F464915

General Info

Members Datasets Scaffolds Average Seq Length
571 269 1142 303

Family's Representative Sequence

Representative Sequence 3300005436|Ga0070713_100038301|Ga0070713_1000383012
Length 348
Sequence VEHRIVDSGQNWPAVVAGTLGFVSAGKLVDFEQPVACNAEERRSNSMTKLRSMHDAIAEFVPDGASVALGLQLEQMIPFAAGHEIIRQRKRGLTLIGPISDILFDQLIGAGSVEKVIAAWVGNVMMGSAYNFRRAVEQDGMKVFNMTNFTLALALQAGAMGVPFLPTKSALGTDTVKGNHFFYQIFSPFEPKASLWAVRALNPDVTIVHVQRADAEGNAHCWGNLGVMIDGVRAAKRVIVVAEEIVESKVISSDPNRTVVPGFLVNAVVQCRYGAHPSPVQGYYNRDDDFFREYHAETKTKDNSNTWLRDWVYSLPDRQAYIEQLGTDRIEALGVKQHAYAAQADFGY

Samples

Sample ID Description Type Environment
1 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
2 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
11 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
12 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
13 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
14 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
15 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
16 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
17 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
18 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
19 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
20 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
21 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
22 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
23 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
24 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
25 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
26 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
27 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
28 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
29 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
30 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
31 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
32 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
33 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
34 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
35 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
36 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
37 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
38 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
39 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
40 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
41 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
42 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
43 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
44 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
45 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
46 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
47 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
48 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
49 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
50 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
51 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
52 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
53 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
54 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
55 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
56 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
57 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
58 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
59 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
60 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
61 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
62 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
63 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
64 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
65 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
66 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
67 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
68 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
69 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
70 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
71 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
72 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
73 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
74 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
75 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
76 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
77 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
78 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
79 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
80 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
81 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
82 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
83 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
84 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
85 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
86 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
87 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
88 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
89 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
90 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
91 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
92 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
93 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
94 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
95 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
96 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
97 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
98 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
138 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
140 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
141 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
142 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
143 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
147 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
148 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
149 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
150 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
151 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
152 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
153 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
154 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
155 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
156 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
157 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
158 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
159 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
160 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
161 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
162 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
163 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
164 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
165 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
166 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
167 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
168 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
169 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
170 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
171 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
172 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
173 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
174 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
175 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
176 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
177 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
178 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
179 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
180 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
181 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
182 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
183 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
184 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
185 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
186 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
187 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
188 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
189 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
190 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
191 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
192 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
193 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
194 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
195 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
196 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
197 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
198 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
199 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
200 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
201 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
202 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
203 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
204 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
205 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
206 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
207 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
208 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
209 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
210 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
211 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
212 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
213 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
214 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
215 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
216 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
217 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
218 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
219 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
220 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
221 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
222 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
223 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
224 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
225 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
226 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
227 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
228 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
229 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
230 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
231 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
232 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
233 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
234 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
235 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
236 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
237 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
238 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
239 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
240 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
241 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
242 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
243 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
244 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
245 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
246 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
247 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
248 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
249 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
250 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
251 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
252 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
253 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
254 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
255 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
256 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
257 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
258 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
259 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
260 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
261 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
262 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
263 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
264 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
265 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
266 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
267 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
268 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
269 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.95
Metatranscriptomes 1.05
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.18
Nodule 0
Rhizoplane 2.98
Rhizosphere 95.62
Stem 0
Stem Tuber 0
Unclassified 13.66

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070713_100038301 3300005436 Unclassified 3883
2 Ga0070676_10042985 3300005328 Bacteria 2625
3 Ga0070683_100001503 3300005329 Bacteria 18008
4 Ga0070683_100005102 3300005329 Bacteria 10918
5 Ga0070683_100010525 3300005329 Bacteria 7953
6 Ga0070683_100094960 3300005329 Bacteria 2803
7 Ga0070670_100001981 3300005331 Bacteria 16744
8 Ga0068869_100000619 3300005334 Bacteria 20073
9 Ga0068869_100002683 3300005334 Bacteria 10761
10 Ga0070666_10004600 3300005335 Bacteria 8413
11 Ga0070666_10085279 3300005335 Bacteria 2163
12 Ga0070680_100001842 3300005336 Bacteria 15564
13 Ga0070680_100021324 3300005336 Bacteria 5148
14 Ga0070682_100001799 3300005337 Bacteria 11974
15 Ga0070660_100000532 3300005339 Bacteria 25430
16 Ga0070689_100055015 3300005340 Bacteria 3082
17 Ga0070691_10007582 3300005341 Unclassified 4976
18 Ga0070691_10008060 3300005341 Bacteria 4821
19 Ga0070687_100035713 3300005343 Bacteria 2471
20 Ga0070661_100014038 3300005344 Bacteria 5635
21 Ga0070692_10009048 3300005345 Bacteria 4472
22 Ga0070692_10149504 3300005345 Unclassified 1329
23 Ga0070659_100021761 3300005366 Bacteria 4888
24 Ga0070667_100037411 3300005367 Bacteria 4069
25 Ga0070703_10010014 3300005406 Bacteria 2674
26 Ga0070709_10020978 3300005434 Bacteria 3801
27 Ga0070709_10118730 3300005434 Bacteria 1789
28 Ga0070714_100012215 3300005435 Bacteria 6848
29 Ga0070714_100036203 3300005435 Unclassified 4139
30 Ga0070713_100002382 3300005436 Bacteria 12252
31 Ga0070713_100318049 3300005436 Bacteria 1437
32 Ga0070710_10040915 3300005437 Bacteria 2556
33 Ga0070710_10090489 3300005437 Bacteria 1804
34 Ga0070701_10042188 3300005438 Bacteria 2328
35 Ga0070711_100000643 3300005439 Bacteria 18208
36 Ga0070711_100449304 3300005439 Bacteria 1055
37 Ga0070694_100000441 3300005444 Bacteria 22636
38 Ga0070694_100008318 3300005444 Bacteria 6345
39 Ga0070694_100009005 3300005444 Bacteria 6115
40 Ga0070708_100007984 3300005445 Bacteria 8478
41 Ga0070708_100020435 3300005445 Bacteria 5583
42 Ga0070708_100061969 3300005445 Unclassified 3343
43 Ga0070708_100066550 3300005445 Bacteria 3234
44 Ga0070708_100067520 3300005445 Bacteria 3211
45 Ga0070708_100082375 3300005445 Bacteria 2914
46 Ga0070708_100324321 3300005445 Bacteria 1451
47 Ga0070708_100392094 3300005445 Bacteria 1309
48 Ga0070663_100087010 3300005455 Bacteria 2309
49 Ga0070662_100067823 3300005457 Bacteria 2620
50 Ga0070681_10173334 3300005458 Bacteria 2079
51 Ga0068867_100028268 3300005459 Bacteria 4037
52 Ga0070706_100005714 3300005467 Bacteria 11829
53 Ga0070706_100012898 3300005467 Bacteria 7735
54 Ga0070706_100018778 3300005467 Bacteria 6375
55 Ga0070706_100020656 3300005467 Bacteria 6068
56 Ga0070706_100033697 3300005467 Bacteria 4728
57 Ga0070706_100059653 3300005467 Bacteria 3522
58 Ga0070706_100064717 3300005467 Bacteria 3380
59 Ga0070706_100065985 3300005467 Unclassified 3348
60 Ga0070706_100096508 3300005467 Bacteria 2744
61 Ga0070706_100102026 3300005467 Unclassified 2667
62 Ga0070706_100332167 3300005467 Unclassified 1417
63 Ga0070706_100573227 3300005467 Bacteria 1049
64 Ga0070707_100004097 3300005468 Bacteria 13686
65 Ga0070707_100004450 3300005468 Bacteria 13124
66 Ga0070707_100006594 3300005468 Bacteria 10772
67 Ga0070707_100011270 3300005468 Bacteria 8334
68 Ga0070707_100024320 3300005468 Bacteria 5737
69 Ga0070707_100037629 3300005468 Bacteria 4619
70 Ga0070707_100062483 3300005468 Bacteria 3572
71 Ga0070707_100271227 3300005468 Bacteria 1650
72 Ga0070707_100419545 3300005468 Bacteria 1298
73 Ga0070698_100000216 3300005471 Bacteria 56257
74 Ga0070698_100005218 3300005471 Bacteria 14207
75 Ga0070698_100010733 3300005471 Bacteria 9749
76 Ga0070698_100023375 3300005471 Bacteria 6462
77 Ga0070698_100025519 3300005471 Bacteria 6160
78 Ga0070698_100050366 3300005471 Bacteria 4247
79 Ga0070698_100086207 3300005471 Bacteria 3126
80 Ga0070698_100113862 3300005471 Bacteria 2670
81 Ga0070699_100002495 3300005518 Bacteria 16526
82 Ga0070699_100028195 3300005518 Unclassified 4842
83 Ga0070699_100050653 3300005518 Bacteria 3596
84 Ga0070699_100055261 3300005518 Bacteria 3438
85 Ga0070699_100069924 3300005518 Bacteria 3051
86 Ga0070699_100175518 3300005518 Unclassified 1900
87 Ga0070699_100194986 3300005518 Bacteria 1800
88 Ga0070679_100006281 3300005530 Bacteria 11060
89 Ga0070684_100000079 3300005535 Bacteria 63157
90 Ga0070684_100263584 3300005535 Bacteria 1576
91 Ga0070697_100004286 3300005536 Bacteria 10940
92 Ga0070697_100007024 3300005536 Bacteria 8752
93 Ga0070697_100010681 3300005536 Bacteria 7166
94 Ga0070697_100012026 3300005536 Bacteria 6775
95 Ga0070697_100044008 3300005536 Bacteria 3616
96 Ga0070697_100051458 3300005536 Bacteria 3346
97 Ga0070697_100060284 3300005536 Bacteria 3092
98 Ga0070697_100060916 3300005536 Unclassified 3077
99 Ga0070697_100092115 3300005536 Bacteria 2507
100 Ga0070697_100093485 3300005536 Bacteria 2490
101 Ga0070697_100097404 3300005536 Bacteria 2441
102 Ga0070697_100122135 3300005536 Bacteria 2179
103 Ga0070697_100190806 3300005536 Unclassified 1739
104 Ga0070697_100206645 3300005536 Bacteria 1670
105 Ga0070672_100336413 3300005543 Unclassified 1285
106 Ga0070695_100005717 3300005545 Bacteria 7329
107 Ga0070695_100024844 3300005545 Bacteria 3695
108 Ga0070696_100005036 3300005546 Bacteria 8829
109 Ga0070696_100104056 3300005546 Bacteria 2038
110 Ga0070696_100280725 3300005546 Bacteria 1269
111 Ga0070693_100001564 3300005547 Bacteria 10334
112 Ga0070693_100036758 3300005547 Bacteria 2725
113 Ga0070693_100191076 3300005547 Bacteria 1324
114 Ga0070665_100490692 3300005548 Bacteria 1239
115 Ga0070704_100030384 3300005549 Bacteria 3620
116 Ga0070704_100077404 3300005549 Bacteria 2436
117 Ga0068855_100087960 3300005563 Bacteria 3589
118 Ga0068855_100179072 3300005563 Bacteria 2397
119 Ga0070664_100017761 3300005564 Bacteria 5844
120 Ga0068857_100088000 3300005577 Bacteria 2779
121 Ga0068854_100041121 3300005578 Bacteria 3265
122 Ga0068854_100154834 3300005578 Bacteria 1770
123 Ga0068854_100506208 3300005578 Bacteria 1018
124 Ga0068856_100005843 3300005614 Bacteria 12127
125 Ga0068859_100000957 3300005617 Bacteria 29559
126 Ga0068864_100016567 3300005618 Bacteria 6135
127 Ga0068866_10018847 3300005718 Bacteria 3130
128 Ga0068861_100044935 3300005719 Bacteria 3324
129 Ga0068861_100197021 3300005719 Bacteria 1688
130 Ga0068870_10000791 3300005840 Bacteria 12233
131 Ga0068863_100022800 3300005841 Bacteria 5981
132 Ga0068858_100050440 3300005842 Bacteria 3852
133 Ga0068860_100019924 3300005843 Bacteria 6504
134 Ga0068860_100037240 3300005843 Bacteria 4656
135 Ga0068860_100075304 3300005843 Bacteria 3210
136 Ga0068862_100012970 3300005844 Bacteria 6894
137 Ga0068862_100014573 3300005844 Bacteria 6527
138 Ga0068862_100017226 3300005844 Bacteria 6013
139 Ga0081455_10000904 3300005937 Bacteria 38181
140 Ga0081539_10003285 3300005985 Bacteria 20262
141 Ga0070717_10001253 3300006028 Bacteria 17309
142 Ga0070717_10003937 3300006028 Bacteria 10686
143 Ga0070717_10004550 3300006028 Bacteria 10032
144 Ga0070717_10043172 3300006028 Unclassified 3679
145 Ga0070717_10075277 3300006028 Bacteria 2823
146 Ga0070717_10084145 3300006028 Bacteria 2676
147 Ga0070715_10016378 3300006163 Bacteria 2784
148 Ga0070716_100019618 3300006173 Bacteria 3536
149 Ga0070716_100034833 3300006173 Bacteria 2763
150 Ga0070712_100000375 3300006175 Bacteria 25335
151 Ga0070712_100214578 3300006175 Unclassified 1520
152 Ga0097621_100003363 3300006237 Bacteria 11005
153 Ga0097621_100036181 3300006237 Unclassified 3949
154 Ga0068871_100007466 3300006358 Bacteria 7817
155 Ga0068871_100039964 3300006358 Unclassified 3756
156 Ga0075428_100131672 3300006844 Bacteria 2720
157 Ga0075433_10010766 3300006852 Bacteria 7355
158 Ga0075433_10033505 3300006852 Bacteria 4404
159 Ga0075433_10035345 3300006852 Bacteria 4296
160 Ga0075433_10039341 3300006852 Bacteria 4088
161 Ga0075433_10056408 3300006852 Bacteria 3431
162 Ga0075434_100000460 3300006871 Bacteria 30424
163 Ga0075434_100005054 3300006871 Bacteria 11979
164 Ga0075434_100063855 3300006871 Bacteria 3665
165 Ga0075434_100069922 3300006871 Bacteria 3500
166 Ga0075434_100074948 3300006871 Bacteria 3377
167 Ga0075434_100355341 3300006871 Unclassified 1486
168 Ga0068865_100126534 3300006881 Bacteria 1908
169 Ga0068865_100214442 3300006881 Bacteria 1502
170 Ga0075436_100002862 3300006914 Bacteria 11817
171 Ga0075436_100039997 3300006914 Bacteria 3235
172 Ga0075436_100043168 3300006914 Bacteria 3109
173 Ga0075436_100057002 3300006914 Bacteria 2698
174 Ga0075436_100075952 3300006914 Bacteria 2326
175 Ga0075436_100104710 3300006914 Bacteria 1972
176 Ga0075436_100120600 3300006914 Viruses 1835
177 Ga0097620_100000957 3300006931 Bacteria 29559
178 Ga0075435_100000141 3300007076 Bacteria 40680
179 Ga0075435_100031772 3300007076 Bacteria 4163
180 Ga0099794_10031251 3300007265 Bacteria 2492
181 Ga0099795_10003003 3300007788 Bacteria 4104
182 Ga0111539_10000370 3300009094 Bacteria 55548
183 Ga0111539_10174680 3300009094 Bacteria 2509
184 Ga0105245_10004304 3300009098 Bacteria 12603
185 Ga0114129_10045814 3300009147 Bacteria 6147
186 Ga0114129_10046682 3300009147 Bacteria 6087
187 Ga0114129_10105476 3300009147 Bacteria 3895
188 Ga0114129_10169778 3300009147 Bacteria 2974
189 Ga0114129_10238356 3300009147 Bacteria 2446
190 Ga0114129_10248038 3300009147 Bacteria 2391
191 Ga0114129_10318075 3300009147 Bacteria 2070
192 Ga0105243_10353073 3300009148 Bacteria 1351
193 Ga0105241_10000218 3300009174 Bacteria 43050
194 Ga0105241_10006873 3300009174 Bacteria 8371
195 Ga0105242_10032204 3300009176 Bacteria 4192
196 Ga0105242_10147840 3300009176 Bacteria 2046
197 Ga0105248_10449902 3300009177 Bacteria 1451
198 Ga0105248_10519309 3300009177 Bacteria 1343
199 Ga0105239_10537862 3300010375 Bacteria 1330
200 Ga0157373_10001408 3300013100 Bacteria 18402
201 Ga0157373_10007492 3300013100 Bacteria 8119
202 Ga0157371_10134641 3300013102 Bacteria 1759
203 Ga0157370_10459572 3300013104 Bacteria 1170
204 Ga0157369_10002071 3300013105 Bacteria 24228
205 Ga0157369_10020275 3300013105 Bacteria 7431
206 Ga0157369_10025517 3300013105 Bacteria 6560
207 Ga0157369_10199411 3300013105 Bacteria 2101
208 Ga0157369_10459252 3300013105 Bacteria 1319
209 Ga0157374_10007456 3300013296 Bacteria 9330
210 Ga0157374_10136762 3300013296 Bacteria 2376
211 Ga0157378_10000353 3300013297 Bacteria 45114
212 Ga0157378_10076698 3300013297 Unclassified 3012
213 Ga0163162_10041473 3300013306 Bacteria 4606
214 Ga0163162_10055761 3300013306 Bacteria 3980
215 Ga0163162_10348101 3300013306 Bacteria 1614
216 Ga0157372_10006021 3300013307 Bacteria 12878
217 Ga0157372_10008074 3300013307 Bacteria 11196
218 Ga0157372_10129657 3300013307 Bacteria 2900
219 Ga0157372_10203177 3300013307 Bacteria 2295
220 Ga0157372_10271629 3300013307 Bacteria 1970
221 Ga0157372_10380835 3300013307 Bacteria 1644
222 Ga0157375_10127588 3300013308 Bacteria 2660
223 Ga0163163_10056281 3300014325 Bacteria 3887
224 Ga0157379_10067639 3300014968 Bacteria 3193
225 Ga0157379_10201814 3300014968 Bacteria 1798
226 Ga0157376_10047446 3300014969 Unclassified 3546
227 Ga0206356_10913527 3300020070 Bacteria 2537
228 Ga0213873_10004051 3300021358 Bacteria 2699
229 Ga0213874_10049333 3300021377 Bacteria 1286
230 Ga0224712_10001822 3300022467 Bacteria 5095
231 Ga0224712_10003117 3300022467 Bacteria 4238
232 Ga0228598_1000003 3300024227 Bacteria 33664
233 Ga0207653_10012609 3300025885 Bacteria 2640
234 Ga0207688_10068077 3300025901 Bacteria 2015
235 Ga0207680_10017814 3300025903 Bacteria 3761
236 Ga0207699_10267156 3300025906 Bacteria 1184
237 Ga0207645_10080353 3300025907 Bacteria 2090
238 Ga0207643_10006754 3300025908 Bacteria 6154
239 Ga0207684_10001497 3300025910 Bacteria 25099
240 Ga0207684_10001957 3300025910 Bacteria 21321
241 Ga0207684_10005523 3300025910 Bacteria 11649
242 Ga0207684_10016804 3300025910 Bacteria 6282
243 Ga0207684_10017119 3300025910 Bacteria 6222
244 Ga0207684_10038255 3300025910 Bacteria 4071
245 Ga0207684_10060081 3300025910 Bacteria 3228
246 Ga0207684_10086148 3300025910 Unclassified 2675
247 Ga0207684_10099475 3300025910 Bacteria 2484
248 Ga0207684_10153017 3300025910 Bacteria 1985
249 Ga0207684_10155825 3300025910 Bacteria 1966
250 Ga0207684_10201644 3300025910 Unclassified 1716
251 Ga0207684_10215775 3300025910 Unclassified 1655
252 Ga0207654_10217017 3300025911 Unclassified 1267
253 Ga0207654_10232616 3300025911 Bacteria 1228
254 Ga0207707_10214560 3300025912 Bacteria 1676
255 Ga0207695_10071491 3300025913 Bacteria 3544
256 Ga0207671_10141125 3300025914 Bacteria 1856
257 Ga0207671_10339626 3300025914 Unclassified 1190
258 Ga0207693_10000214 3300025915 Bacteria 53256
259 Ga0207693_10070466 3300025915 Bacteria 2736
260 Ga0207693_10121225 3300025915 Unclassified 2054
261 Ga0207663_10001065 3300025916 Bacteria 12581
262 Ga0207662_10028212 3300025918 Bacteria 3244
263 Ga0207662_10067405 3300025918 Bacteria 2158
264 Ga0207657_10000373 3300025919 Bacteria 47375
265 Ga0207652_10001053 3300025921 Bacteria 25164
266 Ga0207646_10000005 3300025922 Bacteria 523896
267 Ga0207646_10000549 3300025922 Bacteria 49403
268 Ga0207646_10000601 3300025922 Bacteria 46850
269 Ga0207646_10001233 3300025922 Bacteria 32128
270 Ga0207646_10001458 3300025922 Bacteria 29273
271 Ga0207646_10001695 3300025922 Bacteria 26787
272 Ga0207646_10017312 3300025922 Bacteria 6748
273 Ga0207646_10032435 3300025922 Bacteria 4727
274 Ga0207646_10033417 3300025922 Bacteria 4654
275 Ga0207646_10037370 3300025922 Bacteria 4378
276 Ga0207646_10041512 3300025922 Bacteria 4136
277 Ga0207646_10074926 3300025922 Bacteria 3023
278 Ga0207650_10022868 3300025925 Bacteria 4429
279 Ga0207659_10337675 3300025926 Bacteria 1247
280 Ga0207700_10021468 3300025928 Unclassified 4409
281 Ga0207700_10053835 3300025928 Bacteria 3017
282 Ga0207700_10181019 3300025928 Bacteria 1765
283 Ga0207700_10542830 3300025928 Bacteria 1031
284 Ga0207664_10008619 3300025929 Bacteria 7128
285 Ga0207664_10018226 3300025929 Bacteria 5162
286 Ga0207664_10319571 3300025929 Bacteria 1369
287 Ga0207664_10425930 3300025929 Unclassified 1183
288 Ga0207706_10045512 3300025933 Bacteria 3888
289 Ga0207706_10082438 3300025933 Bacteria 2827
290 Ga0207706_10149025 3300025933 Bacteria 2058
291 Ga0207709_10256383 3300025935 Bacteria 1280
292 Ga0207665_10003305 3300025939 Bacteria 10804
293 Ga0207665_10018994 3300025939 Bacteria 4515
294 Ga0207665_10072850 3300025939 Unclassified 2348
295 Ga0207665_10267048 3300025939 Unclassified 1269
296 Ga0207691_10133762 3300025940 Unclassified 2189
297 Ga0207711_10381518 3300025941 Bacteria 1308
298 Ga0207689_10004821 3300025942 Bacteria 12165
299 Ga0207689_10203959 3300025942 Bacteria 1633
300 Ga0207661_10001886 3300025944 Bacteria 14358
301 Ga0207679_10000709 3300025945 Bacteria 22225
302 Ga0207712_10034644 3300025961 Bacteria 3422
303 Ga0207658_10373194 3300025986 Bacteria 1248
304 Ga0207677_10004536 3300026023 Bacteria 7470
305 Ga0207677_10029760 3300026023 Bacteria 3475
306 Ga0207639_10168682 3300026041 Bacteria 1851
307 Ga0207702_10044826 3300026078 Bacteria 3718
308 Ga0207702_10333769 3300026078 Bacteria 1447
309 Ga0207702_10552332 3300026078 Bacteria 1127
310 Ga0207641_10014982 3300026088 Bacteria 6356
311 Ga0207641_10121859 3300026088 Bacteria 2328
312 Ga0207648_10041311 3300026089 Bacteria 4050
313 Ga0207676_10145989 3300026095 Unclassified 2032
314 Ga0207674_10001794 3300026116 Bacteria 27378
315 Ga0207674_10002853 3300026116 Bacteria 21468
316 Ga0207675_100007787 3300026118 Bacteria 10103
317 Ga0207675_100013748 3300026118 Bacteria 7551
318 Ga0207675_100034069 3300026118 Bacteria 4746
319 Ga0209983_1003429 3300027665 Bacteria 3389
320 Ga0209588_1000731 3300027671 Bacteria 8291
321 Ga0209971_1000031 3300027682 Bacteria 50315
322 Ga0209966_1000566 3300027695 Bacteria 9168
323 Ga0209998_10002477 3300027717 Bacteria 4220
324 Ga0207428_10000409 3300027907 Bacteria 53318
325 Ga0207428_10162280 3300027907 Bacteria 1696
326 Ga0268266_10399504 3300028379 Bacteria 1299
327 Ga0268265_10045939 3300028380 Bacteria 3262
328 Ga0268265_10125992 3300028380 Unclassified 2119
329 Ga0268264_10071494 3300028381 Bacteria 2940
330 Ga0265338_10011560 3300028800 Bacteria 10178
331 Ga0265338_10102608 3300028800 Bacteria 2326
332 Ga0265338_10102896 3300028800 Bacteria 2321
333 Ga0265770_1001661 3300030878 Bacteria 3047
334 Ga0265760_10003570 3300031090 Bacteria 4512
335 Ga0265760_10074889 3300031090 Bacteria 1042
336 Ga0316575_10008083 3300031665 Bacteria 3824
337 Ga0316575_10023577 3300031665 Bacteria 2379
338 Ga0316579_10005729 3300031691 Bacteria 5032
339 Ga0316579_10026698 3300031691 Bacteria 2616
340 Ga0316576_10009662 3300031727 Bacteria 6240
341 Ga0316576_10052016 3300031727 Unclassified 2982
342 Ga0316576_10059114 3300031727 Unclassified 2805
343 Ga0316576_10074464 3300031727 Unclassified 2510
344 Ga0316576_10154674 3300031727 Bacteria 1728
345 Ga0316578_10023291 3300031728 Bacteria 3464
346 Ga0316578_10031147 3300031728 Unclassified 3037
347 Ga0316578_10051138 3300031728 Bacteria 2419
348 Ga0316577_10016450 3300031733 Bacteria 4077
349 Ga0316577_10087343 3300031733 Bacteria 1745
350 Ga0316577_10133963 3300031733 Unclassified 1394
351 Ga0307413_10242396 3300031824 Bacteria 1332
352 Ga0307413_10248772 3300031824 Bacteria 1317
353 Ga0307410_10001016 3300031852 Bacteria 12153
354 Ga0307410_10061557 3300031852 Bacteria 2569
355 Ga0307410_10240606 3300031852 Bacteria 1402
356 Ga0307409_100075981 3300031995 Bacteria 2692
357 Ga0307416_100009766 3300032002 Bacteria 6306
358 Ga0307416_100042648 3300032002 Unclassified 3544
359 Ga0307411_10061816 3300032005 Bacteria 2495
360 Ga0316580_10012619 3300032139 Bacteria 2575
361 Ga0316580_10027892 3300032139 Bacteria 1744
362 Ga0316580_10037442 3300032139 Bacteria 1500
363 Ga0373948_0013143 3300034817 Bacteria 1490
364 Ga0373926_0029796 3300035083 Bacteria 1919
365 Ga0373949_0001880 3300035090 Bacteria 5695
366 Ga0373923_0003716 3300035111 Bacteria 4942
367 Ga0373936_0002742 3300035113 Bacteria 6560
368 Ga0373954_0002947 3300035118 Bacteria 7179
369 Ga0373956_0000112 3300035119 Bacteria 27904
370 Ga0316574_0036228 3300035398 Bacteria 3019
371 Ga0316574_0045602 3300035398 Bacteria 2715
372 Ga0373924_0095197 3300035410 Unclassified 1277
373 Ga0373931_0081812 3300035691 Bacteria 1784
374 Ga0373935_0028232 3300035692 Bacteria 3468
375 Ga0373935_0208156 3300035692 Unclassified 1354
376 Ga0373927_0000163 3300035695 Bacteria 52049
377 Ga0373933_0131896 3300035724 Bacteria 1572
378 Ga0373947_0044113 3300035725 Bacteria 2664
379 Ga0373947_0065898 3300035725 Unclassified 2210
380 Ga0373937_0006752 3300036401 Bacteria 9903
381 Ga0373937_0021766 3300036401 Bacteria 5755
382 Ga0373937_0070339 3300036401 Bacteria 3228
383 Ga0316582_0001462 3300036647 Bacteria 10383
384 Ga0316582_0015139 3300036647 Bacteria 4399
385 Ga0316582_0137443 3300036647 Bacteria 1645
386 Ga0316584_0018095 3300036712 Bacteria 5080
387 Ga0316584_0079947 3300036712 Bacteria 2449
388 Ga0316584_0135087 3300036712 Bacteria 1841
389 Ga0316584_0230674 3300036712 Bacteria 1357
390 Ga0373925_0065351 3300037068 Unclassified 2740
391 Ga0373925_0217584 3300037068 Bacteria 1524
392 Ga0395905_0023199 3300037471 Bacteria 5865
393 Ga0395905_0075933 3300037471 Unclassified 3149
394 Ga0400489_14542 3300039093 Bacteria 67753
395 Ga0436365_0520453 3300039437 Unclassified 2013
396 Ga0436365_0616185 3300039437 Bacteria 3067
397 Ga0436363_0158073 3300039450 Bacteria 3969
398 Ga0436363_0616842 3300039450 Unclassified 1058
399 Ga0436363_1598903 3300039450 Bacteria 8370
400 Ga0436362_0204128 3300039453 Bacteria 5387
401 Ga0436362_0291038 3300039453 Bacteria 2435
402 Ga0439448_0008988 3300042005 Bacteria 2936
403 Ga0439448_0068342 3300042005 Unclassified 1181
404 Ga0439458_0001620 3300042157 Bacteria 5621
405 Ga0439460_0000326 3300042461 Bacteria 10035
406 Ga0451577_0000215 3300042876 Bacteria 120190
407 Ga0451577_0003242 3300042876 Bacteria 18293
408 Ga0451577_0042844 3300042876 Bacteria 4056
409 Ga0451577_0058833 3300042876 Bacteria 3426
410 Ga0451577_0095454 3300042876 Bacteria 2655
411 Ga0451577_0100299 3300042876 Bacteria 2586
412 Ga0451577_0526460 3300042876 Bacteria 1073
413 Ga0453683_0011496 3300044673 Bacteria 5831
414 Ga0453683_0016214 3300044673 Bacteria 4813
415 Ga0453683_0024938 3300044673 Bacteria 3800
416 Ga0453683_0056964 3300044673 Bacteria 2446
417 Ga0466966_0079164 3300044684 Bacteria 2049
418 Ga0453684_0000698 3300044712 Bacteria 119496
419 Ga0453684_0047011 3300044712 Bacteria 5730
420 Ga0453684_0050388 3300044712 Bacteria 5478
421 Ga0453684_0061179 3300044712 Bacteria 4836
422 Ga0453684_0427652 3300044712 Unclassified 1478
423 Ga0466968_0036895 3300044735 Unclassified 2049
424 Ga0466957_0049755 3300044842 Unclassified 2549
425 Ga0451576_0015980 3300045051 Bacteria 8297
426 Ga0451576_0022226 3300045051 Bacteria 6881
427 Ga0451576_0042455 3300045051 Bacteria 4800
428 Ga0451576_0124087 3300045051 Bacteria 2690
429 Ga0451576_0174868 3300045051 Bacteria 2241
430 Ga0451576_0216254 3300045051 Bacteria 2001
431 Ga0451576_0230921 3300045051 Bacteria 1932
432 Ga0451576_0362479 3300045051 Unclassified 1518
433 Ga0466967_0054355 3300045976 Unclassified 3523
434 Ga0466967_0161591 3300045976 Bacteria 2103
435 Ga0495651_0003194 3300046462 Bacteria 12599
436 Ga0495653_0006087 3300046463 Bacteria 9883
437 Ga0495580_0004280 3300046472 Bacteria 12001
438 Ga0495580_0009817 3300046472 Bacteria 7508
439 Ga0495580_0015856 3300046472 Bacteria 5672
440 Ga0495580_0026747 3300046472 Bacteria 4202
441 Ga0495580_0029664 3300046472 Unclassified 3969
442 Ga0495580_0065318 3300046472 Bacteria 2549
443 Ga0495580_0125263 3300046472 Bacteria 1783
444 Ga0495608_0005084 3300046511 Bacteria 9397
445 Ga0495608_0013110 3300046511 Bacteria 5754
446 Ga0495628_0003107 3300046516 Bacteria 14892
447 Ga0495630_0022447 3300046517 Unclassified 4660
448 Ga0495630_0053130 3300046517 Unclassified 3033
449 Ga0495666_0004105 3300046526 Bacteria 7354
450 Ga0495665_0007815 3300046531 Bacteria 5785
451 Ga0495640_0337838 3300046533 Unclassified 931
452 Ga0495586_0002626 3300046535 Bacteria 9721
453 Ga0495587_0010414 3300046536 Bacteria 5920
454 Ga0495667_0024378 3300046559 Unclassified 4074
455 Ga0495667_0240071 3300046559 Unclassified 1154
456 Ga0495635_0035017 3300046663 Unclassified 3481
457 Ga0495657_0043231 3300046675 Unclassified 3073
458 Ga0495623_0003279 3300046679 Bacteria 10684
459 Ga0495658_0113842 3300046683 Bacteria 1629
460 Ga0495613_0021784 3300046689 Unclassified 4776
461 Ga0495613_0064288 3300046689 Unclassified 2684
462 Ga0495624_0020322 3300046690 Unclassified 4422
463 Ga0495600_0029979 3300046809 Unclassified 3524
464 Ga0495604_0016330 3300047317 Bacteria 5933
465 Ga0495604_0139919 3300047317 Unclassified 1730
466 Ga0495674_0056792 3300047319 Bacteria 3427
467 Ga0495674_0383560 3300047319 Bacteria 1137
468 Ga0495676_0094092 3300047321 Unclassified 2233
469 Ga0495680_0132546 3300047322 Unclassified 1830
470 Ga0495675_0001125 3300047444 Bacteria 16254
471 Ga0495684_0003957 3300047471 Bacteria 11549
472 Ga0495684_0007061 3300047471 Bacteria 8717
473 Ga0495593_0014865 3300047673 Unclassified 4421
474 Ga0495602_0084381 3300048088 Bacteria 2658
475 Ga0495602_0106675 3300048088 Bacteria 2286
476 Ga0495602_0107092 3300048088 Bacteria 2280
477 Ga0495614_0021396 3300048089 Unclassified 2793
478 Ga0496100_0042510 3300048903 Bacteria 2903
479 Ga0496100_0276065 3300048903 Bacteria 1251
480 Ga0496101_0200407 3300048904 Unclassified 1543
481 Ga0496102_0014382 3300048905 Bacteria 6875
482 Ga0496103_0017822 3300048906 Bacteria 4254
483 Ga0496104_0078269 3300048907 Unclassified 3151
484 Ga0496104_0167933 3300048907 Bacteria 2104
485 Ga0496104_0216736 3300048907 Bacteria 1826
486 Ga0496106_0139488 3300048909 Unclassified 1906
487 Ga0496107_0039076 3300048910 Bacteria 3404
488 Ga0496108_0000231 3300048911 Bacteria 50109
489 Ga0496109_0173982 3300048912 Unclassified 2021
490 Ga0496112_0056891 3300048915 Bacteria 3850
491 Ga0496112_0083061 3300048915 Bacteria 3168
492 Ga0496112_0255406 3300048915 Unclassified 1703
493 Ga0496114_0051903 3300048917 Bacteria 3415
494 Ga0496115_0198497 3300048918 Unclassified 1657
495 Ga0501033_0131888 3300049570 Bacteria 1810
496 Ga0501034_0068645 3300049571 Unclassified 3555
497 Ga0501036_0126399 3300049572 Bacteria 2159
498 Ga0501037_0025423 3300049573 Bacteria 4376
499 Ga0501037_0225523 3300049573 Unclassified 1317
500 Ga0501038_0073833 3300049574 Bacteria 2887
501 Ga0501038_0116158 3300049574 Bacteria 2211
502 Ga0501039_0011397 3300049575 Bacteria 6769
503 Ga0501040_0002367 3300049576 Bacteria 12108
504 Ga0501040_0008480 3300049576 Bacteria 6674
505 Ga0501040_0062294 3300049576 Bacteria 2566
506 Ga0501041_0054333 3300049577 Bacteria 2443
507 Ga0501042_0166242 3300049578 Bacteria 1592
508 Ga0501046_0015137 3300049580 Bacteria 6486
509 Ga0501047_0067962 3300049581 Bacteria 3433
510 Ga0501048_0071039 3300049582 Bacteria 2458
511 Ga0501068_0039594 3300049584 Bacteria 2827
512 Ga0501068_0072496 3300049584 Bacteria 2103
513 Ga0501070_0066874 3300049586 Bacteria 2977
514 Ga0501072_0004417 3300049588 Bacteria 10684
515 Ga0501072_0048552 3300049588 Bacteria 3343
516 Ga0501072_0205343 3300049588 Bacteria 1571
517 Ga0501072_0259054 3300049588 Bacteria 1384
518 Ga0501074_0010797 3300049590 Bacteria 6632
519 Ga0501074_0049218 3300049590 Bacteria 3043
520 Ga0501075_0021827 3300049591 Bacteria 4671
521 Ga0501075_0177677 3300049591 Bacteria 1624
522 Ga0501075_0501146 3300049591 Bacteria 926
523 Ga0501076_0016342 3300049592 Bacteria 5627
524 Ga0501076_0055813 3300049592 Bacteria 3133
525 Ga0501077_0004765 3300049593 Bacteria 8248
526 Ga0501077_0014791 3300049593 Bacteria 4903
527 Ga0501079_0009564 3300049741 Bacteria 7350
528 Ga0501079_0047867 3300049741 Bacteria 3299
529 Ga0501080_0088491 3300049742 Bacteria 2877
530 Ga0501080_0104630 3300049742 Bacteria 2625
531 Ga0501081_0002200 3300049743 Bacteria 12263
532 Ga0501081_0150684 3300049743 Bacteria 1670
533 Ga0501083_0046073 3300049744 Bacteria 2949
534 Ga0501044_0063133 3300049823 Bacteria 3785
535 Ga0501045_0001094 3300049824 Bacteria 17919
536 nmdc:mga05p37_119732_c1 3300050507 Bacteria 3234
537 nmdc:mga05p37_149869_c1 3300050507 Bacteria 2854
538 nmdc:mga05p37_276614_c1 3300050507 Bacteria 2004
539 nmdc:mga05p37_306779_c1 3300050507 Bacteria 1883
540 nmdc:mga05p37_51049_c1 3300050507 Bacteria 5087
541 nmdc:mga05p37_706572_c1 3300050507 Bacteria 1119
542 nmdc:mga06r32_300768_c1 3300050510 Bacteria 1590
543 nmdc:mga08y16_113227_c1 3300050511 Bacteria 2824
544 nmdc:mga08y16_5056_c1 3300050511 Bacteria 13784
545 nmdc:mga0n895_1163_c1 3300050512 Bacteria 19263
546 nmdc:mga0n895_15521_c1 3300050512 Bacteria 6948
547 nmdc:mga0n895_17987_c1 3300050512 Bacteria 6531
548 nmdc:mga0n895_37261_c1 3300050512 Bacteria 4703
549 nmdc:mga0n895_41786_c1 3300050512 Bacteria 4459
550 nmdc:mga0rr50_200_c1 3300050513 Bacteria 32649
551 nmdc:mga0rr50_20590_c1 3300050513 Bacteria 4485
552 nmdc:mga0rr50_3580_c1 3300050513 Bacteria 8976
553 nmdc:mga0rr50_40563_c1 3300050513 Bacteria 3386
554 nmdc:mga08x19_1768_c1 3300050514 Bacteria 13297
555 nmdc:mga08x19_48051_c1 3300050514 Bacteria 2733
556 nmdc:mga08x19_57833_c1 3300050514 Bacteria 2507
557 nmdc:mga08x19_7031_c1 3300050514 Bacteria 6680
558 nmdc:mga08x19_7236_c1 3300050514 Bacteria 6592
559 nmdc:mga08x19_87312_c1 3300050514 Bacteria 2055
560 nmdc:mga0a205_14475_c1 3300050515 Bacteria 7358
561 nmdc:mga0a205_1708_c2 3300050515 Bacteria 12820
562 nmdc:mga0a205_1997_c2 3300050515 Bacteria 4312
563 nmdc:mga0a205_44714_c1 3300050515 Bacteria 4270
564 Ga0500637_0015225 3300053178 Unclassified 4072
565 Ga0501084_0010083 3300054114 Bacteria 7807
566 Ga0501084_0025131 3300054114 Bacteria 4969
567 Ga0501082_0001632 3300060353 Bacteria 19773
568 Ga0501082_0011787 3300060353 Bacteria 7517
569 Ga0501082_0023073 3300060353 Bacteria 5365
570 Ga0530510_0083998 3300061734 Bacteria 2319
571 Ga0530510_0152058 3300061734 Bacteria 1709
572 Ga0070713_100038301
573 Ga0070676_10042985
574 Ga0070683_100001503
575 Ga0070683_100005102
576 Ga0070683_100010525
577 Ga0070683_100094960
578 Ga0070670_100001981
579 Ga0068869_100000619
580 Ga0068869_100002683
581 Ga0070666_10004600
582 Ga0070666_10085279
583 Ga0070680_100001842
584 Ga0070680_100021324
585 Ga0070682_100001799
586 Ga0070660_100000532
587 Ga0070689_100055015
588 Ga0070691_10007582
589 Ga0070691_10008060
590 Ga0070687_100035713
591 Ga0070661_100014038
592 Ga0070692_10009048
593 Ga0070692_10149504
594 Ga0070659_100021761
595 Ga0070667_100037411
596 Ga0070703_10010014
597 Ga0070709_10020978
598 Ga0070709_10118730
599 Ga0070714_100012215
600 Ga0070714_100036203
601 Ga0070713_100002382
602 Ga0070713_100318049
603 Ga0070710_10040915
604 Ga0070710_10090489
605 Ga0070701_10042188
606 Ga0070711_100000643
607 Ga0070711_100449304
608 Ga0070694_100000441
609 Ga0070694_100008318
610 Ga0070694_100009005
611 Ga0070708_100007984
612 Ga0070708_100020435
613 Ga0070708_100061969
614 Ga0070708_100066550
615 Ga0070708_100067520
616 Ga0070708_100082375
617 Ga0070708_100324321
618 Ga0070708_100392094
619 Ga0070663_100087010
620 Ga0070662_100067823
621 Ga0070681_10173334
622 Ga0068867_100028268
623 Ga0070706_100005714
624 Ga0070706_100012898
625 Ga0070706_100018778
626 Ga0070706_100020656
627 Ga0070706_100033697
628 Ga0070706_100059653
629 Ga0070706_100064717
630 Ga0070706_100065985
631 Ga0070706_100096508
632 Ga0070706_100102026
633 Ga0070706_100332167
634 Ga0070706_100573227
635 Ga0070707_100004097
636 Ga0070707_100004450
637 Ga0070707_100006594
638 Ga0070707_100011270
639 Ga0070707_100024320
640 Ga0070707_100037629
641 Ga0070707_100062483
642 Ga0070707_100271227
643 Ga0070707_100419545
644 Ga0070698_100000216
645 Ga0070698_100005218
646 Ga0070698_100010733
647 Ga0070698_100023375
648 Ga0070698_100025519
649 Ga0070698_100050366
650 Ga0070698_100086207
651 Ga0070698_100113862
652 Ga0070699_100002495
653 Ga0070699_100028195
654 Ga0070699_100050653
655 Ga0070699_100055261
656 Ga0070699_100069924
657 Ga0070699_100175518
658 Ga0070699_100194986
659 Ga0070679_100006281
660 Ga0070684_100000079
661 Ga0070684_100263584
662 Ga0070697_100004286
663 Ga0070697_100007024
664 Ga0070697_100010681
665 Ga0070697_100012026
666 Ga0070697_100044008
667 Ga0070697_100051458
668 Ga0070697_100060284
669 Ga0070697_100060916
670 Ga0070697_100092115
671 Ga0070697_100093485
672 Ga0070697_100097404
673 Ga0070697_100122135
674 Ga0070697_100190806
675 Ga0070697_100206645
676 Ga0070672_100336413
677 Ga0070695_100005717
678 Ga0070695_100024844
679 Ga0070696_100005036
680 Ga0070696_100104056
681 Ga0070696_100280725
682 Ga0070693_100001564
683 Ga0070693_100036758
684 Ga0070693_100191076
685 Ga0070665_100490692
686 Ga0070704_100030384
687 Ga0070704_100077404
688 Ga0068855_100087960
689 Ga0068855_100179072
690 Ga0070664_100017761
691 Ga0068857_100088000
692 Ga0068854_100041121
693 Ga0068854_100154834
694 Ga0068854_100506208
695 Ga0068856_100005843
696 Ga0068859_100000957
697 Ga0068864_100016567
698 Ga0068866_10018847
699 Ga0068861_100044935
700 Ga0068861_100197021
701 Ga0068870_10000791
702 Ga0068863_100022800
703 Ga0068858_100050440
704 Ga0068860_100019924
705 Ga0068860_100037240
706 Ga0068860_100075304
707 Ga0068862_100012970
708 Ga0068862_100014573
709 Ga0068862_100017226
710 Ga0081455_10000904
711 Ga0081539_10003285
712 Ga0070717_10001253
713 Ga0070717_10003937
714 Ga0070717_10004550
715 Ga0070717_10043172
716 Ga0070717_10075277
717 Ga0070717_10084145
718 Ga0070715_10016378
719 Ga0070716_100019618
720 Ga0070716_100034833
721 Ga0070712_100000375
722 Ga0070712_100214578
723 Ga0097621_100003363
724 Ga0097621_100036181
725 Ga0068871_100007466
726 Ga0068871_100039964
727 Ga0075428_100131672
728 Ga0075433_10010766
729 Ga0075433_10033505
730 Ga0075433_10035345
731 Ga0075433_10039341
732 Ga0075433_10056408
733 Ga0075434_100000460
734 Ga0075434_100005054
735 Ga0075434_100063855
736 Ga0075434_100069922
737 Ga0075434_100074948
738 Ga0075434_100355341
739 Ga0068865_100126534
740 Ga0068865_100214442
741 Ga0075436_100002862
742 Ga0075436_100039997
743 Ga0075436_100043168
744 Ga0075436_100057002
745 Ga0075436_100075952
746 Ga0075436_100104710
747 Ga0075436_100120600
748 Ga0097620_100000957
749 Ga0075435_100000141
750 Ga0075435_100031772
751 Ga0099794_10031251
752 Ga0099795_10003003
753 Ga0111539_10000370
754 Ga0111539_10174680
755 Ga0105245_10004304
756 Ga0114129_10045814
757 Ga0114129_10046682
758 Ga0114129_10105476
759 Ga0114129_10169778
760 Ga0114129_10238356
761 Ga0114129_10248038
762 Ga0114129_10318075
763 Ga0105243_10353073
764 Ga0105241_10000218
765 Ga0105241_10006873
766 Ga0105242_10032204
767 Ga0105242_10147840
768 Ga0105248_10449902
769 Ga0105248_10519309
770 Ga0105239_10537862
771 Ga0157373_10001408
772 Ga0157373_10007492
773 Ga0157371_10134641
774 Ga0157370_10459572
775 Ga0157369_10002071
776 Ga0157369_10020275
777 Ga0157369_10025517
778 Ga0157369_10199411
779 Ga0157369_10459252
780 Ga0157374_10007456
781 Ga0157374_10136762
782 Ga0157378_10000353
783 Ga0157378_10076698
784 Ga0163162_10041473
785 Ga0163162_10055761
786 Ga0163162_10348101
787 Ga0157372_10006021
788 Ga0157372_10008074
789 Ga0157372_10129657
790 Ga0157372_10203177
791 Ga0157372_10271629
792 Ga0157372_10380835
793 Ga0157375_10127588
794 Ga0163163_10056281
795 Ga0157379_10067639
796 Ga0157379_10201814
797 Ga0157376_10047446
798 Ga0206356_10913527
799 Ga0213873_10004051
800 Ga0213874_10049333
801 Ga0224712_10001822
802 Ga0224712_10003117
803 Ga0228598_1000003
804 Ga0207653_10012609
805 Ga0207688_10068077
806 Ga0207680_10017814
807 Ga0207699_10267156
808 Ga0207645_10080353
809 Ga0207643_10006754
810 Ga0207684_10001497
811 Ga0207684_10001957
812 Ga0207684_10005523
813 Ga0207684_10016804
814 Ga0207684_10017119
815 Ga0207684_10038255
816 Ga0207684_10060081
817 Ga0207684_10086148
818 Ga0207684_10099475
819 Ga0207684_10153017
820 Ga0207684_10155825
821 Ga0207684_10201644
822 Ga0207684_10215775
823 Ga0207654_10217017
824 Ga0207654_10232616
825 Ga0207707_10214560
826 Ga0207695_10071491
827 Ga0207671_10141125
828 Ga0207671_10339626
829 Ga0207693_10000214
830 Ga0207693_10070466
831 Ga0207693_10121225
832 Ga0207663_10001065
833 Ga0207662_10028212
834 Ga0207662_10067405
835 Ga0207657_10000373
836 Ga0207652_10001053
837 Ga0207646_10000005
838 Ga0207646_10000549
839 Ga0207646_10000601
840 Ga0207646_10001233
841 Ga0207646_10001458
842 Ga0207646_10001695
843 Ga0207646_10017312
844 Ga0207646_10032435
845 Ga0207646_10033417
846 Ga0207646_10037370
847 Ga0207646_10041512
848 Ga0207646_10074926
849 Ga0207650_10022868
850 Ga0207659_10337675
851 Ga0207700_10021468
852 Ga0207700_10053835
853 Ga0207700_10181019
854 Ga0207700_10542830
855 Ga0207664_10008619
856 Ga0207664_10018226
857 Ga0207664_10319571
858 Ga0207664_10425930
859 Ga0207706_10045512
860 Ga0207706_10082438
861 Ga0207706_10149025
862 Ga0207709_10256383
863 Ga0207665_10003305
864 Ga0207665_10018994
865 Ga0207665_10072850
866 Ga0207665_10267048
867 Ga0207691_10133762
868 Ga0207711_10381518
869 Ga0207689_10004821
870 Ga0207689_10203959
871 Ga0207661_10001886
872 Ga0207679_10000709
873 Ga0207712_10034644
874 Ga0207658_10373194
875 Ga0207677_10004536
876 Ga0207677_10029760
877 Ga0207639_10168682
878 Ga0207702_10044826
879 Ga0207702_10333769
880 Ga0207702_10552332
881 Ga0207641_10014982
882 Ga0207641_10121859
883 Ga0207648_10041311
884 Ga0207676_10145989
885 Ga0207674_10001794
886 Ga0207674_10002853
887 Ga0207675_100007787
888 Ga0207675_100013748
889 Ga0207675_100034069
890 Ga0209983_1003429
891 Ga0209588_1000731
892 Ga0209971_1000031
893 Ga0209966_1000566
894 Ga0209998_10002477
895 Ga0207428_10000409
896 Ga0207428_10162280
897 Ga0268266_10399504
898 Ga0268265_10045939
899 Ga0268265_10125992
900 Ga0268264_10071494
901 Ga0265338_10011560
902 Ga0265338_10102608
903 Ga0265338_10102896
904 Ga0265770_1001661
905 Ga0265760_10003570
906 Ga0265760_10074889
907 Ga0316575_10008083
908 Ga0316575_10023577
909 Ga0316579_10005729
910 Ga0316579_10026698
911 Ga0316576_10009662
912 Ga0316576_10052016
913 Ga0316576_10059114
914 Ga0316576_10074464
915 Ga0316576_10154674
916 Ga0316578_10023291
917 Ga0316578_10031147
918 Ga0316578_10051138
919 Ga0316577_10016450
920 Ga0316577_10087343
921 Ga0316577_10133963
922 Ga0307413_10242396
923 Ga0307413_10248772
924 Ga0307410_10001016
925 Ga0307410_10061557
926 Ga0307410_10240606
927 Ga0307409_100075981
928 Ga0307416_100009766
929 Ga0307416_100042648
930 Ga0307411_10061816
931 Ga0316580_10012619
932 Ga0316580_10027892
933 Ga0316580_10037442
934 Ga0373948_0013143
935 Ga0373926_0029796
936 Ga0373949_0001880
937 Ga0373923_0003716
938 Ga0373936_0002742
939 Ga0373954_0002947
940 Ga0373956_0000112
941 Ga0316574_0036228
942 Ga0316574_0045602
943 Ga0373924_0095197
944 Ga0373931_0081812
945 Ga0373935_0028232
946 Ga0373935_0208156
947 Ga0373927_0000163
948 Ga0373933_0131896
949 Ga0373947_0044113
950 Ga0373947_0065898
951 Ga0373937_0006752
952 Ga0373937_0021766
953 Ga0373937_0070339
954 Ga0316582_0001462
955 Ga0316582_0015139
956 Ga0316582_0137443
957 Ga0316584_0018095
958 Ga0316584_0079947
959 Ga0316584_0135087
960 Ga0316584_0230674
961 Ga0373925_0065351
962 Ga0373925_0217584
963 Ga0395905_0023199
964 Ga0395905_0075933
965 Ga0400489_14542
966 Ga0436365_0520453
967 Ga0436365_0616185
968 Ga0436363_0158073
969 Ga0436363_0616842
970 Ga0436363_1598903
971 Ga0436362_0204128
972 Ga0436362_0291038
973 Ga0439448_0008988
974 Ga0439448_0068342
975 Ga0439458_0001620
976 Ga0439460_0000326
977 Ga0451577_0000215
978 Ga0451577_0003242
979 Ga0451577_0042844
980 Ga0451577_0058833
981 Ga0451577_0095454
982 Ga0451577_0100299
983 Ga0451577_0526460
984 Ga0453683_0011496
985 Ga0453683_0016214
986 Ga0453683_0024938
987 Ga0453683_0056964
988 Ga0466966_0079164
989 Ga0453684_0000698
990 Ga0453684_0047011
991 Ga0453684_0050388
992 Ga0453684_0061179
993 Ga0453684_0427652
994 Ga0466968_0036895
995 Ga0466957_0049755
996 Ga0451576_0015980
997 Ga0451576_0022226
998 Ga0451576_0042455
999 Ga0451576_0124087
1000 Ga0451576_0174868
1001 Ga0451576_0216254
1002 Ga0451576_0230921
1003 Ga0451576_0362479
1004 Ga0466967_0054355
1005 Ga0466967_0161591
1006 Ga0495651_0003194
1007 Ga0495653_0006087
1008 Ga0495580_0004280
1009 Ga0495580_0009817
1010 Ga0495580_0015856
1011 Ga0495580_0026747
1012 Ga0495580_0029664
1013 Ga0495580_0065318
1014 Ga0495580_0125263
1015 Ga0495608_0005084
1016 Ga0495608_0013110
1017 Ga0495628_0003107
1018 Ga0495630_0022447
1019 Ga0495630_0053130
1020 Ga0495666_0004105
1021 Ga0495665_0007815
1022 Ga0495640_0337838
1023 Ga0495586_0002626
1024 Ga0495587_0010414
1025 Ga0495667_0024378
1026 Ga0495667_0240071
1027 Ga0495635_0035017
1028 Ga0495657_0043231
1029 Ga0495623_0003279
1030 Ga0495658_0113842
1031 Ga0495613_0021784
1032 Ga0495613_0064288
1033 Ga0495624_0020322
1034 Ga0495600_0029979
1035 Ga0495604_0016330
1036 Ga0495604_0139919
1037 Ga0495674_0056792
1038 Ga0495674_0383560
1039 Ga0495676_0094092
1040 Ga0495680_0132546
1041 Ga0495675_0001125
1042 Ga0495684_0003957
1043 Ga0495684_0007061
1044 Ga0495593_0014865
1045 Ga0495602_0084381
1046 Ga0495602_0106675
1047 Ga0495602_0107092
1048 Ga0495614_0021396
1049 Ga0496100_0042510
1050 Ga0496100_0276065
1051 Ga0496101_0200407
1052 Ga0496102_0014382
1053 Ga0496103_0017822
1054 Ga0496104_0078269
1055 Ga0496104_0167933
1056 Ga0496104_0216736
1057 Ga0496106_0139488
1058 Ga0496107_0039076
1059 Ga0496108_0000231
1060 Ga0496109_0173982
1061 Ga0496112_0056891
1062 Ga0496112_0083061
1063 Ga0496112_0255406
1064 Ga0496114_0051903
1065 Ga0496115_0198497
1066 Ga0501033_0131888
1067 Ga0501034_0068645
1068 Ga0501036_0126399
1069 Ga0501037_0025423
1070 Ga0501037_0225523
1071 Ga0501038_0073833
1072 Ga0501038_0116158
1073 Ga0501039_0011397
1074 Ga0501040_0002367
1075 Ga0501040_0008480
1076 Ga0501040_0062294
1077 Ga0501041_0054333
1078 Ga0501042_0166242
1079 Ga0501046_0015137
1080 Ga0501047_0067962
1081 Ga0501048_0071039
1082 Ga0501068_0039594
1083 Ga0501068_0072496
1084 Ga0501070_0066874
1085 Ga0501072_0004417
1086 Ga0501072_0048552
1087 Ga0501072_0205343
1088 Ga0501072_0259054
1089 Ga0501074_0010797
1090 Ga0501074_0049218
1091 Ga0501075_0021827
1092 Ga0501075_0177677
1093 Ga0501075_0501146
1094 Ga0501076_0016342
1095 Ga0501076_0055813
1096 Ga0501077_0004765
1097 Ga0501077_0014791
1098 Ga0501079_0009564
1099 Ga0501079_0047867
1100 Ga0501080_0088491
1101 Ga0501080_0104630
1102 Ga0501081_0002200
1103 Ga0501081_0150684
1104 Ga0501083_0046073
1105 Ga0501044_0063133
1106 Ga0501045_0001094
1107 nmdc:mga05p37_119732_c1
1108 nmdc:mga05p37_149869_c1
1109 nmdc:mga05p37_276614_c1
1110 nmdc:mga05p37_306779_c1
1111 nmdc:mga05p37_51049_c1
1112 nmdc:mga05p37_706572_c1
1113 nmdc:mga06r32_300768_c1
1114 nmdc:mga08y16_113227_c1
1115 nmdc:mga08y16_5056_c1
1116 nmdc:mga0n895_1163_c1
1117 nmdc:mga0n895_15521_c1
1118 nmdc:mga0n895_17987_c1
1119 nmdc:mga0n895_37261_c1
1120 nmdc:mga0n895_41786_c1
1121 nmdc:mga0rr50_200_c1
1122 nmdc:mga0rr50_20590_c1
1123 nmdc:mga0rr50_3580_c1
1124 nmdc:mga0rr50_40563_c1
1125 nmdc:mga08x19_1768_c1
1126 nmdc:mga08x19_48051_c1
1127 nmdc:mga08x19_57833_c1
1128 nmdc:mga08x19_7031_c1
1129 nmdc:mga08x19_7236_c1
1130 nmdc:mga08x19_87312_c1
1131 nmdc:mga0a205_14475_c1
1132 nmdc:mga0a205_1708_c2
1133 nmdc:mga0a205_1997_c2
1134 nmdc:mga0a205_44714_c1
1135 Ga0500637_0015225
1136 Ga0501084_0010083
1137 Ga0501084_0025131
1138 Ga0501082_0001632
1139 Ga0501082_0011787
1140 Ga0501082_0023073
1141 Ga0530510_0083998
1142 Ga0530510_0152058

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01144

CoA_trans

Coenzyme A transferase

50

271

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
1poi-assembly1.cif.gz_A crystal structure of glutaconate coenzyme a-transferase from acidaminococcus fermentans to 2.55 angstoms resolution 0.9096 1 287
6coj-assembly1.cif.gz_A-2 crystal structure of rhodococcus jostii rha1 ipdab e105a cochea-coa complex 0.8744 1 275
6co9-assembly1.cif.gz_A crystal structure of rhodococcus jostii rha1 ipdab cochea-coa complex 0.874 1 275
1poi-assembly1.cif.gz_A crystal structure of glutaconate coenzyme a-transferase from acidaminococcus fermentans to 2.55 angstoms resolution 0.869 1 287
3cdk-assembly1.cif.gz_C crystal structure of the co-expressed succinyl-coa transferase a and b complex from bacillus subtilis 0.8629 1 224
ID Description Score Start End Superfamily
1poiA01 Alpha Beta;3-Layer(aba) Sandwich;Glutaconate Coenzyme A-transferase;Glutaconate Coenzyme A-transferase 0.9167 1 287 3.40.1080.10
1poiA01 Alpha Beta;3-Layer(aba) Sandwich;Glutaconate Coenzyme A-transferase;Glutaconate Coenzyme A-transferase 0.8608 1 287 3.40.1080.10
5dbnA00 Alpha Beta;3-Layer(aba) Sandwich;Glutaconate Coenzyme A-transferase;Glutaconate Coenzyme A-transferase 0.8415 1 223 3.40.1080.10
af_A4I5L9_2_259_3.40.1080.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaconate Coenzyme A-transferase;Glutaconate Coenzyme A-transferase 0.839 1 224 3.40.1080.10
2nrbB01 Alpha Beta;3-Layer(aba) Sandwich;Glutaconate Coenzyme A-transferase;Glutaconate Coenzyme A-transferase 0.8238 1 223 3.40.1080.10
ID Description Score Start End GO Terms
AF-A0A1Q7HS79-F1-model_v4 3-oxoadipate CoA-transferase 0.9687 1 285 GO:0008410
AF-A0A2V8EB16-F1-model_v4 3-oxoadipate--succinyl-CoA transferase subunit A 0.9677 86 294 GO:0008410
AF-A0A382LWX0-F1-model_v4 CoA transferase subunit A 0.9636 1 265 GO:0008410
AF-A0A538T7D5-F1-model_v4 CoA transferase subunit A 0.9618 1 253 GO:0008410
AF-A0A3D2J9K5-F1-model_v4 CoA transferase subunit A 0.9615 1 300 GO:0008410

Map