metagRoot

F465130

General Info

Members	Datasets	Scaffolds	Average Seq Length
572	256	1144	159

Family's Representative Sequence

Representative Sequence	3300050512\|nmdc:mga0n895_1408229_c1\|nmdc:mga0n895_1408229_c1_55_588
Length	177
Sequence	MTRPQARETSREILKIVPLVMRTVAAELRAAGELPAPAHFGLLSMLSERPRMLTELASIQGVSLPTISNSISAMVARGWVRRTAPGTDRRVVIIEVTATGRGALERVARAAEAHLADVLAPLDLPAKRRLQAGLGVLCSVFAAHPDAKNRRTDRSPGGRVSRKRHRTWPKRRPYLSQ

Samples

	Sample ID	Description	Type	Environment
1	3300050512	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation	Metagenome	Rhizosphere
2	2162886012	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1	Metagenome	Rhizosphere
3	3300005290	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3)	Metagenome	Rhizosphere
4	3300005327	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG	Metagenome	Rhizosphere
5	3300005328	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG	Metagenome	Rhizosphere
6	3300005330	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG	Metagenome	Rhizosphere
7	3300005331	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG	Metagenome	Rhizosphere
8	3300005333	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG	Metagenome	Rhizosphere
9	3300005334	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2	Metagenome	Rhizosphere
10	3300005335	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG	Metagenome	Rhizosphere
11	3300005336	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG	Metagenome	Rhizosphere
12	3300005337	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG	Metagenome	Rhizosphere
13	3300005338	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2	Metagenome	Rhizosphere
14	3300005339	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG	Metagenome	Rhizosphere
15	3300005340	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG	Metagenome	Rhizosphere
16	3300005341	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG	Metagenome	Rhizosphere
17	3300005343	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG	Metagenome	Rhizosphere
18	3300005344	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG	Metagenome	Rhizosphere
19	3300005345	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG	Metagenome	Rhizosphere
20	3300005353	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG	Metagenome	Rhizosphere
21	3300005355	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG	Metagenome	Rhizosphere
22	3300005356	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG	Metagenome	Rhizosphere
23	3300005364	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG	Metagenome	Rhizosphere
24	3300005365	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG	Metagenome	Rhizosphere
25	3300005366	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG	Metagenome	Rhizosphere
26	3300005367	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG	Metagenome	Rhizosphere
27	3300005406	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG	Metagenome	Rhizosphere
28	3300005434	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG	Metagenome	Rhizosphere
29	3300005439	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG	Metagenome	Rhizosphere
30	3300005440	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG	Metagenome	Rhizosphere
31	3300005441	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG	Metagenome	Rhizosphere
32	3300005444	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG	Metagenome	Rhizosphere
33	3300005445	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG	Metagenome	Rhizosphere
34	3300005456	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG	Metagenome	Rhizosphere
35	3300005457	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG	Metagenome	Rhizosphere
36	3300005458	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG	Metagenome	Rhizosphere
37	3300005459	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2	Metagenome	Rhizosphere
38	3300005466	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG	Metagenome	Rhizosphere
39	3300005467	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG	Metagenome	Rhizosphere
40	3300005468	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG	Metagenome	Rhizosphere
41	3300005471	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG	Metagenome	Rhizosphere
42	3300005530	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG	Metagenome	Rhizosphere
43	3300005535	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG	Metagenome	Rhizosphere
44	3300005536	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG	Metagenome	Rhizosphere
45	3300005539	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2	Metagenome	Rhizosphere
46	3300005543	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG	Metagenome	Rhizosphere
47	3300005544	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG	Metagenome	Rhizosphere
48	3300005545	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG	Metagenome	Rhizosphere
49	3300005548	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG	Metagenome	Rhizosphere
50	3300005549	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG	Metagenome	Rhizosphere
51	3300005563	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2	Metagenome	Rhizosphere
52	3300005564	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG	Metagenome	Rhizosphere
53	3300005577	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2	Metagenome	Rhizosphere
54	3300005578	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2	Metagenome	Rhizosphere
55	3300005617	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2	Metagenome	Rhizosphere
56	3300005618	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2	Metagenome	Rhizosphere
57	3300005718	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2	Metagenome	Rhizosphere
58	3300005719	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2	Metagenome	Rhizosphere
59	3300005834	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2	Metagenome	Rhizosphere
60	3300005841	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2	Metagenome	Rhizosphere
61	3300005842	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2	Metagenome	Rhizosphere
62	3300005843	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2	Metagenome	Rhizosphere
63	3300005844	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2	Metagenome	Rhizosphere
64	3300005937	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1	Metagenome	Rhizosphere
65	3300005985	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2	Metagenome	Rhizosphere
66	3300006163	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG	Metagenome	Rhizosphere
67	3300006173	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG	Metagenome	Rhizosphere
68	3300006237	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2)	Metagenome	Rhizosphere
69	3300006358	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2	Metagenome	Rhizosphere
70	3300006844	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2	Metagenome	Rhizosphere
71	3300006846	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4	Metagenome	Rhizosphere
72	3300006852	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2	Metagenome	Rhizosphere
73	3300006871	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3	Metagenome	Rhizosphere
74	3300006880	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3	Metagenome	Rhizosphere
75	3300006881	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2	Metagenome	Rhizosphere
76	3300006914	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5	Metagenome	Rhizosphere
77	3300006931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2)	Metagenome	Rhizosphere
78	3300007076	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4	Metagenome	Rhizosphere
79	3300007788	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2	Metagenome	Rhizosphere
80	3300009011	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG	Metagenome	Rhizosphere
81	3300009094	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2)	Metagenome	Rhizosphere
82	3300009098	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG	Metagenome	Rhizosphere
83	3300009147	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2)	Metagenome	Rhizosphere
84	3300009148	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG	Metagenome	Rhizosphere
85	3300009174	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG	Metagenome	Rhizosphere
86	3300009176	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG	Metagenome	Rhizosphere
87	3300009177	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG	Metagenome	Rhizosphere
88	3300009551	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG	Metagenome	Rhizosphere
89	3300009553	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG	Metagenome	Rhizosphere
90	3300011119	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG	Metagenome	Rhizosphere
91	3300013296	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG	Metagenome	Rhizosphere
92	3300013297	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG	Metagenome	Rhizosphere
93	3300013306	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG	Metagenome	Rhizosphere
94	3300013307	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG	Metagenome	Rhizosphere
95	3300013308	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG	Metagenome	Rhizosphere
96	3300014325	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG	Metagenome	Rhizosphere
97	3300014326	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG	Metagenome	Rhizosphere
98	3300014745	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG	Metagenome	Rhizosphere
99	3300014968	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG	Metagenome	Rhizosphere
100	3300014969	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG	Metagenome	Rhizosphere
101	3300017792	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG	Metagenome	Rhizosphere
102	3300025315	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2)	Metagenome	Rhizosphere
103	3300025321	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
104	3300025885	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
105	3300025893	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
106	3300025899	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
107	3300025900	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
108	3300025901	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2)	Metagenome	Rhizosphere
109	3300025903	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
110	3300025906	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
111	3300025907	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
112	3300025908	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
113	3300025910	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
114	3300025912	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
115	3300025913	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
116	3300025916	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
117	3300025917	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
118	3300025918	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
119	3300025919	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
120	3300025920	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
121	3300025921	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
122	3300025923	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
123	3300025924	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
124	3300025925	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
125	3300025926	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
126	3300025927	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
127	3300025931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
128	3300025932	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
129	3300025933	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
130	3300025934	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
131	3300025936	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
132	3300025937	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
133	3300025938	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
134	3300025939	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
135	3300025940	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
136	3300025941	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
137	3300025942	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
138	3300025945	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
139	3300025949	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
140	3300025960	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
141	3300025981	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
142	3300025986	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
143	3300026023	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
144	3300026035	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
145	3300026041	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
146	3300026067	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
147	3300026075	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
148	3300026088	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
149	3300026089	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
150	3300026095	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
151	3300026116	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
152	3300026118	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
153	3300026121	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
154	3300027907	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3)	Metagenome	Rhizosphere
155	3300028379	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
156	3300028380	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
157	3300028381	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
158	3300031548	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3	Metagenome	Rhizosphere
159	3300034816	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3	Metagenome	Rhizosphere
160	3300034817	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1	Metagenome	Rhizosphere
161	3300034818	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3	Metagenome	Rhizosphere
162	3300034819	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1	Metagenome	Rhizosphere
163	3300034820	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2	Metagenome	Rhizosphere
164	3300034957	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2	Metagenome	Rhizosphere
165	3300035083	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17	Metagenome	Rhizosphere
166	3300035085	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2	Metagenome	Rhizosphere
167	3300035086	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4	Metagenome	Rhizosphere
168	3300035088	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4	Metagenome	Rhizosphere
169	3300035089	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2	Metagenome	Rhizosphere
170	3300035091	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4	Metagenome	Rhizosphere
171	3300035092	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11	Metagenome	Rhizosphere
172	3300035112	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16	Metagenome	Rhizosphere
173	3300035113	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12	Metagenome	Rhizosphere
174	3300035115	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11	Metagenome	Rhizosphere
175	3300035117	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1	Metagenome	Rhizosphere
176	3300035118	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2	Metagenome	Rhizosphere
177	3300035119	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4	Metagenome	Rhizosphere
178	3300035121	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3	Metagenome	Rhizosphere
179	3300035170	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1	Metagenome	Rhizosphere
180	3300035171	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4	Metagenome	Rhizosphere
181	3300035172	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3	Metagenome	Rhizosphere
182	3300035207	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16	Metagenome	Rhizosphere
183	3300035241	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4	Metagenome	Rhizosphere
184	3300035242	Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11	Metagenome	Rhizosphere
185	3300035410	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12	Metagenome	Rhizosphere
186	3300035691	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4	Metagenome	Rhizosphere
187	3300035692	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11	Metagenome	Rhizosphere
188	3300035695	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19	Metagenome	Rhizosphere
189	3300035724	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1	Metagenome	Rhizosphere
190	3300035725	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8	Metagenome	Rhizosphere
191	3300036401	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16	Metagenome	Rhizosphere
192	3300037068	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16	Metagenome	Rhizosphere
193	3300045051	Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED	Metagenome	Rhizosphere
194	3300045976	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R	Metagenome	Rhizosphere
195	3300046454	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere	Metagenome	Rhizosphere
196	3300046455	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere	Metagenome	Rhizosphere
197	3300046459	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere	Metagenome	Rhizosphere
198	3300046462	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere	Metagenome	Rhizosphere
199	3300046463	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere	Metagenome	Rhizosphere
200	3300046472	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere	Metagenome	Rhizosphere
201	3300046473	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere	Metagenome	Rhizosphere
202	3300046475	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere	Metagenome	Rhizosphere
203	3300046477	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere	Metagenome	Rhizosphere
204	3300046511	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere	Metagenome	Rhizosphere
205	3300046514	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere	Metagenome	Rhizosphere
206	3300046516	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere	Metagenome	Rhizosphere
207	3300046517	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere	Metagenome	Rhizosphere
208	3300046529	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere	Metagenome	Rhizosphere
209	3300046531	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere	Metagenome	Rhizosphere
210	3300046535	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere	Metagenome	Rhizosphere
211	3300046536	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere	Metagenome	Rhizosphere
212	3300046539	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere	Metagenome	Rhizosphere
213	3300046543	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere	Metagenome	Rhizosphere
214	3300046559	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere	Metagenome	Rhizosphere
215	3300046615	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere	Metagenome	Rhizosphere
216	3300046642	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere	Metagenome	Rhizosphere
217	3300046663	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere	Metagenome	Rhizosphere
218	3300046683	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere	Metagenome	Rhizosphere
219	3300046684	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere	Metagenome	Rhizosphere
220	3300046689	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere	Metagenome	Rhizosphere
221	3300046691	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere	Metagenome	Rhizosphere
222	3300046694	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere	Metagenome	Rhizosphere
223	3300046809	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere	Metagenome	Rhizosphere
224	3300047317	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere	Metagenome	Rhizosphere
225	3300047319	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere	Metagenome	Rhizosphere
226	3300047320	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere	Metagenome	Rhizosphere
227	3300047321	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere	Metagenome	Rhizosphere
228	3300047444	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere	Metagenome	Rhizosphere
229	3300047471	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere	Metagenome	Rhizosphere
230	3300048089	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere	Metagenome	Rhizosphere
231	3300048903	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled	Metagenome	Rhizoplane
232	3300048904	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled	Metagenome	Rhizoplane
233	3300048907	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15	Metagenome	Rhizoplane
234	3300048908	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15	Metagenome	Rhizoplane
235	3300048909	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15	Metagenome	Rhizoplane
236	3300048911	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled	Metagenome	Rhizoplane
237	3300048912	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled	Metagenome	Rhizoplane
238	3300048913	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15	Metagenome	Rhizoplane
239	3300048914	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15	Metagenome	Rhizoplane
240	3300048915	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15	Metagenome	Rhizoplane
241	3300048916	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15	Metagenome	Rhizoplane
242	3300048917	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15	Metagenome	Rhizoplane
243	3300048918	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15	Metagenome	Rhizoplane
244	3300049743	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03	Metagenome	Rhizosphere
245	3300049744	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02	Metagenome	Rhizosphere
246	3300050507	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation	Metagenome	Rhizosphere
247	3300050508	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation	Metagenome	Rhizosphere
248	3300050509	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation	Metagenome	Rhizosphere
249	3300050511	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation	Metagenome	Rhizosphere
250	3300050513	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation	Metagenome	Rhizosphere
251	3300050514	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation	Metagenome	Rhizosphere
252	3300050515	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation	Metagenome	Rhizosphere
253	3300053077	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere	Metagenome	Rhizosphere
254	3300053084	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere	Metagenome	Rhizosphere
255	3300053085	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere	Metagenome	Rhizosphere
256	3300061734	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2)	Metagenome	Rhizosphere

Type Distribution

Type	Percentage (%)
Metagenomes	100
Metatranscriptomes	0
Isolates	0

Biome Distribution

Category	Percentage (%)
Aerial Root	0
Bulb	0
Endosphere	0
Nodule	0
Rhizoplane	6.12
Rhizosphere	93.88
Stem	0
Stem Tuber	0
Unclassified	18.71

Taxonomy

Scaffolds

	Scaffold	Dataset	Taxonomy	Length
1	nmdc:mga0n895_1408229_c1	3300050512	Bacteria	665
2	MBSR1b_contig_9732256	2162886012	Bacteria	853
3	Ga0065712_10080672	3300005290	Bacteria	3079
4	Ga0070658_10051493	3300005327	Bacteria	3337
5	Ga0070676_10802343	3300005328	Bacteria	695
6	Ga0070690_100657842	3300005330	Bacteria	801
7	Ga0070670_100133851	3300005331	Unclassified	2141
8	Ga0070670_100150066	3300005331	Bacteria	2017
9	Ga0070670_100259229	3300005331	Bacteria	1515
10	Ga0070677_10034824	3300005333	Bacteria	1948
11	Ga0068869_100041849	3300005334	Bacteria	3282
12	Ga0070666_10006632	3300005335	Bacteria	7121
13	Ga0070666_10112900	3300005335	Bacteria	1880
14	Ga0070666_10134410	3300005335	Bacteria	1720
15	Ga0070666_10236911	3300005335	Unclassified	1290
16	Ga0070666_10242104	3300005335	Bacteria	1276
17	Ga0070680_100464829	3300005336	Bacteria	1081
18	Ga0070680_100654604	3300005336	Bacteria	903
19	Ga0070682_100455795	3300005337	Unclassified	980
20	Ga0068868_100019906	3300005338	Bacteria	5033
21	Ga0068868_100150545	3300005338	Bacteria	1916
22	Ga0068868_100170240	3300005338	Bacteria	1803
23	Ga0068868_100624881	3300005338	Bacteria	957
24	Ga0068868_100731406	3300005338	Bacteria	888
25	Ga0070660_100040798	3300005339	Unclassified	3535
26	Ga0070660_100113585	3300005339	Unclassified	2157
27	Ga0070689_100221999	3300005340	Bacteria	1550
28	Ga0070689_100335865	3300005340	Unclassified	1265
29	Ga0070691_10184739	3300005341	Unclassified	1087
30	Ga0070687_100143553	3300005343	Unclassified	1393
31	Ga0070687_100260314	3300005343	Bacteria	1082
32	Ga0070687_101455489	3300005343	Unclassified	514
33	Ga0070661_100048919	3300005344	Bacteria	3096
34	Ga0070692_10689010	3300005345	Unclassified	686
35	Ga0070669_100009978	3300005353	Bacteria	6752
36	Ga0070669_101039571	3300005353	Bacteria	704
37	Ga0070669_101170869	3300005353	Unclassified	663
38	Ga0070671_100029323	3300005355	Bacteria	4537
39	Ga0070671_100221797	3300005355	Bacteria	1604
40	Ga0070674_100443717	3300005356	Bacteria	1070
41	Ga0070674_100495161	3300005356	Bacteria	1017
42	Ga0070674_100510440	3300005356	Unclassified	1003
43	Ga0070673_100049739	3300005364	Bacteria	3274
44	Ga0070673_100051577	3300005364	Bacteria	3223
45	Ga0070673_100180138	3300005364	Bacteria	1808
46	Ga0070673_101014867	3300005364	Bacteria	773
47	Ga0070688_100053498	3300005365	Unclassified	2526
48	Ga0070688_100129144	3300005365	Bacteria	1703
49	Ga0070688_100135983	3300005365	Bacteria	1664
50	Ga0070688_100253093	3300005365	Bacteria	1255
51	Ga0070659_100088201	3300005366	Bacteria	2484
52	Ga0070659_100211577	3300005366	Bacteria	1598
53	Ga0070659_100657167	3300005366	Unclassified	904
54	Ga0070659_101094826	3300005366	Bacteria	702
55	Ga0070667_100040668	3300005367	Bacteria	3899
56	Ga0070667_100083105	3300005367	Bacteria	2743
57	Ga0070667_100696607	3300005367	Bacteria	940
58	Ga0070703_10357919	3300005406	Bacteria	625
59	Ga0070709_10164623	3300005434	Bacteria	1545
60	Ga0070709_10407174	3300005434	Unclassified	1017
61	Ga0070711_100162085	3300005439	Unclassified	1696
62	Ga0070705_100120728	3300005440	Bacteria	1692
63	Ga0070700_101556122	3300005441	Unclassified	563
64	Ga0070694_100548862	3300005444	Unclassified	925
65	Ga0070694_100574722	3300005444	Unclassified	905
66	Ga0070708_100151768	3300005445	Bacteria	2155
67	Ga0070678_100107653	3300005456	Unclassified	2175
68	Ga0070678_100184549	3300005456	Bacteria	1710
69	Ga0070678_100580540	3300005456	Bacteria	998
70	Ga0070662_100138033	3300005457	Bacteria	1887
71	Ga0070681_10064889	3300005458	Bacteria	3621
72	Ga0070681_10136626	3300005458	Bacteria	2382
73	Ga0068867_100015338	3300005459	Bacteria	5433
74	Ga0068867_100069968	3300005459	Bacteria	2622
75	Ga0068867_100411354	3300005459	Bacteria	1143
76	Ga0068867_100554817	3300005459	Bacteria	996
77	Ga0068867_101551198	3300005459	Unclassified	618
78	Ga0070685_10039857	3300005466	Unclassified	2671
79	Ga0070706_100884463	3300005467	Bacteria	825
80	Ga0070707_100639705	3300005468	Bacteria	1026
81	Ga0070698_100037910	3300005471	Bacteria	4969
82	Ga0070679_100057554	3300005530	Bacteria	3875
83	Ga0070679_100203723	3300005530	Bacteria	1943
84	Ga0070679_100516901	3300005530	Bacteria	1138
85	Ga0070679_100920074	3300005530	Unclassified	818
86	Ga0070684_100104233	3300005535	Bacteria	2537
87	Ga0070684_100858303	3300005535	Bacteria	850
88	Ga0070697_100122063	3300005536	Bacteria	2180
89	Ga0068853_101076060	3300005539	Bacteria	775
90	Ga0068853_101813194	3300005539	Unclassified	591
91	Ga0070672_100264780	3300005543	Bacteria	1450
92	Ga0070672_100330861	3300005543	Bacteria	1296
93	Ga0070672_101117564	3300005543	Bacteria	701
94	Ga0070686_100002261	3300005544	Bacteria	10623
95	Ga0070686_100243662	3300005544	Unclassified	1310
96	Ga0070686_100522160	3300005544	Bacteria	924
97	Ga0070695_100054133	3300005545	Bacteria	2582
98	Ga0070695_101316493	3300005545	Bacteria	597
99	Ga0070665_100007278	3300005548	Bacteria	11250
100	Ga0070665_100022577	3300005548	Bacteria	6334
101	Ga0070665_100038039	3300005548	Bacteria	4837
102	Ga0070665_100042980	3300005548	Bacteria	4543
103	Ga0070704_100104169	3300005549	Bacteria	2145
104	Ga0070704_100164455	3300005549	Bacteria	1758
105	Ga0070704_101081474	3300005549	Bacteria	728
106	Ga0068855_100071607	3300005563	Bacteria	4031
107	Ga0068855_100982148	3300005563	Bacteria	888
108	Ga0070664_100981657	3300005564	Unclassified	793
109	Ga0070664_101127657	3300005564	Unclassified	739
110	Ga0068857_100258131	3300005577	Bacteria	1599
111	Ga0068857_101278386	3300005577	Unclassified	712
112	Ga0068854_100031715	3300005578	Bacteria	3673
113	Ga0068854_100397565	3300005578	Bacteria	1139
114	Ga0068859_100015936	3300005617	Bacteria	7555
115	Ga0068859_100284050	3300005617	Bacteria	1748
116	Ga0068859_100307675	3300005617	Unclassified	1678
117	Ga0068859_100310239	3300005617	Bacteria	1671
118	Ga0068859_100615707	3300005617	Bacteria	1178
119	Ga0068859_100721791	3300005617	Bacteria	1086
120	Ga0068864_100011465	3300005618	Bacteria	7323
121	Ga0068864_100064186	3300005618	Bacteria	3184
122	Ga0068864_100220536	3300005618	Bacteria	1749
123	Ga0068864_101160531	3300005618	Bacteria	770
124	Ga0068866_10327583	3300005718	Bacteria	966
125	Ga0068861_100093413	3300005719	Bacteria	2379
126	Ga0068861_100566511	3300005719	Bacteria	1037
127	Ga0068851_10127756	3300005834	Unclassified	1372
128	Ga0068851_10773350	3300005834	Bacteria	595
129	Ga0068863_100030478	3300005841	Bacteria	5150
130	Ga0068863_100065985	3300005841	Bacteria	3424
131	Ga0068863_100230676	3300005841	Bacteria	1786
132	Ga0068863_100536114	3300005841	Bacteria	1155
133	Ga0068863_100679055	3300005841	Bacteria	1023
134	Ga0068863_101009457	3300005841	Bacteria	835
135	Ga0068858_100029308	3300005842	Bacteria	5110
136	Ga0068858_100051909	3300005842	Bacteria	3794
137	Ga0068858_100500044	3300005842	Bacteria	1174
138	Ga0068860_100052117	3300005843	Bacteria	3892
139	Ga0068860_100112139	3300005843	Bacteria	2608
140	Ga0068860_100802342	3300005843	Bacteria	955
141	Ga0068862_100163668	3300005844	Unclassified	1987
142	Ga0068862_100954122	3300005844	Bacteria	846
143	Ga0068862_101754299	3300005844	Bacteria	629
144	Ga0081455_10009319	3300005937	Bacteria	10105
145	Ga0081539_10082515	3300005985	Bacteria	1685
146	Ga0070715_10039034	3300006163	Bacteria	1975
147	Ga0070716_100295081	3300006173	Bacteria	1125
148	Ga0097621_100004056	3300006237	Bacteria	10159
149	Ga0097621_100032915	3300006237	Bacteria	4124
150	Ga0097621_100063040	3300006237	Bacteria	3045
151	Ga0097621_100289105	3300006237	Unclassified	1445
152	Ga0068871_100001688	3300006358	Bacteria	14806
153	Ga0068871_100003083	3300006358	Bacteria	11436
154	Ga0068871_100034462	3300006358	Bacteria	4017
155	Ga0068871_100480149	3300006358	Bacteria	1118
156	Ga0075428_100108384	3300006844	Bacteria	3027
157	Ga0075428_100275502	3300006844	Bacteria	1810
158	Ga0075428_100646594	3300006844	Unclassified	1128
159	Ga0075430_100490138	3300006846	Bacteria	1014
160	Ga0075433_10071296	3300006852	Bacteria	3054
161	Ga0075433_10118254	3300006852	Bacteria	2352
162	Ga0075434_100002460	3300006871	Bacteria	16304
163	Ga0075434_100026240	3300006871	Bacteria	5706
164	Ga0075434_100041254	3300006871	Bacteria	4573
165	Ga0075434_100112401	3300006871	Bacteria	2735
166	Ga0075434_100794061	3300006871	Bacteria	963
167	Ga0075434_100887680	3300006871	Bacteria	907
168	Ga0075429_100533758	3300006880	Bacteria	1028
169	Ga0068865_100003144	3300006881	Bacteria	9885
170	Ga0068865_100391957	3300006881	Bacteria	1135
171	Ga0068865_100719258	3300006881	Bacteria	855
172	Ga0075436_100011787	3300006914	Bacteria	5999
173	Ga0075436_100035449	3300006914	Bacteria	3442
174	Ga0075436_100045406	3300006914	Bacteria	3030
175	Ga0097620_100015936	3300006931	Bacteria	7555
176	Ga0097620_100284039	3300006931	Bacteria	1748
177	Ga0097620_100307640	3300006931	Unclassified	1678
178	Ga0097620_100310217	3300006931	Bacteria	1671
179	Ga0097620_100615706	3300006931	Bacteria	1178
180	Ga0097620_100721777	3300006931	Bacteria	1086
181	Ga0075435_100003382	3300007076	Bacteria	10820
182	Ga0075435_100006939	3300007076	Bacteria	8040
183	Ga0075435_100015107	3300007076	Bacteria	5796
184	Ga0075435_100033502	3300007076	Bacteria	4063
185	Ga0075435_100371513	3300007076	Bacteria	1228
186	Ga0075435_100453992	3300007076	Bacteria	1105
187	Ga0075435_100484072	3300007076	Bacteria	1069
188	Ga0099795_10245086	3300007788	Bacteria	771
189	Ga0105251_10131262	3300009011	Unclassified	1135
190	Ga0111539_10000566	3300009094	Bacteria	47366
191	Ga0111539_10147658	3300009094	Bacteria	2753
192	Ga0111539_10257128	3300009094	Bacteria	2033
193	Ga0111539_10512143	3300009094	Bacteria	1398
194	Ga0111539_10835934	3300009094	Bacteria	1071
195	Ga0111539_11412694	3300009094	Unclassified	807
196	Ga0105245_10029881	3300009098	Bacteria	4818
197	Ga0105245_10068847	3300009098	Bacteria	3208
198	Ga0105245_10089422	3300009098	Bacteria	2831
199	Ga0105245_10435769	3300009098	Unclassified	1316
200	Ga0114129_10013827	3300009147	Bacteria	11499
201	Ga0114129_10069821	3300009147	Bacteria	4898
202	Ga0114129_10086230	3300009147	Unclassified	4355
203	Ga0114129_10103987	3300009147	Bacteria	3925
204	Ga0114129_10148239	3300009147	Bacteria	3213
205	Ga0114129_10270283	3300009147	Bacteria	2274
206	Ga0114129_10349410	3300009147	Unclassified	1959
207	Ga0114129_11143344	3300009147	Bacteria	972
208	Ga0105243_10196388	3300009148	Bacteria	1766
209	Ga0105243_11037626	3300009148	Bacteria	825
210	Ga0105241_11325766	3300009174	Unclassified	686
211	Ga0105242_10005384	3300009176	Bacteria	9898
212	Ga0105242_10012484	3300009176	Bacteria	6541
213	Ga0105242_10052785	3300009176	Bacteria	3318
214	Ga0105242_10092269	3300009176	Bacteria	2551
215	Ga0105242_10441723	3300009176	Bacteria	1224
216	Ga0105242_10519916	3300009176	Bacteria	1135
217	Ga0105248_10009961	3300009177	Bacteria	10465
218	Ga0105248_10010539	3300009177	Bacteria	10182
219	Ga0105248_10029552	3300009177	Bacteria	6114
220	Ga0105248_10138105	3300009177	Bacteria	2750
221	Ga0105248_10272771	3300009177	Bacteria	1905
222	Ga0105248_10379557	3300009177	Bacteria	1591
223	Ga0105248_10688498	3300009177	Bacteria	1153
224	Ga0105248_10711758	3300009177	Bacteria	1133
225	Ga0105248_10873659	3300009177	Bacteria	1015
226	Ga0105238_10158901	3300009551	Unclassified	2236
227	Ga0105249_10210516	3300009553	Unclassified	1908
228	Ga0105246_10245025	3300011119	Bacteria	1419
229	Ga0157374_10174427	3300013296	Bacteria	2098
230	Ga0157378_10135633	3300013297	Bacteria	2282
231	Ga0163162_10056442	3300013306	Bacteria	3955
232	Ga0163162_10227877	3300013306	Bacteria	1994
233	Ga0157372_10663853	3300013307	Bacteria	1214
234	Ga0157375_10110052	3300013308	Bacteria	2852
235	Ga0157375_10196050	3300013308	Bacteria	2175
236	Ga0157375_10290307	3300013308	Bacteria	1799
237	Ga0157375_10367236	3300013308	Unclassified	1605
238	Ga0157375_10722967	3300013308	Bacteria	1148
239	Ga0163163_10097076	3300014325	Bacteria	2967
240	Ga0163163_10446514	3300014325	Bacteria	1353
241	Ga0163163_10596189	3300014325	Bacteria	1168
242	Ga0163163_11805109	3300014325	Bacteria	672
243	Ga0157380_10149499	3300014326	Unclassified	2017
244	Ga0157380_10702546	3300014326	Bacteria	1016
245	Ga0157380_11070291	3300014326	Bacteria	844
246	Ga0157377_10156529	3300014745	Bacteria	1413
247	Ga0157377_10302614	3300014745	Bacteria	1056
248	Ga0157379_10013829	3300014968	Bacteria	7073
249	Ga0157379_10018333	3300014968	Bacteria	6170
250	Ga0157379_10042234	3300014968	Bacteria	4070
251	Ga0157379_10158896	3300014968	Bacteria	2040
252	Ga0157379_10237710	3300014968	Bacteria	1652
253	Ga0157379_10913965	3300014968	Bacteria	833
254	Ga0157376_10033215	3300014969	Bacteria	4151
255	Ga0157376_10063876	3300014969	Bacteria	3103
256	Ga0157376_10594553	3300014969	Bacteria	1101
257	Ga0157376_10607300	3300014969	Unclassified	1089
258	Ga0163161_10609453	3300017792	Bacteria	901
259	Ga0163161_11421062	3300017792	Bacteria	607
260	Ga0207697_10050044	3300025315	Bacteria	1725
261	Ga0207656_10054336	3300025321	Bacteria	1741
262	Ga0207653_10303095	3300025885	Bacteria	620
263	Ga0207682_10029247	3300025893	Bacteria	2202
264	Ga0207642_10090136	3300025899	Bacteria	1512
265	Ga0207710_10084602	3300025900	Bacteria	1476
266	Ga0207688_10201106	3300025901	Bacteria	1194
267	Ga0207680_10016785	3300025903	Bacteria	3852
268	Ga0207680_10062928	3300025903	Bacteria	2269
269	Ga0207680_10229293	3300025903	Unclassified	1276
270	Ga0207699_10084050	3300025906	Bacteria	1982
271	Ga0207645_10119793	3300025907	Bacteria	1708
272	Ga0207643_10052084	3300025908	Bacteria	2324
273	Ga0207643_10428242	3300025908	Unclassified	839
274	Ga0207684_10110565	3300025910	Bacteria	2352
275	Ga0207707_10024993	3300025912	Bacteria	5227
276	Ga0207707_10059176	3300025912	Bacteria	3334
277	Ga0207707_10185390	3300025912	Bacteria	1816
278	Ga0207695_10339107	3300025913	Bacteria	1391
279	Ga0207695_10921933	3300025913	Bacteria	753
280	Ga0207663_10142036	3300025916	Unclassified	1674
281	Ga0207663_11311511	3300025916	Unclassified	583
282	Ga0207660_10669600	3300025917	Unclassified	846
283	Ga0207662_10053669	3300025918	Bacteria	2401
284	Ga0207662_10368698	3300025918	Bacteria	968
285	Ga0207662_10402274	3300025918	Bacteria	929
286	Ga0207657_10011698	3300025919	Bacteria	8696
287	Ga0207657_10075614	3300025919	Unclassified	2842
288	Ga0207649_10077607	3300025920	Bacteria	2141
289	Ga0207652_10495319	3300025921	Bacteria	1100
290	Ga0207652_10635066	3300025921	Unclassified	956
291	Ga0207681_10003789	3300025923	Bacteria	9383
292	Ga0207681_10354765	3300025923	Bacteria	1175
293	Ga0207694_10267452	3300025924	Bacteria	1402
294	Ga0207650_10049085	3300025925	Bacteria	3115
295	Ga0207650_10209160	3300025925	Bacteria	1566
296	Ga0207659_10292689	3300025926	Bacteria	1335
297	Ga0207659_11474249	3300025926	Unclassified	582
298	Ga0207687_10017387	3300025927	Bacteria	4734
299	Ga0207687_10084943	3300025927	Bacteria	2295
300	Ga0207644_10095255	3300025931	Bacteria	2226
301	Ga0207644_10974039	3300025931	Unclassified	711
302	Ga0207690_10090064	3300025932	Bacteria	2164
303	Ga0207706_10050096	3300025933	Bacteria	3691
304	Ga0207706_10080344	3300025933	Bacteria	2867
305	Ga0207686_10021899	3300025934	Bacteria	3674
306	Ga0207686_10043537	3300025934	Bacteria	2751
307	Ga0207686_10058835	3300025934	Bacteria	2425
308	Ga0207686_10133892	3300025934	Bacteria	1704
309	Ga0207670_10068717	3300025936	Bacteria	2442
310	Ga0207670_10390244	3300025936	Bacteria	1111
311	Ga0207669_10295836	3300025937	Bacteria	1228
312	Ga0207669_10320383	3300025937	Bacteria	1186
313	Ga0207669_10391519	3300025937	Unclassified	1086
314	Ga0207669_10409060	3300025937	Bacteria	1065
315	Ga0207704_10010470	3300025938	Bacteria	4527
316	Ga0207704_10107003	3300025938	Bacteria	1880
317	Ga0207704_10299415	3300025938	Bacteria	1231
318	Ga0207704_10698009	3300025938	Bacteria	840
319	Ga0207665_10272418	3300025939	Unclassified	1257
320	Ga0207691_10011230	3300025940	Bacteria	8595
321	Ga0207691_10271513	3300025940	Bacteria	1460
322	Ga0207691_10385422	3300025940	Bacteria	1196
323	Ga0207691_10770134	3300025940	Bacteria	810
324	Ga0207711_10012752	3300025941	Bacteria	6981
325	Ga0207711_10061777	3300025941	Bacteria	3230
326	Ga0207711_10066104	3300025941	Bacteria	3127
327	Ga0207711_10100132	3300025941	Bacteria	2563
328	Ga0207711_10154803	3300025941	Bacteria	2071
329	Ga0207711_10160938	3300025941	Bacteria	2032
330	Ga0207711_10500421	3300025941	Bacteria	1133
331	Ga0207711_10566255	3300025941	Bacteria	1060
332	Ga0207711_10707088	3300025941	Bacteria	940
333	Ga0207689_10258673	3300025942	Bacteria	1440
334	Ga0207689_10335336	3300025942	Bacteria	1256
335	Ga0207679_10210200	3300025945	Unclassified	1631
336	Ga0207667_10433306	3300025949	Unclassified	1337
337	Ga0207651_10101585	3300025960	Bacteria	2135
338	Ga0207651_10314592	3300025960	Bacteria	1307
339	Ga0207651_10517906	3300025960	Bacteria	1033
340	Ga0207640_10034722	3300025981	Bacteria	3149
341	Ga0207658_10126991	3300025986	Bacteria	2043
342	Ga0207658_10935232	3300025986	Bacteria	790
343	Ga0207677_10020435	3300026023	Bacteria	4021
344	Ga0207677_10023294	3300026023	Bacteria	3822
345	Ga0207677_10451329	3300026023	Bacteria	1102
346	Ga0207677_10851270	3300026023	Bacteria	819
347	Ga0207703_10009308	3300026035	Bacteria	7721
348	Ga0207703_10036732	3300026035	Bacteria	3900
349	Ga0207703_10631386	3300026035	Bacteria	1015
350	Ga0207703_10765511	3300026035	Bacteria	920
351	Ga0207703_10824240	3300026035	Bacteria	886
352	Ga0207703_10939627	3300026035	Bacteria	829
353	Ga0207639_11673695	3300026041	Unclassified	596
354	Ga0207678_10662531	3300026067	Bacteria	917
355	Ga0207708_10924762	3300026075	Unclassified	756
356	Ga0207641_10001674	3300026088	Bacteria	21561
357	Ga0207641_10080647	3300026088	Bacteria	2824
358	Ga0207641_10951208	3300026088	Bacteria	854
359	Ga0207641_11035216	3300026088	Bacteria	818
360	Ga0207648_10008731	3300026089	Bacteria	9767
361	Ga0207648_10019539	3300026089	Bacteria	6115
362	Ga0207648_10512526	3300026089	Bacteria	1098
363	Ga0207676_10029383	3300026095	Bacteria	4115
364	Ga0207676_10043030	3300026095	Bacteria	3475
365	Ga0207676_10086153	3300026095	Bacteria	2565
366	Ga0207676_10134481	3300026095	Unclassified	2107
367	Ga0207674_10228384	3300026116	Bacteria	1809
368	Ga0207674_10307127	3300026116	Bacteria	1535
369	Ga0207674_10527751	3300026116	Bacteria	1140
370	Ga0207675_100057951	3300026118	Bacteria	3615
371	Ga0207675_100114906	3300026118	Bacteria	2542
372	Ga0207675_100304125	3300026118	Bacteria	1554
373	Ga0207675_100372809	3300026118	Bacteria	1402
374	Ga0207683_10204380	3300026121	Bacteria	1796
375	Ga0207683_10309180	3300026121	Unclassified	1447
376	Ga0207683_10677718	3300026121	Bacteria	955
377	Ga0207683_11746391	3300026121	Bacteria	571
378	Ga0207428_10023202	3300027907	Bacteria	5220
379	Ga0207428_10023538	3300027907	Bacteria	5179
380	Ga0207428_10615940	3300027907	Unclassified	781
381	Ga0268266_10007240	3300028379	Bacteria	10032
382	Ga0268266_10010362	3300028379	Bacteria	8150
383	Ga0268266_10229472	3300028379	Bacteria	1709
384	Ga0268265_10172916	3300028380	Unclassified	1848
385	Ga0268265_10824492	3300028380	Bacteria	906
386	Ga0268264_10405525	3300028381	Bacteria	1311
387	Ga0268264_11691936	3300028381	Unclassified	643
388	Ga0307408_100688272	3300031548	Bacteria	918
389	Ga0373930_0000320	3300034816	Bacteria	6258
390	Ga0373948_0000141	3300034817	Bacteria	7692
391	Ga0373950_0007555	3300034818	Bacteria	1691
392	Ga0373958_0002384	3300034819	Bacteria	2624
393	Ga0373959_0000482	3300034820	Bacteria	7302
394	Ga0373938_0013986	3300034957	Bacteria	1533
395	Ga0373926_0060601	3300035083	Bacteria	1379
396	Ga0373929_0000091	3300035085	Bacteria	15028
397	Ga0373934_0123818	3300035086	Bacteria	1052
398	Ga0373940_0180354	3300035088	Bacteria	686
399	Ga0373944_0031103	3300035089	Bacteria	1605
400	Ga0373951_0000106	3300035091	Bacteria	32539
401	Ga0373952_0000985	3300035092	Bacteria	5188
402	Ga0373952_0005484	3300035092	Bacteria	2320
403	Ga0373932_0000207	3300035112	Bacteria	17273
404	Ga0373932_0174754	3300035112	Bacteria	750
405	Ga0373936_0334100	3300035113	Unclassified	688
406	Ga0373941_0001675	3300035115	Bacteria	4742
407	Ga0373941_0101164	3300035115	Bacteria	1004
408	Ga0373953_0227190	3300035117	Unclassified	809
409	Ga0373954_0181338	3300035118	Bacteria	1033
410	Ga0373954_0682369	3300035118	Bacteria	509
411	Ga0373956_0193772	3300035119	Bacteria	963
412	Ga0373960_0000394	3300035121	Bacteria	8524
413	Ga0373943_0176326	3300035170	Bacteria	1172
414	Ga0373946_0322554	3300035171	Bacteria	768
415	Ga0373955_0032291	3300035172	Bacteria	2747
416	Ga0373955_0373357	3300035172	Bacteria	865
417	Ga0373955_0459566	3300035172	Unclassified	776
418	Ga0373942_0000561	3300035207	Bacteria	10438
419	Ga0373961_0000706	3300035241	Bacteria	11651
420	Ga0373962_0000569	3300035242	Bacteria	8340
421	Ga0373962_0072091	3300035242	Unclassified	1034
422	Ga0373924_0141279	3300035410	Bacteria	1051
423	Ga0373931_0005036	3300035691	Bacteria	6077
424	Ga0373935_0142528	3300035692	Bacteria	1620
425	Ga0373935_0313600	3300035692	Bacteria	1111
426	Ga0373927_0118233	3300035695	Unclassified	1729
427	Ga0373933_0208421	3300035724	Bacteria	1252
428	Ga0373933_0270928	3300035724	Bacteria	1096
429	Ga0373933_0288181	3300035724	Bacteria	1062
430	Ga0373933_0635027	3300035724	Unclassified	702
431	Ga0373947_0115331	3300035725	Bacteria	1702
432	Ga0373947_0189840	3300035725	Bacteria	1340
433	Ga0373947_0591663	3300035725	Bacteria	756
434	Ga0373947_0655044	3300035725	Unclassified	716
435	Ga0373937_0023152	3300036401	Bacteria	5590
436	Ga0373937_0105237	3300036401	Bacteria	2622
437	Ga0373937_0201123	3300036401	Bacteria	1873
438	Ga0373937_0204644	3300036401	Unclassified	1856
439	Ga0373937_0263386	3300036401	Unclassified	1626
440	Ga0373937_0415113	3300036401	Unclassified	1277
441	Ga0373937_0630554	3300036401	Unclassified	1017
442	Ga0373937_0791219	3300036401	Bacteria	896
443	Ga0373937_0965512	3300036401	Bacteria	801
444	Ga0373925_0596011	3300037068	Unclassified	910
445	Ga0373925_1497332	3300037068	Unclassified	552
446	Ga0451576_0206867	3300045051	Bacteria	2049
447	Ga0451576_0314363	3300045051	Bacteria	1639
448	Ga0466967_0902432	3300045976	Unclassified	879
449	Ga0495592_0373916	3300046454	Unclassified	908
450	Ga0495603_0059186	3300046455	Bacteria	2265
451	Ga0495603_0407042	3300046455	Unclassified	780
452	Ga0495629_0075392	3300046459	Bacteria	2356
453	Ga0495651_0565509	3300046462	Bacteria	721
454	Ga0495653_0762415	3300046463	Bacteria	584
455	Ga0495580_0344637	3300046472	Unclassified	1010
456	Ga0495582_0234531	3300046473	Bacteria	1051
457	Ga0495639_0370726	3300046475	Unclassified	721
458	Ga0495664_0147388	3300046477	Unclassified	1427
459	Ga0495608_0011490	3300046511	Bacteria	6162
460	Ga0495618_0474482	3300046514	Bacteria	757
461	Ga0495628_0632710	3300046516	Bacteria	761
462	Ga0495630_0038681	3300046517	Bacteria	3568
463	Ga0495652_0096573	3300046529	Bacteria	2406
464	Ga0495652_0200803	3300046529	Bacteria	1513
465	Ga0495665_0320427	3300046531	Unclassified	792
466	Ga0495586_0440991	3300046535	Bacteria	750
467	Ga0495587_0049668	3300046536	Unclassified	2483
468	Ga0495587_0141671	3300046536	Bacteria	1372
469	Ga0495621_0441770	3300046539	Bacteria	556
470	Ga0495645_0000912	3300046543	Bacteria	20131
471	Ga0495645_0405753	3300046543	Unclassified	867
472	Ga0495667_0136904	3300046559	Unclassified	1579
473	Ga0495667_0593956	3300046559	Unclassified	690
474	Ga0495656_0016928	3300046615	Bacteria	2774
475	Ga0495634_0040587	3300046642	Bacteria	3164
476	Ga0495635_0250036	3300046663	Bacteria	1195
477	Ga0495658_0501886	3300046683	Bacteria	776
478	Ga0495669_0266598	3300046684	Bacteria	823
479	Ga0495613_0002802	3300046689	Bacteria	13083
480	Ga0495613_0065294	3300046689	Bacteria	2660
481	Ga0495670_0168823	3300046691	Bacteria	1152
482	Ga0495649_0218650	3300046694	Bacteria	986
483	Ga0495600_0296069	3300046809	Unclassified	1022
484	Ga0495600_0486165	3300046809	Bacteria	760
485	Ga0495604_0032371	3300047317	Bacteria	4145
486	Ga0495604_0107922	3300047317	Unclassified	2034
487	Ga0495674_0776521	3300047319	Bacteria	747
488	Ga0495672_0384772	3300047320	Bacteria	644
489	Ga0495676_0347652	3300047321	Unclassified	992
490	Ga0495675_0299916	3300047444	Unclassified	955
491	Ga0495684_0004911	3300047471	Bacteria	10434
492	Ga0495684_0023640	3300047471	Bacteria	4726
493	Ga0495614_0103432	3300048089	Bacteria	1247
494	Ga0496100_0112432	3300048903	Bacteria	1894
495	Ga0496100_1506382	3300048903	Unclassified	531
496	Ga0496101_0000634	3300048904	Bacteria	21327
497	Ga0496104_0018660	3300048907	Bacteria	6332
498	Ga0496104_0087065	3300048907	Bacteria	2983
499	Ga0496104_0196238	3300048907	Bacteria	1931
500	Ga0496104_0325700	3300048907	Unclassified	1449
501	Ga0496104_0993366	3300048907	Bacteria	743
502	Ga0496105_0357788	3300048908	Bacteria	1165
503	Ga0496106_0137859	3300048909	Unclassified	1918
504	Ga0496106_0175803	3300048909	Bacteria	1698
505	Ga0496106_0380371	3300048909	Bacteria	1134
506	Ga0496106_0598562	3300048909	Bacteria	883
507	Ga0496108_0005741	3300048911	Bacteria	10050
508	Ga0496108_0597028	3300048911	Unclassified	962
509	Ga0496109_0095489	3300048912	Bacteria	2753
510	Ga0496109_0973496	3300048912	Bacteria	786
511	Ga0496110_0520133	3300048913	Unclassified	1082
512	Ga0496110_0886744	3300048913	Bacteria	798
513	Ga0496111_0196599	3300048914	Unclassified	1499
514	Ga0496111_0807206	3300048914	Bacteria	679
515	Ga0496112_0000483	3300048915	Bacteria	26742
516	Ga0496112_0102452	3300048915	Unclassified	2833
517	Ga0496112_0138342	3300048915	Bacteria	2405
518	Ga0496112_0661702	3300048915	Bacteria	974
519	Ga0496112_1587970	3300048915	Unclassified	567
520	Ga0496113_0047440	3300048916	Bacteria	3192
521	Ga0496114_0001934	3300048917	Bacteria	15771
522	Ga0496114_0043903	3300048917	Bacteria	3707
523	Ga0496114_0117252	3300048917	Bacteria	2287
524	Ga0496114_0123045	3300048917	Bacteria	2233
525	Ga0496114_0132555	3300048917	Bacteria	2153
526	Ga0496114_1120967	3300048917	Bacteria	672
527	Ga0496115_0041384	3300048918	Bacteria	3667
528	Ga0496115_0817085	3300048918	Bacteria	724
529	Ga0501081_0905167	3300049743	Bacteria	665
530	Ga0501083_0274697	3300049744	Bacteria	1096
531	nmdc:mga05p37_22763_c1	3300050507	Bacteria	7601
532	nmdc:mga05p37_42874_c1	3300050507	Bacteria	5562
533	nmdc:mga05p37_429536_c1	3300050507	Bacteria	1535
534	nmdc:mga05p37_53224_c1	3300050507	Bacteria	4978
535	nmdc:mga05p37_7088_c1	3300050507	Bacteria	13218
536	nmdc:mga05p37_868804_c1	3300050507	Unclassified	977
537	nmdc:mga09592_983346_c1	3300050508	Unclassified	706
538	nmdc:mga0qj67_722380_c1	3300050509	Bacteria	791
539	nmdc:mga08y16_21067_c1	3300050511	Bacteria	6883
540	nmdc:mga08y16_57993_c1	3300050511	Bacteria	4046
541	nmdc:mga08y16_804265_c1	3300050511	Bacteria	933
542	nmdc:mga08y16_976201_c1	3300050511	Unclassified	829
543	nmdc:mga0n895_107215_c1	3300050512	Unclassified	2807
544	nmdc:mga0n895_19485_c1	3300050512	Bacteria	6307
545	nmdc:mga0n895_349186_c1	3300050512	Bacteria	1498
546	nmdc:mga0n895_577564_c1	3300050512	Bacteria	1128
547	nmdc:mga0n895_7846_c1	3300050512	Bacteria	9202
548	nmdc:mga0n895_96600_c1	3300050512	Bacteria	2960
549	nmdc:mga0rr50_12654_c1	3300050513	Bacteria	5462
550	nmdc:mga0rr50_199393_c1	3300050513	Bacteria	1644
551	nmdc:mga0rr50_22192_c1	3300050513	Bacteria	4352
552	nmdc:mga0rr50_305410_c1	3300050513	Bacteria	1332
553	nmdc:mga0rr50_46131_c1	3300050513	Bacteria	3208
554	nmdc:mga0rr50_529732_c1	3300050513	Bacteria	1003
555	nmdc:mga0rr50_705349_c1	3300050513	Bacteria	861
556	nmdc:mga08x19_207097_c1	3300050514	Bacteria	1346
557	nmdc:mga08x19_4946_c1	3300050514	Bacteria	7868
558	nmdc:mga0a205_141390_c1	3300050515	Bacteria	2307
559	Ga0495601_0015347	3300053077	Bacteria	4630
560	Ga0495601_0035518	3300053077	Bacteria	3112
561	Ga0495601_0108912	3300053077	Bacteria	1793
562	Ga0495601_0186874	3300053077	Bacteria	1354
563	Ga0495595_0007954	3300053084	Bacteria	4343
564	Ga0495595_0265842	3300053084	Bacteria	860
565	Ga0495619_0006633	3300053085	Bacteria	7326
566	Ga0495619_0015200	3300053085	Bacteria	4866
567	Ga0495619_0222065	3300053085	Bacteria	1309
568	Ga0495619_0287915	3300053085	Unclassified	1138
569	Ga0495619_0354126	3300053085	Bacteria	1015
570	Ga0495619_0520523	3300053085	Unclassified	817
571	Ga0495619_0618949	3300053085	Bacteria	740
572	Ga0530510_0326427	3300061734	Bacteria	1151
573	nmdc:mga0n895_1408229_c1
574	MBSR1b_contig_9732256
575	Ga0065712_10080672
576	Ga0070658_10051493
577	Ga0070676_10802343
578	Ga0070690_100657842
579	Ga0070670_100133851
580	Ga0070670_100150066
581	Ga0070670_100259229
582	Ga0070677_10034824
583	Ga0068869_100041849
584	Ga0070666_10006632
585	Ga0070666_10112900
586	Ga0070666_10134410
587	Ga0070666_10236911
588	Ga0070666_10242104
589	Ga0070680_100464829
590	Ga0070680_100654604
591	Ga0070682_100455795
592	Ga0068868_100019906
593	Ga0068868_100150545
594	Ga0068868_100170240
595	Ga0068868_100624881
596	Ga0068868_100731406
597	Ga0070660_100040798
598	Ga0070660_100113585
599	Ga0070689_100221999
600	Ga0070689_100335865
601	Ga0070691_10184739
602	Ga0070687_100143553
603	Ga0070687_100260314
604	Ga0070687_101455489
605	Ga0070661_100048919
606	Ga0070692_10689010
607	Ga0070669_100009978
608	Ga0070669_101039571
609	Ga0070669_101170869
610	Ga0070671_100029323
611	Ga0070671_100221797
612	Ga0070674_100443717
613	Ga0070674_100495161
614	Ga0070674_100510440
615	Ga0070673_100049739
616	Ga0070673_100051577
617	Ga0070673_100180138
618	Ga0070673_101014867
619	Ga0070688_100053498
620	Ga0070688_100129144
621	Ga0070688_100135983
622	Ga0070688_100253093
623	Ga0070659_100088201
624	Ga0070659_100211577
625	Ga0070659_100657167
626	Ga0070659_101094826
627	Ga0070667_100040668
628	Ga0070667_100083105
629	Ga0070667_100696607
630	Ga0070703_10357919
631	Ga0070709_10164623
632	Ga0070709_10407174
633	Ga0070711_100162085
634	Ga0070705_100120728
635	Ga0070700_101556122
636	Ga0070694_100548862
637	Ga0070694_100574722
638	Ga0070708_100151768
639	Ga0070678_100107653
640	Ga0070678_100184549
641	Ga0070678_100580540
642	Ga0070662_100138033
643	Ga0070681_10064889
644	Ga0070681_10136626
645	Ga0068867_100015338
646	Ga0068867_100069968
647	Ga0068867_100411354
648	Ga0068867_100554817
649	Ga0068867_101551198
650	Ga0070685_10039857
651	Ga0070706_100884463
652	Ga0070707_100639705
653	Ga0070698_100037910
654	Ga0070679_100057554
655	Ga0070679_100203723
656	Ga0070679_100516901
657	Ga0070679_100920074
658	Ga0070684_100104233
659	Ga0070684_100858303
660	Ga0070697_100122063
661	Ga0068853_101076060
662	Ga0068853_101813194
663	Ga0070672_100264780
664	Ga0070672_100330861
665	Ga0070672_101117564
666	Ga0070686_100002261
667	Ga0070686_100243662
668	Ga0070686_100522160
669	Ga0070695_100054133
670	Ga0070695_101316493
671	Ga0070665_100007278
672	Ga0070665_100022577
673	Ga0070665_100038039
674	Ga0070665_100042980
675	Ga0070704_100104169
676	Ga0070704_100164455
677	Ga0070704_101081474
678	Ga0068855_100071607
679	Ga0068855_100982148
680	Ga0070664_100981657
681	Ga0070664_101127657
682	Ga0068857_100258131
683	Ga0068857_101278386
684	Ga0068854_100031715
685	Ga0068854_100397565
686	Ga0068859_100015936
687	Ga0068859_100284050
688	Ga0068859_100307675
689	Ga0068859_100310239
690	Ga0068859_100615707
691	Ga0068859_100721791
692	Ga0068864_100011465
693	Ga0068864_100064186
694	Ga0068864_100220536
695	Ga0068864_101160531
696	Ga0068866_10327583
697	Ga0068861_100093413
698	Ga0068861_100566511
699	Ga0068851_10127756
700	Ga0068851_10773350
701	Ga0068863_100030478
702	Ga0068863_100065985
703	Ga0068863_100230676
704	Ga0068863_100536114
705	Ga0068863_100679055
706	Ga0068863_101009457
707	Ga0068858_100029308
708	Ga0068858_100051909
709	Ga0068858_100500044
710	Ga0068860_100052117
711	Ga0068860_100112139
712	Ga0068860_100802342
713	Ga0068862_100163668
714	Ga0068862_100954122
715	Ga0068862_101754299
716	Ga0081455_10009319
717	Ga0081539_10082515
718	Ga0070715_10039034
719	Ga0070716_100295081
720	Ga0097621_100004056
721	Ga0097621_100032915
722	Ga0097621_100063040
723	Ga0097621_100289105
724	Ga0068871_100001688
725	Ga0068871_100003083
726	Ga0068871_100034462
727	Ga0068871_100480149
728	Ga0075428_100108384
729	Ga0075428_100275502
730	Ga0075428_100646594
731	Ga0075430_100490138
732	Ga0075433_10071296
733	Ga0075433_10118254
734	Ga0075434_100002460
735	Ga0075434_100026240
736	Ga0075434_100041254
737	Ga0075434_100112401
738	Ga0075434_100794061
739	Ga0075434_100887680
740	Ga0075429_100533758
741	Ga0068865_100003144
742	Ga0068865_100391957
743	Ga0068865_100719258
744	Ga0075436_100011787
745	Ga0075436_100035449
746	Ga0075436_100045406
747	Ga0097620_100015936
748	Ga0097620_100284039
749	Ga0097620_100307640
750	Ga0097620_100310217
751	Ga0097620_100615706
752	Ga0097620_100721777
753	Ga0075435_100003382
754	Ga0075435_100006939
755	Ga0075435_100015107
756	Ga0075435_100033502
757	Ga0075435_100371513
758	Ga0075435_100453992
759	Ga0075435_100484072
760	Ga0099795_10245086
761	Ga0105251_10131262
762	Ga0111539_10000566
763	Ga0111539_10147658
764	Ga0111539_10257128
765	Ga0111539_10512143
766	Ga0111539_10835934
767	Ga0111539_11412694
768	Ga0105245_10029881
769	Ga0105245_10068847
770	Ga0105245_10089422
771	Ga0105245_10435769
772	Ga0114129_10013827
773	Ga0114129_10069821
774	Ga0114129_10086230
775	Ga0114129_10103987
776	Ga0114129_10148239
777	Ga0114129_10270283
778	Ga0114129_10349410
779	Ga0114129_11143344
780	Ga0105243_10196388
781	Ga0105243_11037626
782	Ga0105241_11325766
783	Ga0105242_10005384
784	Ga0105242_10012484
785	Ga0105242_10052785
786	Ga0105242_10092269
787	Ga0105242_10441723
788	Ga0105242_10519916
789	Ga0105248_10009961
790	Ga0105248_10010539
791	Ga0105248_10029552
792	Ga0105248_10138105
793	Ga0105248_10272771
794	Ga0105248_10379557
795	Ga0105248_10688498
796	Ga0105248_10711758
797	Ga0105248_10873659
798	Ga0105238_10158901
799	Ga0105249_10210516
800	Ga0105246_10245025
801	Ga0157374_10174427
802	Ga0157378_10135633
803	Ga0163162_10056442
804	Ga0163162_10227877
805	Ga0157372_10663853
806	Ga0157375_10110052
807	Ga0157375_10196050
808	Ga0157375_10290307
809	Ga0157375_10367236
810	Ga0157375_10722967
811	Ga0163163_10097076
812	Ga0163163_10446514
813	Ga0163163_10596189
814	Ga0163163_11805109
815	Ga0157380_10149499
816	Ga0157380_10702546
817	Ga0157380_11070291
818	Ga0157377_10156529
819	Ga0157377_10302614
820	Ga0157379_10013829
821	Ga0157379_10018333
822	Ga0157379_10042234
823	Ga0157379_10158896
824	Ga0157379_10237710
825	Ga0157379_10913965
826	Ga0157376_10033215
827	Ga0157376_10063876
828	Ga0157376_10594553
829	Ga0157376_10607300
830	Ga0163161_10609453
831	Ga0163161_11421062
832	Ga0207697_10050044
833	Ga0207656_10054336
834	Ga0207653_10303095
835	Ga0207682_10029247
836	Ga0207642_10090136
837	Ga0207710_10084602
838	Ga0207688_10201106
839	Ga0207680_10016785
840	Ga0207680_10062928
841	Ga0207680_10229293
842	Ga0207699_10084050
843	Ga0207645_10119793
844	Ga0207643_10052084
845	Ga0207643_10428242
846	Ga0207684_10110565
847	Ga0207707_10024993
848	Ga0207707_10059176
849	Ga0207707_10185390
850	Ga0207695_10339107
851	Ga0207695_10921933
852	Ga0207663_10142036
853	Ga0207663_11311511
854	Ga0207660_10669600
855	Ga0207662_10053669
856	Ga0207662_10368698
857	Ga0207662_10402274
858	Ga0207657_10011698
859	Ga0207657_10075614
860	Ga0207649_10077607
861	Ga0207652_10495319
862	Ga0207652_10635066
863	Ga0207681_10003789
864	Ga0207681_10354765
865	Ga0207694_10267452
866	Ga0207650_10049085
867	Ga0207650_10209160
868	Ga0207659_10292689
869	Ga0207659_11474249
870	Ga0207687_10017387
871	Ga0207687_10084943
872	Ga0207644_10095255
873	Ga0207644_10974039
874	Ga0207690_10090064
875	Ga0207706_10050096
876	Ga0207706_10080344
877	Ga0207686_10021899
878	Ga0207686_10043537
879	Ga0207686_10058835
880	Ga0207686_10133892
881	Ga0207670_10068717
882	Ga0207670_10390244
883	Ga0207669_10295836
884	Ga0207669_10320383
885	Ga0207669_10391519
886	Ga0207669_10409060
887	Ga0207704_10010470
888	Ga0207704_10107003
889	Ga0207704_10299415
890	Ga0207704_10698009
891	Ga0207665_10272418
892	Ga0207691_10011230
893	Ga0207691_10271513
894	Ga0207691_10385422
895	Ga0207691_10770134
896	Ga0207711_10012752
897	Ga0207711_10061777
898	Ga0207711_10066104
899	Ga0207711_10100132
900	Ga0207711_10154803
901	Ga0207711_10160938
902	Ga0207711_10500421
903	Ga0207711_10566255
904	Ga0207711_10707088
905	Ga0207689_10258673
906	Ga0207689_10335336
907	Ga0207679_10210200
908	Ga0207667_10433306
909	Ga0207651_10101585
910	Ga0207651_10314592
911	Ga0207651_10517906
912	Ga0207640_10034722
913	Ga0207658_10126991
914	Ga0207658_10935232
915	Ga0207677_10020435
916	Ga0207677_10023294
917	Ga0207677_10451329
918	Ga0207677_10851270
919	Ga0207703_10009308
920	Ga0207703_10036732
921	Ga0207703_10631386
922	Ga0207703_10765511
923	Ga0207703_10824240
924	Ga0207703_10939627
925	Ga0207639_11673695
926	Ga0207678_10662531
927	Ga0207708_10924762
928	Ga0207641_10001674
929	Ga0207641_10080647
930	Ga0207641_10951208
931	Ga0207641_11035216
932	Ga0207648_10008731
933	Ga0207648_10019539
934	Ga0207648_10512526
935	Ga0207676_10029383
936	Ga0207676_10043030
937	Ga0207676_10086153
938	Ga0207676_10134481
939	Ga0207674_10228384
940	Ga0207674_10307127
941	Ga0207674_10527751
942	Ga0207675_100057951
943	Ga0207675_100114906
944	Ga0207675_100304125
945	Ga0207675_100372809
946	Ga0207683_10204380
947	Ga0207683_10309180
948	Ga0207683_10677718
949	Ga0207683_11746391
950	Ga0207428_10023202
951	Ga0207428_10023538
952	Ga0207428_10615940
953	Ga0268266_10007240
954	Ga0268266_10010362
955	Ga0268266_10229472
956	Ga0268265_10172916
957	Ga0268265_10824492
958	Ga0268264_10405525
959	Ga0268264_11691936
960	Ga0307408_100688272
961	Ga0373930_0000320
962	Ga0373948_0000141
963	Ga0373950_0007555
964	Ga0373958_0002384
965	Ga0373959_0000482
966	Ga0373938_0013986
967	Ga0373926_0060601
968	Ga0373929_0000091
969	Ga0373934_0123818
970	Ga0373940_0180354
971	Ga0373944_0031103
972	Ga0373951_0000106
973	Ga0373952_0000985
974	Ga0373952_0005484
975	Ga0373932_0000207
976	Ga0373932_0174754
977	Ga0373936_0334100
978	Ga0373941_0001675
979	Ga0373941_0101164
980	Ga0373953_0227190
981	Ga0373954_0181338
982	Ga0373954_0682369
983	Ga0373956_0193772
984	Ga0373960_0000394
985	Ga0373943_0176326
986	Ga0373946_0322554
987	Ga0373955_0032291
988	Ga0373955_0373357
989	Ga0373955_0459566
990	Ga0373942_0000561
991	Ga0373961_0000706
992	Ga0373962_0000569
993	Ga0373962_0072091
994	Ga0373924_0141279
995	Ga0373931_0005036
996	Ga0373935_0142528
997	Ga0373935_0313600
998	Ga0373927_0118233
999	Ga0373933_0208421
1000	Ga0373933_0270928
1001	Ga0373933_0288181
1002	Ga0373933_0635027
1003	Ga0373947_0115331
1004	Ga0373947_0189840
1005	Ga0373947_0591663
1006	Ga0373947_0655044
1007	Ga0373937_0023152
1008	Ga0373937_0105237
1009	Ga0373937_0201123
1010	Ga0373937_0204644
1011	Ga0373937_0263386
1012	Ga0373937_0415113
1013	Ga0373937_0630554
1014	Ga0373937_0791219
1015	Ga0373937_0965512
1016	Ga0373925_0596011
1017	Ga0373925_1497332
1018	Ga0451576_0206867
1019	Ga0451576_0314363
1020	Ga0466967_0902432
1021	Ga0495592_0373916
1022	Ga0495603_0059186
1023	Ga0495603_0407042
1024	Ga0495629_0075392
1025	Ga0495651_0565509
1026	Ga0495653_0762415
1027	Ga0495580_0344637
1028	Ga0495582_0234531
1029	Ga0495639_0370726
1030	Ga0495664_0147388
1031	Ga0495608_0011490
1032	Ga0495618_0474482
1033	Ga0495628_0632710
1034	Ga0495630_0038681
1035	Ga0495652_0096573
1036	Ga0495652_0200803
1037	Ga0495665_0320427
1038	Ga0495586_0440991
1039	Ga0495587_0049668
1040	Ga0495587_0141671
1041	Ga0495621_0441770
1042	Ga0495645_0000912
1043	Ga0495645_0405753
1044	Ga0495667_0136904
1045	Ga0495667_0593956
1046	Ga0495656_0016928
1047	Ga0495634_0040587
1048	Ga0495635_0250036
1049	Ga0495658_0501886
1050	Ga0495669_0266598
1051	Ga0495613_0002802
1052	Ga0495613_0065294
1053	Ga0495670_0168823
1054	Ga0495649_0218650
1055	Ga0495600_0296069
1056	Ga0495600_0486165
1057	Ga0495604_0032371
1058	Ga0495604_0107922
1059	Ga0495674_0776521
1060	Ga0495672_0384772
1061	Ga0495676_0347652
1062	Ga0495675_0299916
1063	Ga0495684_0004911
1064	Ga0495684_0023640
1065	Ga0495614_0103432
1066	Ga0496100_0112432
1067	Ga0496100_1506382
1068	Ga0496101_0000634
1069	Ga0496104_0018660
1070	Ga0496104_0087065
1071	Ga0496104_0196238
1072	Ga0496104_0325700
1073	Ga0496104_0993366
1074	Ga0496105_0357788
1075	Ga0496106_0137859
1076	Ga0496106_0175803
1077	Ga0496106_0380371
1078	Ga0496106_0598562
1079	Ga0496108_0005741
1080	Ga0496108_0597028
1081	Ga0496109_0095489
1082	Ga0496109_0973496
1083	Ga0496110_0520133
1084	Ga0496110_0886744
1085	Ga0496111_0196599
1086	Ga0496111_0807206
1087	Ga0496112_0000483
1088	Ga0496112_0102452
1089	Ga0496112_0138342
1090	Ga0496112_0661702
1091	Ga0496112_1587970
1092	Ga0496113_0047440
1093	Ga0496114_0001934
1094	Ga0496114_0043903
1095	Ga0496114_0117252
1096	Ga0496114_0123045
1097	Ga0496114_0132555
1098	Ga0496114_1120967
1099	Ga0496115_0041384
1100	Ga0496115_0817085
1101	Ga0501081_0905167
1102	Ga0501083_0274697
1103	nmdc:mga05p37_22763_c1
1104	nmdc:mga05p37_42874_c1
1105	nmdc:mga05p37_429536_c1
1106	nmdc:mga05p37_53224_c1
1107	nmdc:mga05p37_7088_c1
1108	nmdc:mga05p37_868804_c1
1109	nmdc:mga09592_983346_c1
1110	nmdc:mga0qj67_722380_c1
1111	nmdc:mga08y16_21067_c1
1112	nmdc:mga08y16_57993_c1
1113	nmdc:mga08y16_804265_c1
1114	nmdc:mga08y16_976201_c1
1115	nmdc:mga0n895_107215_c1
1116	nmdc:mga0n895_19485_c1
1117	nmdc:mga0n895_349186_c1
1118	nmdc:mga0n895_577564_c1
1119	nmdc:mga0n895_7846_c1
1120	nmdc:mga0n895_96600_c1
1121	nmdc:mga0rr50_12654_c1
1122	nmdc:mga0rr50_199393_c1
1123	nmdc:mga0rr50_22192_c1
1124	nmdc:mga0rr50_305410_c1
1125	nmdc:mga0rr50_46131_c1
1126	nmdc:mga0rr50_529732_c1
1127	nmdc:mga0rr50_705349_c1
1128	nmdc:mga08x19_207097_c1
1129	nmdc:mga08x19_4946_c1
1130	nmdc:mga0a205_141390_c1
1131	Ga0495601_0015347
1132	Ga0495601_0035518
1133	Ga0495601_0108912
1134	Ga0495601_0186874
1135	Ga0495595_0007954
1136	Ga0495595_0265842
1137	Ga0495619_0006633
1138	Ga0495619_0015200
1139	Ga0495619_0222065
1140	Ga0495619_0287915
1141	Ga0495619_0354126
1142	Ga0495619_0520523
1143	Ga0495619_0618949
1144	Ga0530510_0326427

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF12802

MarR_2

MarR family

34

91

0.97 PF01047

MarR

MarR family

36

92

0.94 Structural Annotation

Top 5 Hits

ID	Description	Score	Start	End
5lzd-assembly1.cif.gz_z	structure of selb-sec-trnasec bound to the 70s ribosome in the gtpase activated state (ga)	0.9467	44	81
4lb5-assembly1.cif.gz_A-2	crystal structure of pkz zalpha in complex with ds(cg)6 (hexagonal form)	0.9323	50	97
5zuo-assembly1.cif.gz_A	crystal structure of bz junction in diverse sequence	0.9187	52	97
4awx-assembly1.cif.gz_B	moonlighting functions of feoc in the regulation of ferrous iron transport in feo	0.9155	42	96
8cll-assembly1.cif.gz_F	structural insights into human tfiiic promoter recognition	0.8814	51	96

ID	Description	Score	Start	End	Superfamily
af_K7LWV0_206_275_1.10.10.10	Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain	0.9703	51	81	1.10.10.10
af_Q58948_3_81_1.10.10.10	Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain	0.9605	40	110	1.10.10.10
af_P0ACK8_1_59_1.10.10.10	Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain	0.9431	41	97	1.10.10.10
af_P0A9W0_3_58_1.10.10.10	Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain	0.9413	42	83	1.10.10.10
af_Q58793_322_389_1.10.10.10	Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain	0.94	43	96	1.10.10.10

ID	Description	Score	Start	End	GO Terms
AF-A0A496QQT6-F1-model_v4	HTH marR-type domain-containing protein	0.9559	1	144	GO:0003700 GO:0006950
AF-A0A7Y5BN36-F1-model_v4	MarR family transcriptional regulator	0.9487	5	144	GO:0003677 GO:0003700 GO:0006950
AF-A0A496QQT6-F1-model_v4	HTH marR-type domain-containing protein	0.9431	1	144	GO:0003700 GO:0006950
AF-A0A1F2TMX1-F1-model_v4	HTH marR-type domain-containing protein	0.9422	1	147	GO:0003677 GO:0003700 GO:0006950
AF-A0A1F5UVX1-F1-model_v4	HTH-type transcriptional regulator SarZ (Staphylococcal accessory regulator Z)	0.9289	7	143	GO:0003677 GO:0003700

F465130

General Info

Family's Representative Sequence

Samples

Type Distribution

Biome Distribution

Taxonomy

Scaffolds

MSA Aligner

Family Sequences

Functional Annotation

PF12802

MarR_2

MarR family

34

91

0.97

PF01047

MarR

MarR family

36

92

0.94

Structural Annotation

Top 5 Hits

Map