F464932

General Info

Members Datasets Scaffolds Average Seq Length
571 241 1142 243

Family's Representative Sequence

Representative Sequence 3300006358|Ga0068871_100233230|Ga0068871_1002332302
Length 261
Sequence MLSREAYPPPDPPVTLFLMPTPNISGLRHRIQNVIGPTPWYWKTFPALRSESGQRFVWSHHDEQGPLGYVVSLALEQQADKPRLALNTYCRPFLIPPSRLGVWCPEGRHIRLVCFEPDQLKAFDLAEIAGWFKQSSDRIYAATAPLAEFEVPVKLPPGTNKINVPAEMQTVDELIAPTTYAALNQDDPAMALYVFYLQAGLVEVLPQKWFTSAQYNVGQQWITRAARDPESHQIFGDGIRVGSFLLEEDGCRLQEWIDKKE

Samples

Sample ID Description Type Environment
1 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
2 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
3 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
4 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
5 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
6 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
7 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
8 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
9 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
10 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
11 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
12 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
13 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
14 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
15 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
16 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
17 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
18 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
19 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
20 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
21 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
22 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
23 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
24 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
25 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
26 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
27 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
28 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
29 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
30 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
31 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
32 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
33 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
34 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
35 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
36 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
37 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
38 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
39 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
40 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
41 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
42 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
43 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
44 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
45 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
46 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
47 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
48 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
49 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
50 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
51 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
52 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
53 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
54 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
55 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
56 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
57 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
58 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
59 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
60 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
61 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
62 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
63 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
64 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
65 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
66 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
67 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
68 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
69 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
70 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
71 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
72 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
73 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
74 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
75 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
76 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
77 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
78 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
79 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
80 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
81 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
82 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
83 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
84 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
85 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
86 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
87 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
88 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
89 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
90 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
91 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
92 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
93 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
94 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
95 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
96 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
97 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
98 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
99 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
100 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
101 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
102 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
103 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
104 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
105 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
106 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
107 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
108 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
109 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
110 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
111 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
112 3300022730 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU2 Metagenome Rhizosphere
113 3300022732 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU1 Metagenome Rhizosphere
114 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
115 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
116 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300028016 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 Metagenome Rhizosphere
176 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
180 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
181 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
182 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
183 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
184 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
185 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
186 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
187 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
188 3300033547 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE1 Metagenome Unclassified
189 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
190 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
191 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
192 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
193 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
194 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
195 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
196 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
197 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
198 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
199 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
200 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
201 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
202 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
203 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
204 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
205 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
206 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
207 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
208 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
209 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
210 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
211 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
212 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
213 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
214 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
215 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
216 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
217 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
218 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
219 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
220 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
221 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
222 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
223 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
224 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
225 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
226 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
227 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
228 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
229 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
230 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
231 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
232 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
233 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
234 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
235 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
236 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
237 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
238 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
239 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
240 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
241 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.12
Metatranscriptomes 0.88
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 5.08
Rhizosphere 94.75
Stem 0
Stem Tuber 0
Unclassified 8.76

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068871_100233230 3300006358 Bacteria 1598
2 MBSR1b_contig_1667589 2162886012 Bacteria 1158
3 JGI24743J22301_10011839 3300001991 Bacteria 1579
4 JGI24034J26672_10005002 3300002239 Bacteria 1893
5 JGI24751J29686_10002844 3300002459 Bacteria 3490
6 JGI24751J29686_10014944 3300002459 Bacteria 1602
7 Ga0065712_10092970 3300005290 Bacteria 2293
8 Ga0065715_10103998 3300005293 Bacteria 2993
9 Ga0070658_10103264 3300005327 Bacteria 2357
10 Ga0070658_10601893 3300005327 Bacteria 953
11 Ga0070676_10018221 3300005328 Bacteria 3887
12 Ga0070683_100006636 3300005329 Bacteria 9718
13 Ga0070683_100552588 3300005329 Unclassified 1101
14 Ga0070690_100026005 3300005330 Bacteria 3607
15 Ga0070670_100049986 3300005331 Bacteria 3594
16 Ga0070670_100084888 3300005331 Bacteria 2720
17 Ga0070670_100322609 3300005331 Bacteria 1353
18 Ga0070670_100341156 3300005331 Bacteria 1315
19 Ga0070677_10038833 3300005333 Bacteria 1865
20 Ga0068869_100010243 3300005334 Bacteria 6107
21 Ga0068869_100016138 3300005334 Bacteria 5030
22 Ga0068869_100143743 3300005334 Bacteria 1844
23 Ga0068869_100160820 3300005334 Bacteria 1748
24 Ga0070666_10047077 3300005335 Bacteria 2894
25 Ga0070680_100281419 3300005336 Bacteria 1409
26 Ga0070682_100056772 3300005337 Bacteria 2463
27 Ga0068868_100003974 3300005338 Bacteria 10320
28 Ga0068868_100008302 3300005338 Bacteria 7436
29 Ga0068868_100023172 3300005338 Bacteria 4696
30 Ga0068868_100068237 3300005338 Bacteria 2831
31 Ga0068868_100110098 3300005338 Bacteria 2237
32 Ga0070660_100048732 3300005339 Bacteria 3254
33 Ga0070660_100250786 3300005339 Bacteria 1443
34 Ga0070689_100100777 3300005340 Bacteria 2285
35 Ga0070661_100003462 3300005344 Bacteria 10887
36 Ga0070661_100069000 3300005344 Bacteria 2598
37 Ga0070661_100482963 3300005344 Unclassified 990
38 Ga0070692_10358889 3300005345 Unclassified 908
39 Ga0070668_100007537 3300005347 Bacteria 8083
40 Ga0070669_100084789 3300005353 Bacteria 2365
41 Ga0070675_100120327 3300005354 Bacteria 2230
42 Ga0070671_100053714 3300005355 Bacteria 3349
43 Ga0070671_100114561 3300005355 Bacteria 2266
44 Ga0070673_100121462 3300005364 Bacteria 2180
45 Ga0070673_100213058 3300005364 Bacteria 1669
46 Ga0070688_100002427 3300005365 Bacteria 9420
47 Ga0070659_100029756 3300005366 Bacteria 4221
48 Ga0070709_10000534 3300005434 Bacteria 22268
49 Ga0070709_10030435 3300005434 Bacteria 3240
50 Ga0070709_10037009 3300005434 Bacteria 2977
51 Ga0070714_100000049 3300005435 Bacteria 111102
52 Ga0070714_100001255 3300005435 Bacteria 18319
53 Ga0070714_100024046 3300005435 Bacteria 5012
54 Ga0070714_100095703 3300005435 Bacteria 2608
55 Ga0070714_100263564 3300005435 Bacteria 1596
56 Ga0070714_100496422 3300005435 Bacteria 1164
57 Ga0070713_100000087 3300005436 Bacteria 58314
58 Ga0070713_100007643 3300005436 Bacteria 7607
59 Ga0070713_100024149 3300005436 Bacteria 4731
60 Ga0070713_100076416 3300005436 Bacteria 2844
61 Ga0070713_100091814 3300005436 Bacteria 2613
62 Ga0070713_100125962 3300005436 Bacteria 2253
63 Ga0070713_100683834 3300005436 Unclassified 979
64 Ga0070710_10031925 3300005437 Bacteria 2848
65 Ga0070710_10035768 3300005437 Bacteria 2710
66 Ga0070711_100001138 3300005439 Bacteria 14245
67 Ga0070711_100180773 3300005439 Bacteria 1615
68 Ga0070711_100243488 3300005439 Bacteria 1407
69 Ga0070705_100073207 3300005440 Bacteria 2078
70 Ga0070700_100187132 3300005441 Bacteria 1445
71 Ga0070708_100031254 3300005445 Bacteria 4608
72 Ga0070663_100015571 3300005455 Bacteria 4914
73 Ga0070678_100099929 3300005456 Bacteria 2246
74 Ga0070678_100926712 3300005456 Unclassified 797
75 Ga0070662_100339577 3300005457 Bacteria 1228
76 Ga0070681_10000145 3300005458 Bacteria 53683
77 Ga0070681_10008173 3300005458 Bacteria 10245
78 Ga0070681_10075138 3300005458 Bacteria 3339
79 Ga0070681_10080595 3300005458 Bacteria 3211
80 Ga0070681_10271982 3300005458 Bacteria 1606
81 Ga0068867_100010509 3300005459 Bacteria 6531
82 Ga0068867_100037913 3300005459 Bacteria 3506
83 Ga0068867_100137573 3300005459 Bacteria 1906
84 Ga0068867_100223863 3300005459 Bacteria 1517
85 Ga0068867_100385960 3300005459 Bacteria 1178
86 Ga0070685_10001679 3300005466 Bacteria 11630
87 Ga0070706_100001205 3300005467 Bacteria 27687
88 Ga0070706_100137813 3300005467 Bacteria 2277
89 Ga0070707_100045233 3300005468 Bacteria 4214
90 Ga0070699_100142930 3300005518 Bacteria 2114
91 Ga0070679_100005857 3300005530 Bacteria 11408
92 Ga0070679_100239952 3300005530 Bacteria 1770
93 Ga0070679_100351998 3300005530 Bacteria 1420
94 Ga0070679_100599052 3300005530 Bacteria 1045
95 Ga0070684_100041812 3300005535 Bacteria 3954
96 Ga0070684_100053654 3300005535 Bacteria 3510
97 Ga0070684_100367486 3300005535 Bacteria 1324
98 Ga0070697_100000581 3300005536 Bacteria 27631
99 Ga0068853_100004441 3300005539 Bacteria 10867
100 Ga0068853_100107581 3300005539 Bacteria 2473
101 Ga0070672_100039504 3300005543 Bacteria 3615
102 Ga0070672_100122977 3300005543 Bacteria 2126
103 Ga0070686_100020313 3300005544 Bacteria 3928
104 Ga0070696_100424658 3300005546 Unclassified 1044
105 Ga0070693_100300376 3300005547 Bacteria 1082
106 Ga0068855_100002457 3300005563 Bacteria 22883
107 Ga0068855_100004647 3300005563 Bacteria 16758
108 Ga0068855_100067456 3300005563 Bacteria 4167
109 Ga0068855_100087476 3300005563 Bacteria 3601
110 Ga0068855_100204983 3300005563 Bacteria 2219
111 Ga0070664_100041626 3300005564 Bacteria 3877
112 Ga0070664_100050067 3300005564 Bacteria 3534
113 Ga0070664_100176878 3300005564 Bacteria 1895
114 Ga0068857_100000103 3300005577 Bacteria 49957
115 Ga0068857_100001930 3300005577 Bacteria 16712
116 Ga0068857_100021565 3300005577 Bacteria 5668
117 Ga0068854_100001916 3300005578 Bacteria 12677
118 Ga0068854_100020557 3300005578 Bacteria 4469
119 Ga0068854_100098088 3300005578 Bacteria 2192
120 Ga0068854_100137573 3300005578 Bacteria 1871
121 Ga0068854_100179999 3300005578 Bacteria 1651
122 Ga0068854_100339791 3300005578 Bacteria 1226
123 Ga0068856_100000831 3300005614 Bacteria 33256
124 Ga0068856_100003508 3300005614 Bacteria 15827
125 Ga0068856_100009065 3300005614 Bacteria 9680
126 Ga0068856_100010929 3300005614 Bacteria 8808
127 Ga0068856_100014330 3300005614 Bacteria 7666
128 Ga0068856_100055275 3300005614 Bacteria 3917
129 Ga0068856_100134901 3300005614 Unclassified 2474
130 Ga0070702_100287469 3300005615 Unclassified 1131
131 Ga0068852_100012457 3300005616 Bacteria 6459
132 Ga0068852_100079012 3300005616 Bacteria 2913
133 Ga0068852_100143089 3300005616 Bacteria 2215
134 Ga0068859_100001596 3300005617 Bacteria 23138
135 Ga0068859_100007525 3300005617 Bacteria 11054
136 Ga0068859_100014192 3300005617 Bacteria 7989
137 Ga0068864_100002450 3300005618 Bacteria 15328
138 Ga0068864_100027441 3300005618 Bacteria 4809
139 Ga0068864_100095650 3300005618 Bacteria 2627
140 Ga0068864_100604120 3300005618 Bacteria 1065
141 Ga0068866_10002093 3300005718 Bacteria 8306
142 Ga0068866_10019039 3300005718 Bacteria 3117
143 Ga0068866_10082078 3300005718 Bacteria 1733
144 Ga0068861_100044006 3300005719 Bacteria 3355
145 Ga0068851_10110815 3300005834 Bacteria 1465
146 Ga0068851_10124247 3300005834 Bacteria 1390
147 Ga0068851_10202370 3300005834 Bacteria 1109
148 Ga0068870_10009338 3300005840 Bacteria 4456
149 Ga0068863_100002310 3300005841 Bacteria 18962
150 Ga0068863_100060169 3300005841 Bacteria 3592
151 Ga0068863_100104673 3300005841 Bacteria 2692
152 Ga0068863_100587424 3300005841 Bacteria 1102
153 Ga0068858_100000802 3300005842 Bacteria 32930
154 Ga0068858_100002301 3300005842 Bacteria 19338
155 Ga0068858_100032225 3300005842 Bacteria 4868
156 Ga0068858_100063819 3300005842 Bacteria 3408
157 Ga0068858_100314590 3300005842 Bacteria 1495
158 Ga0068860_100014344 3300005843 Bacteria 7767
159 Ga0068860_100111034 3300005843 Bacteria 2621
160 Ga0068860_100214923 3300005843 Bacteria 1866
161 Ga0068860_100366402 3300005843 Bacteria 1420
162 Ga0068862_100134326 3300005844 Bacteria 2191
163 Ga0068862_100270018 3300005844 Bacteria 1555
164 Ga0081540_1079082 3300005983 Bacteria 1488
165 Ga0070717_10001569 3300006028 Bacteria 15815
166 Ga0070717_10007306 3300006028 Bacteria 8195
167 Ga0070717_10052044 3300006028 Bacteria 3372
168 Ga0070717_10490038 3300006028 Unclassified 1110
169 Ga0070715_10007259 3300006163 Bacteria 3810
170 Ga0070715_10171964 3300006163 Unclassified 1080
171 Ga0070716_100000485 3300006173 Bacteria 16467
172 Ga0070716_100000984 3300006173 Bacteria 12417
173 Ga0070716_100004594 3300006173 Bacteria 6620
174 Ga0070716_100059429 3300006173 Bacteria 2204
175 Ga0070712_100002338 3300006175 Bacteria 11683
176 Ga0070712_100004090 3300006175 Bacteria 8961
177 Ga0070712_100004113 3300006175 Bacteria 8941
178 Ga0097621_100000186 3300006237 Bacteria 39848
179 Ga0097621_100001011 3300006237 Bacteria 19780
180 Ga0097621_100042290 3300006237 Bacteria 3670
181 Ga0068871_100001600 3300006358 Bacteria 15224
182 Ga0068871_100002219 3300006358 Bacteria 13188
183 Ga0068871_100094733 3300006358 Bacteria 2492
184 Ga0068871_100218207 3300006358 Bacteria 1651
185 Ga0068871_100288963 3300006358 Bacteria 1436
186 Ga0075433_10013160 3300006852 Bacteria 6716
187 Ga0075434_100019655 3300006871 Bacteria 6538
188 Ga0075434_100073405 3300006871 Bacteria 3414
189 Ga0068865_100013199 3300006881 Bacteria 5216
190 Ga0068865_100015956 3300006881 Bacteria 4796
191 Ga0068865_100020950 3300006881 Bacteria 4247
192 Ga0068865_100054830 3300006881 Bacteria 2772
193 Ga0075436_100052509 3300006914 Bacteria 2814
194 Ga0075436_100387232 3300006914 Bacteria 1011
195 Ga0097620_100001596 3300006931 Bacteria 23138
196 Ga0097620_100007525 3300006931 Bacteria 11054
197 Ga0097620_100014192 3300006931 Bacteria 7989
198 Ga0099794_10161108 3300007265 Unclassified 1141
199 Ga0099795_10250283 3300007788 Unclassified 764
200 Ga0105251_10205412 3300009011 Unclassified 887
201 Ga0105250_10016988 3300009092 Bacteria 2960
202 Ga0105250_10126699 3300009092 Bacteria 1052
203 Ga0105240_10027807 3300009093 Bacteria 7400
204 Ga0105240_10084013 3300009093 Bacteria 3905
205 Ga0105240_10142560 3300009093 Bacteria 2863
206 Ga0105240_10189240 3300009093 Bacteria 2421
207 Ga0105240_10498082 3300009093 Bacteria 1355
208 Ga0105245_10054237 3300009098 Bacteria 3600
209 Ga0105245_10122839 3300009098 Bacteria 2427
210 Ga0105245_10130224 3300009098 Bacteria 2359
211 Ga0105247_10002075 3300009101 Bacteria 13871
212 Ga0105241_10043758 3300009174 Bacteria 3392
213 Ga0105241_10098586 3300009174 Bacteria 2319
214 Ga0105241_10105005 3300009174 Bacteria 2252
215 Ga0105241_10196401 3300009174 Bacteria 1682
216 Ga0105242_10082327 3300009176 Bacteria 2693
217 Ga0105242_10122939 3300009176 Bacteria 2230
218 Ga0105242_10143755 3300009176 Bacteria 2073
219 Ga0105242_10229279 3300009176 Bacteria 1664
220 Ga0105242_10505396 3300009176 Bacteria 1150
221 Ga0105248_10003050 3300009177 Bacteria 18578
222 Ga0105248_10057600 3300009177 Bacteria 4362
223 Ga0105248_10079413 3300009177 Unclassified 3688
224 Ga0105248_10517387 3300009177 Bacteria 1346
225 Ga0105237_10031883 3300009545 Bacteria 5338
226 Ga0105237_10080488 3300009545 Bacteria 3248
227 Ga0105237_10154093 3300009545 Bacteria 2294
228 Ga0105237_10175828 3300009545 Bacteria 2141
229 Ga0105237_10340445 3300009545 Bacteria 1504
230 Ga0105237_10475625 3300009545 Bacteria 1255
231 Ga0105237_10524729 3300009545 Unclassified 1191
232 Ga0105238_10003737 3300009551 Bacteria 15143
233 Ga0105238_10102072 3300009551 Bacteria 2850
234 Ga0105238_10336602 3300009551 Bacteria 1497
235 Ga0105238_10348600 3300009551 Bacteria 1470
236 Ga0105249_10088055 3300009553 Bacteria 2899
237 Ga0105249_10519298 3300009553 Unclassified 1238
238 Ga0099796_10046516 3300010159 Bacteria 1490
239 Ga0099796_10115051 3300010159 Unclassified 1028
240 Ga0099796_10134544 3300010159 Unclassified 961
241 Ga0105239_10016908 3300010375 Bacteria 8062
242 Ga0105239_10193936 3300010375 Bacteria 2274
243 Ga0105239_10366980 3300010375 Bacteria 1627
244 Ga0105239_10372857 3300010375 Bacteria 1613
245 Ga0105239_11061262 3300010375 Unclassified 932
246 Ga0105246_10093345 3300011119 Bacteria 2174
247 Ga0157373_10052376 3300013100 Bacteria 2905
248 Ga0157373_10057415 3300013100 Bacteria 2761
249 Ga0157373_10284055 3300013100 Bacteria 1173
250 Ga0157371_10004537 3300013102 Bacteria 12094
251 Ga0157371_10216995 3300013102 Unclassified 1373
252 Ga0157370_10024605 3300013104 Bacteria 5963
253 Ga0157369_10000062 3300013105 Bacteria 149758
254 Ga0157369_10007201 3300013105 Bacteria 12818
255 Ga0157369_10035904 3300013105 Bacteria 5433
256 Ga0157369_10073607 3300013105 Bacteria 3665
257 Ga0157369_10104774 3300013105 Bacteria 3011
258 Ga0157369_10194282 3300013105 Bacteria 2132
259 Ga0157369_10318613 3300013105 Bacteria 1617
260 Ga0157374_10000665 3300013296 Bacteria 30212
261 Ga0157374_10001198 3300013296 Bacteria 22160
262 Ga0157374_10004088 3300013296 Bacteria 12244
263 Ga0157374_10010616 3300013296 Bacteria 7930
264 Ga0157374_10255668 3300013296 Bacteria 1724
265 Ga0157378_10000570 3300013297 Bacteria 34853
266 Ga0157378_10001319 3300013297 Bacteria 22308
267 Ga0157378_10019903 3300013297 Bacteria 5901
268 Ga0163162_10612258 3300013306 Bacteria 1215
269 Ga0157372_10000779 3300013307 Bacteria 34499
270 Ga0157372_10001078 3300013307 Bacteria 29713
271 Ga0157372_10001382 3300013307 Bacteria 26191
272 Ga0157372_10008648 3300013307 Bacteria 10813
273 Ga0157372_10015823 3300013307 Bacteria 8092
274 Ga0157372_10071045 3300013307 Bacteria 3919
275 Ga0157372_10088175 3300013307 Bacteria 3522
276 Ga0157372_10090861 3300013307 Bacteria 3472
277 Ga0157372_10218173 3300013307 Bacteria 2211
278 Ga0157375_10587059 3300013308 Unclassified 1274
279 Ga0157375_10596257 3300013308 Bacteria 1264
280 Ga0157375_11235533 3300013308 Unclassified 877
281 Ga0163163_10013262 3300014325 Bacteria 7539
282 Ga0163163_10270999 3300014325 Bacteria 1749
283 Ga0163163_10449299 3300014325 Bacteria 1349
284 Ga0157377_10011449 3300014745 Bacteria 4428
285 Ga0157379_10007201 3300014968 Bacteria 9620
286 Ga0157379_10053258 3300014968 Bacteria 3615
287 Ga0157376_10001731 3300014969 Bacteria 14523
288 Ga0157376_10008790 3300014969 Bacteria 7308
289 Ga0157376_10049858 3300014969 Bacteria 3470
290 Ga0157376_10078099 3300014969 Bacteria 2833
291 Ga0157376_10137469 3300014969 Bacteria 2188
292 Ga0157376_10572828 3300014969 Bacteria 1120
293 Ga0157376_10610322 3300014969 Bacteria 1087
294 Ga0224570_101459 3300022730 Bacteria 1767
295 Ga0224569_101118 3300022732 Bacteria 2277
296 Ga0224572_1000012 3300024225 Bacteria 9349
297 Ga0224572_1005088 3300024225 Unclassified 2329
298 Ga0228598_1000861 3300024227 Bacteria 6564
299 Ga0207697_10007637 3300025315 Bacteria 4799
300 Ga0207656_10013461 3300025321 Bacteria 3128
301 Ga0207656_10084237 3300025321 Bacteria 1434
302 Ga0207682_10011702 3300025893 Bacteria 3429
303 Ga0207692_10002867 3300025898 Bacteria 6670
304 Ga0207692_10023474 3300025898 Bacteria 2853
305 Ga0207692_10053145 3300025898 Bacteria 2062
306 Ga0207692_10066385 3300025898 Bacteria 1886
307 Ga0207692_10459713 3300025898 Bacteria 802
308 Ga0207642_10016277 3300025899 Bacteria 2796
309 Ga0207642_10095594 3300025899 Bacteria 1479
310 Ga0207642_10151760 3300025899 Bacteria 1234
311 Ga0207688_10048754 3300025901 Bacteria 2366
312 Ga0207680_10492292 3300025903 Unclassified 873
313 Ga0207647_10007693 3300025904 Bacteria 7761
314 Ga0207647_10008101 3300025904 Bacteria 7552
315 Ga0207647_10031544 3300025904 Bacteria 3409
316 Ga0207647_10240790 3300025904 Bacteria 1039
317 Ga0207685_10032277 3300025905 Bacteria 1883
318 Ga0207699_10017938 3300025906 Bacteria 3740
319 Ga0207699_10026100 3300025906 Bacteria 3215
320 Ga0207699_10028413 3300025906 Bacteria 3108
321 Ga0207699_10080800 3300025906 Bacteria 2015
322 Ga0207699_10254219 3300025906 Bacteria 1212
323 Ga0207645_10000939 3300025907 Bacteria 24219
324 Ga0207643_10001563 3300025908 Bacteria 13019
325 Ga0207705_10119696 3300025909 Bacteria 1953
326 Ga0207705_10529796 3300025909 Bacteria 916
327 Ga0207684_10011651 3300025910 Bacteria 7676
328 Ga0207684_10102514 3300025910 Bacteria 2447
329 Ga0207654_10023697 3300025911 Bacteria 3291
330 Ga0207654_10039600 3300025911 Bacteria 2652
331 Ga0207654_10043752 3300025911 Bacteria 2540
332 Ga0207707_10005993 3300025912 Bacteria 10639
333 Ga0207707_10006642 3300025912 Bacteria 10094
334 Ga0207707_10013148 3300025912 Bacteria 7213
335 Ga0207695_10025388 3300025913 Bacteria 6634
336 Ga0207695_10211967 3300025913 Bacteria 1847
337 Ga0207671_10412145 3300025914 Bacteria 1075
338 Ga0207693_10000202 3300025915 Bacteria 54429
339 Ga0207693_10000728 3300025915 Bacteria 29655
340 Ga0207693_10007587 3300025915 Bacteria 8913
341 Ga0207663_10000392 3300025916 Bacteria 18994
342 Ga0207663_10018337 3300025916 Bacteria 3921
343 Ga0207663_10087339 3300025916 Bacteria 2059
344 Ga0207663_10100611 3300025916 Bacteria 1940
345 Ga0207662_10002135 3300025918 Bacteria 9837
346 Ga0207657_10004695 3300025919 Bacteria 14420
347 Ga0207657_10012645 3300025919 Bacteria 8320
348 Ga0207649_10000355 3300025920 Bacteria 34488
349 Ga0207652_10032075 3300025921 Bacteria 4413
350 Ga0207652_10115445 3300025921 Bacteria 2385
351 Ga0207652_10531034 3300025921 Bacteria 1058
352 Ga0207652_10544872 3300025921 Bacteria 1043
353 Ga0207646_10042533 3300025922 Bacteria 4081
354 Ga0207694_10039367 3300025924 Bacteria 3638
355 Ga0207694_10366112 3300025924 Bacteria 1195
356 Ga0207650_10000884 3300025925 Bacteria 22676
357 Ga0207650_10223203 3300025925 Bacteria 1517
358 Ga0207650_10543608 3300025925 Unclassified 973
359 Ga0207659_10390384 3300025926 Unclassified 1162
360 Ga0207687_10043594 3300025927 Bacteria 3092
361 Ga0207687_10078710 3300025927 Bacteria 2374
362 Ga0207687_10390797 3300025927 Bacteria 1142
363 Ga0207700_10001159 3300025928 Bacteria 15133
364 Ga0207700_10002031 3300025928 Bacteria 11563
365 Ga0207700_10013393 3300025928 Bacteria 5334
366 Ga0207700_10034835 3300025928 Bacteria 3619
367 Ga0207700_10131545 3300025928 Bacteria 2044
368 Ga0207700_10240867 3300025928 Unclassified 1542
369 Ga0207700_10282014 3300025928 Bacteria 1429
370 Ga0207700_10546865 3300025928 Unclassified 1027
371 Ga0207664_10000052 3300025929 Bacteria 131431
372 Ga0207664_10019370 3300025929 Bacteria 5028
373 Ga0207664_10415719 3300025929 Unclassified 1197
374 Ga0207664_10776646 3300025929 Unclassified 862
375 Ga0207664_10846539 3300025929 Unclassified 822
376 Ga0207644_10046702 3300025931 Bacteria 3086
377 Ga0207690_10371642 3300025932 Unclassified 1134
378 Ga0207706_10025736 3300025933 Bacteria 5271
379 Ga0207706_10045913 3300025933 Bacteria 3869
380 Ga0207686_10421237 3300025934 Unclassified 1021
381 Ga0207670_10073628 3300025936 Bacteria 2369
382 Ga0207704_10012030 3300025938 Bacteria 4282
383 Ga0207704_10133556 3300025938 Bacteria 1723
384 Ga0207665_10000707 3300025939 Bacteria 22630
385 Ga0207665_10005613 3300025939 Bacteria 8362
386 Ga0207665_10020184 3300025939 Bacteria 4378
387 Ga0207665_10067543 3300025939 Bacteria 2435
388 Ga0207665_10134977 3300025939 Bacteria 1755
389 Ga0207691_10002497 3300025940 Bacteria 17987
390 Ga0207711_10014463 3300025941 Bacteria 6557
391 Ga0207711_10368277 3300025941 Unclassified 1332
392 Ga0207711_10369304 3300025941 Bacteria 1330
393 Ga0207689_10000394 3300025942 Bacteria 41129
394 Ga0207689_10161076 3300025942 Bacteria 1849
395 Ga0207661_10150296 3300025944 Bacteria 2013
396 Ga0207661_10172466 3300025944 Bacteria 1883
397 Ga0207661_10401429 3300025944 Bacteria 1243
398 Ga0207679_10000065 3300025945 Bacteria 97825
399 Ga0207679_10524194 3300025945 Unclassified 1060
400 Ga0207667_10005137 3300025949 Bacteria 15986
401 Ga0207667_10009536 3300025949 Bacteria 11422
402 Ga0207667_10182811 3300025949 Bacteria 2152
403 Ga0207667_10301261 3300025949 Unclassified 1638
404 Ga0207667_10301751 3300025949 Bacteria 1636
405 Ga0207651_10033980 3300025960 Bacteria 3296
406 Ga0207651_10045964 3300025960 Bacteria 2932
407 Ga0207651_10169729 3300025960 Bacteria 1719
408 Ga0207712_10131775 3300025961 Bacteria 1906
409 Ga0207712_10232432 3300025961 Bacteria 1481
410 Ga0207640_10034075 3300025981 Bacteria 3175
411 Ga0207640_10041102 3300025981 Bacteria 2939
412 Ga0207640_10084430 3300025981 Bacteria 2180
413 Ga0207640_10115616 3300025981 Bacteria 1911
414 Ga0207640_10163008 3300025981 Bacteria 1652
415 Ga0207658_10029737 3300025986 Bacteria 3861
416 Ga0207677_10064402 3300026023 Bacteria 2553
417 Ga0207677_10081264 3300026023 Bacteria 2325
418 Ga0207677_10112472 3300026023 Bacteria 2030
419 Ga0207677_10186464 3300026023 Bacteria 1637
420 Ga0207703_10010437 3300026035 Bacteria 7264
421 Ga0207703_10043799 3300026035 Bacteria 3594
422 Ga0207703_10132408 3300026035 Bacteria 2155
423 Ga0207703_10134447 3300026035 Bacteria 2139
424 Ga0207639_10024800 3300026041 Bacteria 4345
425 Ga0207708_10116523 3300026075 Bacteria 2078
426 Ga0207702_10000706 3300026078 Bacteria 35933
427 Ga0207702_10003164 3300026078 Bacteria 15234
428 Ga0207702_10066320 3300026078 Bacteria 3093
429 Ga0207702_10187176 3300026078 Bacteria 1910
430 Ga0207641_10001498 3300026088 Bacteria 22856
431 Ga0207641_10003104 3300026088 Bacteria 14936
432 Ga0207648_10003111 3300026089 Bacteria 17524
433 Ga0207648_10272269 3300026089 Bacteria 1513
434 Ga0207648_10302668 3300026089 Bacteria 1434
435 Ga0207676_10004805 3300026095 Bacteria 9585
436 Ga0207676_10016339 3300026095 Bacteria 5374
437 Ga0207676_10025718 3300026095 Bacteria 4370
438 Ga0207674_10000404 3300026116 Bacteria 56025
439 Ga0207674_10001934 3300026116 Bacteria 26301
440 Ga0207674_10042115 3300026116 Bacteria 4719
441 Ga0207675_100004754 3300026118 Bacteria 13078
442 Ga0207698_10045320 3300026142 Bacteria 3312
443 Ga0207698_10153455 3300026142 Bacteria 2003
444 Ga0207698_10156074 3300026142 Bacteria 1988
445 Ga0265354_1004830 3300028016 Bacteria 1392
446 Ga0268266_10016462 3300028379 Bacteria 6321
447 Ga0268265_10177579 3300028380 Bacteria 1826
448 Ga0268265_10805781 3300028380 Bacteria 916
449 Ga0268264_10050601 3300028381 Bacteria 3460
450 Ga0268264_10099018 3300028381 Bacteria 2530
451 Ga0268264_10162389 3300028381 Bacteria 2014
452 Ga0268264_10328903 3300028381 Bacteria 1448
453 Ga0268264_10503840 3300028381 Bacteria 1181
454 Ga0268264_10849198 3300028381 Bacteria 914
455 Ga0265338_10001801 3300028800 Bacteria 33703
456 Ga0265338_10004036 3300028800 Bacteria 20147
457 Ga0265338_10067628 3300028800 Bacteria 3084
458 Ga0265338_10111646 3300028800 Bacteria 2200
459 Ga0265338_10187737 3300028800 Archaea 1569
460 Ga0265762_1000399 3300030760 Bacteria 7464
461 Ga0265762_1001635 3300030760 Bacteria 4086
462 Ga0265760_10002618 3300031090 Bacteria 5263
463 Ga0265760_10008440 3300031090 Bacteria 2947
464 Ga0265760_10009400 3300031090 Unclassified 2794
465 Ga0265325_10024705 3300031241 Bacteria 3267
466 Ga0265340_10112960 3300031247 Bacteria 1254
467 Ga0265339_10017123 3300031249 Bacteria 4298
468 Ga0265339_10067041 3300031249 Bacteria 1921
469 Ga0265316_10011291 3300031344 Bacteria 8068
470 Ga0265316_10012671 3300031344 Bacteria 7548
471 Ga0265342_10014571 3300031712 Bacteria 5215
472 Ga0307416_100016898 3300032002 Bacteria 5087
473 Ga0316212_1006794 3300033547 Bacteria 1657
474 Ga0373934_0013043 3300035086 Bacteria 3139
475 Ga0373944_0011208 3300035089 Bacteria 2454
476 Ga0373936_0046881 3300035113 Bacteria 1742
477 Ga0373945_0009427 3300035116 Bacteria 3199
478 Ga0373954_0014703 3300035118 Bacteria 3492
479 Ga0373956_0025821 3300035119 Bacteria 2541
480 Ga0373957_0077315 3300035120 Bacteria 1309
481 Ga0373943_0021585 3300035170 Bacteria 2974
482 Ga0373943_0098677 3300035170 Bacteria 1524
483 Ga0373946_0017122 3300035171 Bacteria 2769
484 Ga0373955_0033922 3300035172 Bacteria 2691
485 Ga0373955_0053409 3300035172 Bacteria 2206
486 Ga0373955_0078994 3300035172 Unclassified 1855
487 Ga0373931_0010781 3300035691 Bacteria 4401
488 Ga0373931_0070307 3300035691 Bacteria 1909
489 Ga0373931_0168584 3300035691 Unclassified 1288
490 Ga0373935_0011583 3300035692 Bacteria 5295
491 Ga0373927_0008739 3300035695 Bacteria 6804
492 Ga0373927_0034888 3300035695 Bacteria 3272
493 Ga0373927_0164683 3300035695 Bacteria 1453
494 Ga0373933_0021303 3300035724 Unclassified 3681
495 Ga0373933_0274799 3300035724 Unclassified 1088
496 Ga0373947_0007813 3300035725 Bacteria 6178
497 Ga0373937_0069437 3300036401 Bacteria 3249
498 Ga0373937_0103603 3300036401 Bacteria 2643
499 Ga0373937_0186757 3300036401 Unclassified 1947
500 Ga0373937_0446187 3300036401 Bacteria 1228
501 Ga0373925_0008351 3300037068 Bacteria 7540
502 Ga0373925_0028506 3300037068 Bacteria 4091
503 Ga0373925_0070455 3300037068 Bacteria 2643
504 Ga0373925_0272976 3300037068 Bacteria 1360
505 Ga0466963_0051520 3300044694 Bacteria 2729
506 Ga0466964_0060164 3300044706 Bacteria 1579
507 Ga0453684_0565765 3300044712 Bacteria 1250
508 Ga0451576_0131333 3300045051 Bacteria 2611
509 Ga0466967_0118944 3300045976 Bacteria 2438
510 Ga0495653_0370200 3300046463 Bacteria 917
511 Ga0495580_0000461 3300046472 Bacteria 33757
512 Ga0495580_0001584 3300046472 Bacteria 19969
513 Ga0495580_0002826 3300046472 Bacteria 14924
514 Ga0495580_0004128 3300046472 Bacteria 12243
515 Ga0495580_0106525 3300046472 Bacteria 1947
516 Ga0495580_0245729 3300046472 Unclassified 1226
517 Ga0495580_0263337 3300046472 Bacteria 1179
518 Ga0495580_0331742 3300046472 Bacteria 1033
519 Ga0495582_0010448 3300046473 Bacteria 5107
520 Ga0495582_0062461 3300046473 Bacteria 2058
521 Ga0495639_0053903 3300046475 Bacteria 1833
522 Ga0495630_0065400 3300046517 Bacteria 2733
523 Ga0495630_0080798 3300046517 Bacteria 2453
524 Ga0495665_0071499 3300046531 Bacteria 1827
525 Ga0495659_0044943 3300046664 Bacteria 1590
526 Ga0495657_0224528 3300046675 Bacteria 1138
527 Ga0495599_0151072 3300046678 Bacteria 1438
528 Ga0495599_0164596 3300046678 Bacteria 1370
529 Ga0495623_0054034 3300046679 Bacteria 2535
530 Ga0495658_0015501 3300046683 Bacteria 3911
531 Ga0495624_0102345 3300046690 Bacteria 1763
532 Ga0495581_0064047 3300047315 Bacteria 2124
533 Ga0495674_0002411 3300047319 Bacteria 18293
534 Ga0495674_0193924 3300047319 Bacteria 1687
535 Ga0495674_0292308 3300047319 Bacteria 1332
536 Ga0495674_0454157 3300047319 Bacteria 1029
537 Ga0495675_0012503 3300047444 Bacteria 5343
538 Ga0495602_0187315 3300048088 Unclassified 1590
539 Ga0495602_0424654 3300048088 Bacteria 943
540 Ga0496100_0108794 3300048903 Bacteria 1923
541 Ga0496101_0159558 3300048904 Bacteria 1729
542 Ga0496101_0186336 3300048904 Bacteria 1600
543 Ga0496101_0527620 3300048904 Unclassified 933
544 Ga0496102_0041751 3300048905 Bacteria 4155
545 Ga0496102_0058217 3300048905 Bacteria 3530
546 Ga0496102_0226387 3300048905 Bacteria 1763
547 Ga0496102_0304396 3300048905 Unclassified 1502
548 Ga0496103_0015603 3300048906 Bacteria 4525
549 Ga0496103_0022099 3300048906 Bacteria 3830
550 Ga0496103_0068837 3300048906 Bacteria 2212
551 Ga0496103_0348532 3300048906 Unclassified 952
552 Ga0496104_0018558 3300048907 Bacteria 6348
553 Ga0496104_0401060 3300048907 Unclassified 1284
554 Ga0496107_0409287 3300048910 Bacteria 1009
555 Ga0496108_0000263 3300048911 Bacteria 45358
556 Ga0496108_0246036 3300048911 Bacteria 1556
557 Ga0496109_0000336 3300048912 Bacteria 43748
558 Ga0496110_0000474 3300048913 Bacteria 27301
559 Ga0496110_0113499 3300048913 Bacteria 2437
560 Ga0496110_0478006 3300048913 Unclassified 1135
561 Ga0496111_0013306 3300048914 Bacteria 5595
562 Ga0496112_0000176 3300048915 Bacteria 40747
563 Ga0496112_0000653 3300048915 Bacteria 24074
564 Ga0496112_0032108 3300048915 Bacteria 5097
565 Ga0496112_0140086 3300048915 Unclassified 2388
566 Ga0496113_0002059 3300048916 Bacteria 11556
567 Ga0496115_0009397 3300048918 Bacteria 7266
568 Ga0496115_0486016 3300048918 Bacteria 994
569 nmdc:mga0n895_124064_c1 3300050512 Bacteria 2605
570 nmdc:mga08x19_468025_c1 3300050514 Bacteria 888
571 nmdc:mga08x19_93045_c1 3300050514 Bacteria 1992
572 Ga0068871_100233230
573 MBSR1b_contig_1667589
574 JGI24743J22301_10011839
575 JGI24034J26672_10005002
576 JGI24751J29686_10002844
577 JGI24751J29686_10014944
578 Ga0065712_10092970
579 Ga0065715_10103998
580 Ga0070658_10103264
581 Ga0070658_10601893
582 Ga0070676_10018221
583 Ga0070683_100006636
584 Ga0070683_100552588
585 Ga0070690_100026005
586 Ga0070670_100049986
587 Ga0070670_100084888
588 Ga0070670_100322609
589 Ga0070670_100341156
590 Ga0070677_10038833
591 Ga0068869_100010243
592 Ga0068869_100016138
593 Ga0068869_100143743
594 Ga0068869_100160820
595 Ga0070666_10047077
596 Ga0070680_100281419
597 Ga0070682_100056772
598 Ga0068868_100003974
599 Ga0068868_100008302
600 Ga0068868_100023172
601 Ga0068868_100068237
602 Ga0068868_100110098
603 Ga0070660_100048732
604 Ga0070660_100250786
605 Ga0070689_100100777
606 Ga0070661_100003462
607 Ga0070661_100069000
608 Ga0070661_100482963
609 Ga0070692_10358889
610 Ga0070668_100007537
611 Ga0070669_100084789
612 Ga0070675_100120327
613 Ga0070671_100053714
614 Ga0070671_100114561
615 Ga0070673_100121462
616 Ga0070673_100213058
617 Ga0070688_100002427
618 Ga0070659_100029756
619 Ga0070709_10000534
620 Ga0070709_10030435
621 Ga0070709_10037009
622 Ga0070714_100000049
623 Ga0070714_100001255
624 Ga0070714_100024046
625 Ga0070714_100095703
626 Ga0070714_100263564
627 Ga0070714_100496422
628 Ga0070713_100000087
629 Ga0070713_100007643
630 Ga0070713_100024149
631 Ga0070713_100076416
632 Ga0070713_100091814
633 Ga0070713_100125962
634 Ga0070713_100683834
635 Ga0070710_10031925
636 Ga0070710_10035768
637 Ga0070711_100001138
638 Ga0070711_100180773
639 Ga0070711_100243488
640 Ga0070705_100073207
641 Ga0070700_100187132
642 Ga0070708_100031254
643 Ga0070663_100015571
644 Ga0070678_100099929
645 Ga0070678_100926712
646 Ga0070662_100339577
647 Ga0070681_10000145
648 Ga0070681_10008173
649 Ga0070681_10075138
650 Ga0070681_10080595
651 Ga0070681_10271982
652 Ga0068867_100010509
653 Ga0068867_100037913
654 Ga0068867_100137573
655 Ga0068867_100223863
656 Ga0068867_100385960
657 Ga0070685_10001679
658 Ga0070706_100001205
659 Ga0070706_100137813
660 Ga0070707_100045233
661 Ga0070699_100142930
662 Ga0070679_100005857
663 Ga0070679_100239952
664 Ga0070679_100351998
665 Ga0070679_100599052
666 Ga0070684_100041812
667 Ga0070684_100053654
668 Ga0070684_100367486
669 Ga0070697_100000581
670 Ga0068853_100004441
671 Ga0068853_100107581
672 Ga0070672_100039504
673 Ga0070672_100122977
674 Ga0070686_100020313
675 Ga0070696_100424658
676 Ga0070693_100300376
677 Ga0068855_100002457
678 Ga0068855_100004647
679 Ga0068855_100067456
680 Ga0068855_100087476
681 Ga0068855_100204983
682 Ga0070664_100041626
683 Ga0070664_100050067
684 Ga0070664_100176878
685 Ga0068857_100000103
686 Ga0068857_100001930
687 Ga0068857_100021565
688 Ga0068854_100001916
689 Ga0068854_100020557
690 Ga0068854_100098088
691 Ga0068854_100137573
692 Ga0068854_100179999
693 Ga0068854_100339791
694 Ga0068856_100000831
695 Ga0068856_100003508
696 Ga0068856_100009065
697 Ga0068856_100010929
698 Ga0068856_100014330
699 Ga0068856_100055275
700 Ga0068856_100134901
701 Ga0070702_100287469
702 Ga0068852_100012457
703 Ga0068852_100079012
704 Ga0068852_100143089
705 Ga0068859_100001596
706 Ga0068859_100007525
707 Ga0068859_100014192
708 Ga0068864_100002450
709 Ga0068864_100027441
710 Ga0068864_100095650
711 Ga0068864_100604120
712 Ga0068866_10002093
713 Ga0068866_10019039
714 Ga0068866_10082078
715 Ga0068861_100044006
716 Ga0068851_10110815
717 Ga0068851_10124247
718 Ga0068851_10202370
719 Ga0068870_10009338
720 Ga0068863_100002310
721 Ga0068863_100060169
722 Ga0068863_100104673
723 Ga0068863_100587424
724 Ga0068858_100000802
725 Ga0068858_100002301
726 Ga0068858_100032225
727 Ga0068858_100063819
728 Ga0068858_100314590
729 Ga0068860_100014344
730 Ga0068860_100111034
731 Ga0068860_100214923
732 Ga0068860_100366402
733 Ga0068862_100134326
734 Ga0068862_100270018
735 Ga0081540_1079082
736 Ga0070717_10001569
737 Ga0070717_10007306
738 Ga0070717_10052044
739 Ga0070717_10490038
740 Ga0070715_10007259
741 Ga0070715_10171964
742 Ga0070716_100000485
743 Ga0070716_100000984
744 Ga0070716_100004594
745 Ga0070716_100059429
746 Ga0070712_100002338
747 Ga0070712_100004090
748 Ga0070712_100004113
749 Ga0097621_100000186
750 Ga0097621_100001011
751 Ga0097621_100042290
752 Ga0068871_100001600
753 Ga0068871_100002219
754 Ga0068871_100094733
755 Ga0068871_100218207
756 Ga0068871_100288963
757 Ga0075433_10013160
758 Ga0075434_100019655
759 Ga0075434_100073405
760 Ga0068865_100013199
761 Ga0068865_100015956
762 Ga0068865_100020950
763 Ga0068865_100054830
764 Ga0075436_100052509
765 Ga0075436_100387232
766 Ga0097620_100001596
767 Ga0097620_100007525
768 Ga0097620_100014192
769 Ga0099794_10161108
770 Ga0099795_10250283
771 Ga0105251_10205412
772 Ga0105250_10016988
773 Ga0105250_10126699
774 Ga0105240_10027807
775 Ga0105240_10084013
776 Ga0105240_10142560
777 Ga0105240_10189240
778 Ga0105240_10498082
779 Ga0105245_10054237
780 Ga0105245_10122839
781 Ga0105245_10130224
782 Ga0105247_10002075
783 Ga0105241_10043758
784 Ga0105241_10098586
785 Ga0105241_10105005
786 Ga0105241_10196401
787 Ga0105242_10082327
788 Ga0105242_10122939
789 Ga0105242_10143755
790 Ga0105242_10229279
791 Ga0105242_10505396
792 Ga0105248_10003050
793 Ga0105248_10057600
794 Ga0105248_10079413
795 Ga0105248_10517387
796 Ga0105237_10031883
797 Ga0105237_10080488
798 Ga0105237_10154093
799 Ga0105237_10175828
800 Ga0105237_10340445
801 Ga0105237_10475625
802 Ga0105237_10524729
803 Ga0105238_10003737
804 Ga0105238_10102072
805 Ga0105238_10336602
806 Ga0105238_10348600
807 Ga0105249_10088055
808 Ga0105249_10519298
809 Ga0099796_10046516
810 Ga0099796_10115051
811 Ga0099796_10134544
812 Ga0105239_10016908
813 Ga0105239_10193936
814 Ga0105239_10366980
815 Ga0105239_10372857
816 Ga0105239_11061262
817 Ga0105246_10093345
818 Ga0157373_10052376
819 Ga0157373_10057415
820 Ga0157373_10284055
821 Ga0157371_10004537
822 Ga0157371_10216995
823 Ga0157370_10024605
824 Ga0157369_10000062
825 Ga0157369_10007201
826 Ga0157369_10035904
827 Ga0157369_10073607
828 Ga0157369_10104774
829 Ga0157369_10194282
830 Ga0157369_10318613
831 Ga0157374_10000665
832 Ga0157374_10001198
833 Ga0157374_10004088
834 Ga0157374_10010616
835 Ga0157374_10255668
836 Ga0157378_10000570
837 Ga0157378_10001319
838 Ga0157378_10019903
839 Ga0163162_10612258
840 Ga0157372_10000779
841 Ga0157372_10001078
842 Ga0157372_10001382
843 Ga0157372_10008648
844 Ga0157372_10015823
845 Ga0157372_10071045
846 Ga0157372_10088175
847 Ga0157372_10090861
848 Ga0157372_10218173
849 Ga0157375_10587059
850 Ga0157375_10596257
851 Ga0157375_11235533
852 Ga0163163_10013262
853 Ga0163163_10270999
854 Ga0163163_10449299
855 Ga0157377_10011449
856 Ga0157379_10007201
857 Ga0157379_10053258
858 Ga0157376_10001731
859 Ga0157376_10008790
860 Ga0157376_10049858
861 Ga0157376_10078099
862 Ga0157376_10137469
863 Ga0157376_10572828
864 Ga0157376_10610322
865 Ga0224570_101459
866 Ga0224569_101118
867 Ga0224572_1000012
868 Ga0224572_1005088
869 Ga0228598_1000861
870 Ga0207697_10007637
871 Ga0207656_10013461
872 Ga0207656_10084237
873 Ga0207682_10011702
874 Ga0207692_10002867
875 Ga0207692_10023474
876 Ga0207692_10053145
877 Ga0207692_10066385
878 Ga0207692_10459713
879 Ga0207642_10016277
880 Ga0207642_10095594
881 Ga0207642_10151760
882 Ga0207688_10048754
883 Ga0207680_10492292
884 Ga0207647_10007693
885 Ga0207647_10008101
886 Ga0207647_10031544
887 Ga0207647_10240790
888 Ga0207685_10032277
889 Ga0207699_10017938
890 Ga0207699_10026100
891 Ga0207699_10028413
892 Ga0207699_10080800
893 Ga0207699_10254219
894 Ga0207645_10000939
895 Ga0207643_10001563
896 Ga0207705_10119696
897 Ga0207705_10529796
898 Ga0207684_10011651
899 Ga0207684_10102514
900 Ga0207654_10023697
901 Ga0207654_10039600
902 Ga0207654_10043752
903 Ga0207707_10005993
904 Ga0207707_10006642
905 Ga0207707_10013148
906 Ga0207695_10025388
907 Ga0207695_10211967
908 Ga0207671_10412145
909 Ga0207693_10000202
910 Ga0207693_10000728
911 Ga0207693_10007587
912 Ga0207663_10000392
913 Ga0207663_10018337
914 Ga0207663_10087339
915 Ga0207663_10100611
916 Ga0207662_10002135
917 Ga0207657_10004695
918 Ga0207657_10012645
919 Ga0207649_10000355
920 Ga0207652_10032075
921 Ga0207652_10115445
922 Ga0207652_10531034
923 Ga0207652_10544872
924 Ga0207646_10042533
925 Ga0207694_10039367
926 Ga0207694_10366112
927 Ga0207650_10000884
928 Ga0207650_10223203
929 Ga0207650_10543608
930 Ga0207659_10390384
931 Ga0207687_10043594
932 Ga0207687_10078710
933 Ga0207687_10390797
934 Ga0207700_10001159
935 Ga0207700_10002031
936 Ga0207700_10013393
937 Ga0207700_10034835
938 Ga0207700_10131545
939 Ga0207700_10240867
940 Ga0207700_10282014
941 Ga0207700_10546865
942 Ga0207664_10000052
943 Ga0207664_10019370
944 Ga0207664_10415719
945 Ga0207664_10776646
946 Ga0207664_10846539
947 Ga0207644_10046702
948 Ga0207690_10371642
949 Ga0207706_10025736
950 Ga0207706_10045913
951 Ga0207686_10421237
952 Ga0207670_10073628
953 Ga0207704_10012030
954 Ga0207704_10133556
955 Ga0207665_10000707
956 Ga0207665_10005613
957 Ga0207665_10020184
958 Ga0207665_10067543
959 Ga0207665_10134977
960 Ga0207691_10002497
961 Ga0207711_10014463
962 Ga0207711_10368277
963 Ga0207711_10369304
964 Ga0207689_10000394
965 Ga0207689_10161076
966 Ga0207661_10150296
967 Ga0207661_10172466
968 Ga0207661_10401429
969 Ga0207679_10000065
970 Ga0207679_10524194
971 Ga0207667_10005137
972 Ga0207667_10009536
973 Ga0207667_10182811
974 Ga0207667_10301261
975 Ga0207667_10301751
976 Ga0207651_10033980
977 Ga0207651_10045964
978 Ga0207651_10169729
979 Ga0207712_10131775
980 Ga0207712_10232432
981 Ga0207640_10034075
982 Ga0207640_10041102
983 Ga0207640_10084430
984 Ga0207640_10115616
985 Ga0207640_10163008
986 Ga0207658_10029737
987 Ga0207677_10064402
988 Ga0207677_10081264
989 Ga0207677_10112472
990 Ga0207677_10186464
991 Ga0207703_10010437
992 Ga0207703_10043799
993 Ga0207703_10132408
994 Ga0207703_10134447
995 Ga0207639_10024800
996 Ga0207708_10116523
997 Ga0207702_10000706
998 Ga0207702_10003164
999 Ga0207702_10066320
1000 Ga0207702_10187176
1001 Ga0207641_10001498
1002 Ga0207641_10003104
1003 Ga0207648_10003111
1004 Ga0207648_10272269
1005 Ga0207648_10302668
1006 Ga0207676_10004805
1007 Ga0207676_10016339
1008 Ga0207676_10025718
1009 Ga0207674_10000404
1010 Ga0207674_10001934
1011 Ga0207674_10042115
1012 Ga0207675_100004754
1013 Ga0207698_10045320
1014 Ga0207698_10153455
1015 Ga0207698_10156074
1016 Ga0265354_1004830
1017 Ga0268266_10016462
1018 Ga0268265_10177579
1019 Ga0268265_10805781
1020 Ga0268264_10050601
1021 Ga0268264_10099018
1022 Ga0268264_10162389
1023 Ga0268264_10328903
1024 Ga0268264_10503840
1025 Ga0268264_10849198
1026 Ga0265338_10001801
1027 Ga0265338_10004036
1028 Ga0265338_10067628
1029 Ga0265338_10111646
1030 Ga0265338_10187737
1031 Ga0265762_1000399
1032 Ga0265762_1001635
1033 Ga0265760_10002618
1034 Ga0265760_10008440
1035 Ga0265760_10009400
1036 Ga0265325_10024705
1037 Ga0265340_10112960
1038 Ga0265339_10017123
1039 Ga0265339_10067041
1040 Ga0265316_10011291
1041 Ga0265316_10012671
1042 Ga0265342_10014571
1043 Ga0307416_100016898
1044 Ga0316212_1006794
1045 Ga0373934_0013043
1046 Ga0373944_0011208
1047 Ga0373936_0046881
1048 Ga0373945_0009427
1049 Ga0373954_0014703
1050 Ga0373956_0025821
1051 Ga0373957_0077315
1052 Ga0373943_0021585
1053 Ga0373943_0098677
1054 Ga0373946_0017122
1055 Ga0373955_0033922
1056 Ga0373955_0053409
1057 Ga0373955_0078994
1058 Ga0373931_0010781
1059 Ga0373931_0070307
1060 Ga0373931_0168584
1061 Ga0373935_0011583
1062 Ga0373927_0008739
1063 Ga0373927_0034888
1064 Ga0373927_0164683
1065 Ga0373933_0021303
1066 Ga0373933_0274799
1067 Ga0373947_0007813
1068 Ga0373937_0069437
1069 Ga0373937_0103603
1070 Ga0373937_0186757
1071 Ga0373937_0446187
1072 Ga0373925_0008351
1073 Ga0373925_0028506
1074 Ga0373925_0070455
1075 Ga0373925_0272976
1076 Ga0466963_0051520
1077 Ga0466964_0060164
1078 Ga0453684_0565765
1079 Ga0451576_0131333
1080 Ga0466967_0118944
1081 Ga0495653_0370200
1082 Ga0495580_0000461
1083 Ga0495580_0001584
1084 Ga0495580_0002826
1085 Ga0495580_0004128
1086 Ga0495580_0106525
1087 Ga0495580_0245729
1088 Ga0495580_0263337
1089 Ga0495580_0331742
1090 Ga0495582_0010448
1091 Ga0495582_0062461
1092 Ga0495639_0053903
1093 Ga0495630_0065400
1094 Ga0495630_0080798
1095 Ga0495665_0071499
1096 Ga0495659_0044943
1097 Ga0495657_0224528
1098 Ga0495599_0151072
1099 Ga0495599_0164596
1100 Ga0495623_0054034
1101 Ga0495658_0015501
1102 Ga0495624_0102345
1103 Ga0495581_0064047
1104 Ga0495674_0002411
1105 Ga0495674_0193924
1106 Ga0495674_0292308
1107 Ga0495674_0454157
1108 Ga0495675_0012503
1109 Ga0495602_0187315
1110 Ga0495602_0424654
1111 Ga0496100_0108794
1112 Ga0496101_0159558
1113 Ga0496101_0186336
1114 Ga0496101_0527620
1115 Ga0496102_0041751
1116 Ga0496102_0058217
1117 Ga0496102_0226387
1118 Ga0496102_0304396
1119 Ga0496103_0015603
1120 Ga0496103_0022099
1121 Ga0496103_0068837
1122 Ga0496103_0348532
1123 Ga0496104_0018558
1124 Ga0496104_0401060
1125 Ga0496107_0409287
1126 Ga0496108_0000263
1127 Ga0496108_0246036
1128 Ga0496109_0000336
1129 Ga0496110_0000474
1130 Ga0496110_0113499
1131 Ga0496110_0478006
1132 Ga0496111_0013306
1133 Ga0496112_0000176
1134 Ga0496112_0000653
1135 Ga0496112_0032108
1136 Ga0496112_0140086
1137 Ga0496113_0002059
1138 Ga0496115_0009397
1139 Ga0496115_0486016
1140 nmdc:mga0n895_124064_c1
1141 nmdc:mga08x19_468025_c1
1142 nmdc:mga08x19_93045_c1

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
6hhm-assembly1.cif.gz_A crystal structure of the family s1_7 ulvan-specific sulfatase fa22070 from formosa agariphila 0.6947 65 98
3wy4-assembly2.cif.gz_B crystal structure of alpha-glucosidase mutant e271q in complex with maltose 0.6879 69 98
5khu-assembly1.cif.gz_S model of human anaphase-promoting complex/cyclosome (apc15 deletion mutant), in complex with the mitotic checkpoint complex (apc/c-cdc20-mcc) based on cryo em data at 4.8 angstrom resolution 0.6833 154 243
6r5x-assembly1.cif.gz_A 8-bladed beta-propeller formed by four 2-bladed fragments 0.594 143 237
6r5x-assembly1.cif.gz_A 8-bladed beta-propeller formed by four 2-bladed fragments 0.5531 143 237
ID Description Score Start End Superfamily
1jyoD00 Alpha Beta;2-Layer Sandwich;Yope Regulator; Chain: A,; 0.7777 72 97 3.30.1460.10
af_A4I269_240_411_2.40.128.630 Mainly Beta;Beta Barrel;Lipocalin; 0.6906 173 243 2.40.128.630
af_Q8IDZ2_478_587_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.6756 155 237 2.130.10.10
af_Q2G105_122_189_3.10.450.40 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.6434 81 106 3.10.450.40
af_A0A1D6MMF1_100_345_3.60.21.10 Alpha Beta;4-Layer Sandwich;Purple Acid Phosphatase; chain A, domain 2;Metallo-dependent phosphatases 0.6193 81 106 3.60.21.10
ID Description Score Start End GO Terms
AF-A0A2V9VKF0-F1-model_v4 Uncharacterized protein 0.9776 1 244
AF-A0A2V9VKF0-F1-model_v4 Uncharacterized protein 0.9736 1 244
AF-A0A2V9Y442-F1-model_v4 Uncharacterized protein 0.9636 58 242
AF-A0A2V9T5W5-F1-model_v4 Uncharacterized protein 0.9605 129 245
AF-A0A2V9Y442-F1-model_v4 Uncharacterized protein 0.9535 58 242

Map