga0068863_100745813
759 Ga0068858_100003791
760 Ga0068858_100004338
761 Ga0068858_100019626
762 Ga0068858_100037975
763 Ga0068858_100618030
764 Ga0068860_100004033
765 Ga0068860_100033406
766 Ga0068860_100235775
767 Ga0070715_10086558
768 Ga0097621_100024119
769 Ga0097621_100108629
770 Ga0097621_100170721
771 Ga0068871_100137485
772 Ga0068871_100321538
773 Ga0068871_100517949
774 Ga0068871_101124736
775 Ga0075434_100166543
776 Ga0068865_100222079
777 Ga0068865_100246655
778 Ga0097620_100028376
779 Ga0097620_100135435
780 Ga0097620_100723676
781 Ga0105240_11876372
782 Ga0111539_10534364
783 Ga0105245_10668103
784 Ga0105243_10033813
785 Ga0105241_11467653
786 Ga0105242_10523722
787 Ga0105242_10629411
788 Ga0105248_10022083
789 Ga0105248_10081871
790 Ga0105248_10209361
791 Ga0105248_10368514
792 Ga0105248_10777678
793 Ga0105248_10800401
794 Ga0105248_10813878
795 Ga0105248_10958023
796 Ga0105248_11161901
797 Ga0105248_11431423
798 Ga0105248_11569919
799 Ga0105237_10202760
800 Ga0105238_10059079
801 Ga0105238_10081408
802 Ga0105249_10034243
803 Ga0105249_10044015
804 Ga0105239_10164797
805 Ga0157373_10038721
806 Ga0157371_10180240
807 Ga0157371_10207035
808 Ga0157370_10633773
809 Ga0157369_10477794
810 Ga0157369_10556672
811 Ga0157374_10036720
812 Ga0157374_10385984
813 Ga0157374_10485991
814 Ga0157374_10496992
815 Ga0157374_11983319
816 Ga0157378_10056830
817 Ga0157378_10225564
818 Ga0163162_10012542
819 Ga0163162_10014444
820 Ga0163162_10022860
821 Ga0163162_10125246
822 Ga0163162_11866897
823 Ga0157372_10016161
824 Ga0157372_10167119
825 Ga0157372_11601613
826 Ga0157375_10012775
827 Ga0157375_10055359
828 Ga0157375_10087197
829 Ga0157375_10526352
830 Ga0157375_11297456
831 Ga0157375_11607300
832 Ga0157375_12270315
833 Ga0157375_12414126
834 Ga0163163_10150177
835 Ga0163163_11863478
836 Ga0157380_10021608
837 Ga0157380_10134265
838 Ga0157380_10363508
839 Ga0157380_10670428
840 Ga0157380_12035534
841 Ga0157380_12541904
842 Ga0157377_10010702
843 Ga0157377_10577961
844 Ga0157377_10670540
845 Ga0157379_10005388
846 Ga0157379_10008057
847 Ga0157379_10024645
848 Ga0157379_10048970
849 Ga0157379_10282749
850 Ga0157376_10029054
851 Ga0157376_10087726
852 Ga0157376_10182194
853 Ga0157376_10479036
854 Ga0157376_10556354
855 Ga0157376_11457986
856 Ga0182007_10078730
857 Ga0163161_10020402
858 Ga0163161_10088543
859 Ga0163161_10227860
860 Ga0163161_10351578
861 Ga0163161_10394612
862 Ga0163161_11890795
863 Ga0213872_10000018
864 Ga0213874_10100954
865 Ga0209674_114470
866 Ga0209563_100005
867 Ga0209564_1000003
868 Ga0209257_1045404
869 Ga0207656_10342866
870 Ga0207656_10443781
871 Ga0207656_10458227
872 Ga0207682_10008329
873 Ga0207682_10015553
874 Ga0207682_10102781
875 Ga0207682_10104122
876 Ga0207682_10176184
877 Ga0207682_10232930
878 Ga0207642_10017450
879 Ga0207688_10021937
880 Ga0207688_10056594
881 Ga0207680_10013987
882 Ga0207680_10032671
883 Ga0207680_10260846
884 Ga0207680_10839231
885 Ga0207645_10020411
886 Ga0207645_10031014
887 Ga0207645_10036750
888 Ga0207643_10164256
889 Ga0207643_10555031
890 Ga0207705_10347357
891 Ga0207705_10912828
892 Ga0207654_10998937
893 Ga0207695_10119041
894 Ga0207695_10358171
895 Ga0207660_10021246
896 Ga0207662_10020021
897 Ga0207657_10064285
898 Ga0207657_10207653
899 Ga0207657_10555802
900 Ga0207649_10101996
901 Ga0207649_10445821
902 Ga0207649_10464478
903 Ga0207649_10908021
904 Ga0207652_10008328
905 Ga0207681_10002043
906 Ga0207681_10033865
907 Ga0207681_10138395
908 Ga0207681_10382309
909 Ga0207694_10236128
910 Ga0207694_10345605
911 Ga0207650_10001150
912 Ga0207650_10019718
913 Ga0207650_10092418
914 Ga0207650_10213250
915 Ga0207650_10236108
916 Ga0207650_10237400
917 Ga0207650_10647512
918 Ga0207650_11168055
919 Ga0207659_10000313
920 Ga0207659_10021737
921 Ga0207659_10084134
922 Ga0207659_10117331
923 Ga0207659_10250866
924 Ga0207659_11378313
925 Ga0207687_10562730
926 Ga0207687_10796177
927 Ga0207644_10005994
928 Ga0207644_10015906
929 Ga0207644_10311413
930 Ga0207644_10429695
931 Ga0207644_10479265
932 Ga0207690_10024909
933 Ga0207690_10103612
934 Ga0207690_10178849
935 Ga0207706_10002060
936 Ga0207706_10044064
937 Ga0207706_10051513
938 Ga0207706_10519851
939 Ga0207686_10228754
940 Ga0207686_10616572
941 Ga0207670_10045288
942 Ga0207670_10482207
943 Ga0207669_10129324
944 Ga0207669_10215724
945 Ga0207669_10326427
946 Ga0207669_10426537
947 Ga0207704_10008974
948 Ga0207704_10733340
949 Ga0207704_10903558
950 Ga0207704_11093156
951 Ga0207691_10005968
952 Ga0207691_10024477
953 Ga0207691_10042085
954 Ga0207691_10128509
955 Ga0207691_10142556
956 Ga0207691_10268024
957 Ga0207691_10281783
958 Ga0207691_10342612
959 Ga0207691_10684232
960 Ga0207691_10925120
961 Ga0207711_10029651
962 Ga0207711_10063030
963 Ga0207711_10109354
964 Ga0207711_10252538
965 Ga0207711_10455958
966 Ga0207711_10654051
967 Ga0207689_10000919
968 Ga0207689_10028119
969 Ga0207689_10675186
970 Ga0207661_10245559
971 Ga0207679_10340823
972 Ga0207679_10395117
973 Ga0207679_11195197
974 Ga0207667_10173903
975 Ga0207667_11536149
976 Ga0207651_10000600
977 Ga0207651_10601684
978 Ga0207712_10092618
979 Ga0207712_10102163
980 Ga0207668_10003052
981 Ga0207668_10044827
982 Ga0207668_10085729
983 Ga0207668_10327845
984 Ga0207640_10071608
985 Ga0207640_10131167
986 Ga0207640_10165065
987 Ga0207640_10704600
988 Ga0207658_10000812
989 Ga0207658_10010815
990 Ga0207658_10307448
991 Ga0207658_10720704
992 Ga0207658_10833153
993 Ga0207658_11245991
994 Ga0207658_11942207
995 Ga0207677_10003852
996 Ga0207677_10004132
997 Ga0207677_10197248
998 Ga0207677_10522371
999 Ga0207677_10539666
1000 Ga0207677_10679893
1001 Ga0207703_10000929
1002 Ga0207703_10001541
1003 Ga0207703_10029734
1004 Ga0207703_10058830
1005 Ga0207703_10545621
1006 Ga0207639_10011019
1007 Ga0207639_10878392
1008 Ga0207639_10921032
1009 Ga0207639_11555652
1010 Ga0207678_10005670
1011 Ga0207678_11074831
1012 Ga0207678_11347317
1013 Ga0207702_10023989
1014 Ga0207702_10171048
1015 Ga0207641_10033658
1016 Ga0207641_10037046
1017 Ga0207641_10090017
1018 Ga0207641_10149054
1019 Ga0207641_10244785
1020 Ga0207641_10574276
1021 Ga0207648_10084101
1022 Ga0207648_10230829
1023 Ga0207648_10275222
1024 Ga0207648_10469751
1025 Ga0207648_10817297
1026 Ga0207648_10990746
1027 Ga0207676_10024108
1028 Ga0207676_10073922
1029 Ga0207676_10160775
1030 Ga0207676_10514698
1031 Ga0207674_10209855
1032 Ga0207674_10288556
1033 Ga0207675_100000956
1034 Ga0207683_10010865
1035 Ga0207683_10063700
1036 Ga0207683_10110313
1037 Ga0207683_10113189
1038 Ga0207683_10158397
1039 Ga0207683_10187000
1040 Ga0207683_10371138
1041 Ga0207683_10528114
1042 Ga0207683_10661173
1043 Ga0207683_10887908
1044 Ga0207698_10114183
1045 Ga0207698_10241234
1046 Ga0207698_10294853
1047 Ga0207698_10320561
1048 Ga0207698_10529024
1049 Ga0207698_10532484
1050 Ga0207698_10662854
1051 Ga0207428_10455903
1052 Ga0268266_10331091
1053 Ga0268265_10634052
1054 Ga0268264_10002170
1055 Ga0268264_10185441
1056 Ga0268264_10209821
1057 Ga0268264_11809297
1058 Ga0307408_100051568
1059 Ga0307410_10569189
1060 Ga0307406_10129229
1061 Ga0307412_10968417
1062 Ga0307409_100001376
1063 Ga0307416_100006785
1064 Ga0307415_100006664
1065 Ga0307507_10568720
1066 Ga0373938_0018611
1067 Ga0373926_0179201
1068 Ga0373928_0049242
1069 Ga0373936_0141969
1070 Ga0373939_0112456
1071 Ga0373945_0043125
1072 Ga0373943_0231701
1073 Ga0373924_0092603
1074 Ga0373931_0005543
1075 Ga0373935_0118199
1076 Ga0373935_0969126
1077 Ga0373927_0646620
1078 Ga0373947_0153594
1079 Ga0373937_0048281
1080 Ga0373937_0209174
1081 Ga0373925_0100667
1082 Ga0373925_0135769
1083 Ga0436365_1337200
1084 Ga0436365_1746291
1085 Ga0436361_0311722
1086 Ga0436361_0677882
1087 Ga0436363_0917622
1088 Ga0450919_000063
1089 Ga0450920_048210
1090 Ga0439458_0035456
1091 Ga0451577_1146881
1092 Ga0453684_0569047
1093 Ga0451576_0187750
1094 Ga0451576_0944702
1095 Ga0495592_0874061
1096 Ga0495629_0150699
1097 Ga0495629_0210294
1098 Ga0495628_0365977
1099 Ga0495630_0854939
1100 Ga0495642_0267357
1101 Ga0495598_0005228
1102 Ga0495621_0014281
1103 Ga0495621_0051483
1104 Ga0495667_0336446
1105 Ga0495657_0402645
1106 Ga0495599_0488424
1107 Ga0495647_0016908
1108 Ga0495647_0078157
1109 Ga0495647_0276844
1110 Ga0495658_0101859
1111 Ga0495658_0240981
1112 Ga0495658_0250236
1113 Ga0495658_0276898
1114 Ga0495613_0272545
1115 Ga0495600_0218774
1116 Ga0495684_0131409
1117 Ga0495684_0298628
1118 Ga0496100_0062635
1119 Ga0496100_0317945
1120 Ga0496101_0107171
1121 Ga0496101_0294350
1122 Ga0496101_1156837
1123 Ga0496102_0050677
1124 Ga0496104_0324693
1125 Ga0496105_0218799
1126 Ga0496105_0611696
1127 Ga0496106_0061816
1128 Ga0496108_0036447
1129 Ga0496108_0174344
1130 Ga0496108_0279685
1131 Ga0496108_0386381
1132 Ga0496109_0028476
1133 Ga0496109_0043227
1134 Ga0496109_1248574
1135 Ga0496110_0013837
1136 Ga0496111_0015214
1137 Ga0496111_0548788
1138 Ga0496114_0085754
1139 Ga0496114_0107614
1140 Ga0496115_0041667
1141 Ga0501034_0058447
1142 nmdc:mga08y16_437046_c1
1143 nmdc:mga0n895_783597_c1
1144 Ga0495601_0042029
1145 Ga0495595_0210414
1146 Ga0495619_0012300
1147 Ga0495619_0360631
1148 2644248751

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Map