F464694

General Info

Members Datasets Scaffolds Average Seq Length
569 247 1138 351

Family's Representative Sequence

Representative Sequence 3300005293|Ga0065715_10009928|Ga0065715_100099282
Length 407
Sequence VLIAGWGANCELRASRHSEFVRSKARNSQLASQPAASQQLVTICWPATRSPQLPAGTTFAPFERVEQSPNWEGERHALLSQRISDIGLEIRGSLLEKLVNQLYDELAAKGLEFRPPVYLSDQWGCPDGTPLIGVPFYLADARLSKIEEDYSAAVEGAEESMRYLRHXAGHAFNYAYRLYDRPDWRKMFGPYSRPYRERYRADPFSHDYVRHILGWYAQKHPDEDFAETFAVWLTPDFDWRQAYEGWGALRKLEYVDGVMKEIAHRIPAVPEPSDDDLPVRAMRYTVAEHYEDSEEQIPIKDPRIFDGDLKTIFVSRAQAPESVSAAEFINRHRREIVARISYWTGEQAAVVRQFVDFLGDRAGQLNLQLGGLEASTLIELTAFGTAVMMNYRHTNTVDGAKNSPGNT

Samples

Sample ID Description Type Environment
1 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
2 2162886011 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
16 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
17 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
18 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
19 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
20 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
21 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
22 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
23 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
24 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
25 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
26 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
27 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
28 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
29 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
30 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
31 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
32 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
33 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
34 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
35 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
36 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
37 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
38 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
39 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
40 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
41 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
42 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
43 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
44 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
45 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
46 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
47 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
48 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
49 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
50 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
51 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
52 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
53 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
54 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
55 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
56 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
57 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
58 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
59 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
60 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
61 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
62 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
63 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
64 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
65 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
66 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
67 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
68 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
69 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
70 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
71 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
72 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
73 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
74 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
75 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
76 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
77 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
78 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
79 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
80 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
81 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
82 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
83 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
84 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
85 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
86 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
87 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
88 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
89 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
90 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
91 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
92 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
93 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
94 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
95 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
96 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
97 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
98 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
99 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
100 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
101 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
102 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
103 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
104 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
105 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
106 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
107 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
108 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
109 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
110 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
111 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
112 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
113 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
164 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
165 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
166 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
167 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
168 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
172 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
173 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
174 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
175 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
176 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
177 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
178 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
179 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
180 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
181 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
182 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
183 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
184 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
185 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
186 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
187 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
188 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
189 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
190 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
191 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
192 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
193 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
194 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
195 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
196 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
197 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
198 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
199 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
200 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
201 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
202 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
203 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
204 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
205 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
206 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
207 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
208 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
209 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
210 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
211 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
212 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
213 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
214 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
215 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
216 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
217 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
218 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
219 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
220 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
221 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
222 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
223 3300049674 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought Metagenome Rhizosphere
224 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
225 3300049682 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought Metagenome Rhizosphere
226 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
227 3300049687 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought Metagenome Rhizosphere
228 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
229 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
230 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
231 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
232 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
233 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
234 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
235 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
236 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
237 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
238 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
239 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
240 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
241 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
242 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
243 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
244 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
245 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
246 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
247 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.93
Rhizosphere 97.89
Stem 0
Stem Tuber 0
Unclassified 13.36

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0065715_10009928 3300005293 Bacteria 3918
2 MRS1b_contig_1165057 2162886011 Bacteria 1188
3 Ga0065712_10073456 3300005290 Bacteria 4358
4 Ga0065715_10158917 3300005293 Bacteria 1648
5 Ga0070658_10004789 3300005327 Bacteria 11011
6 Ga0070658_10006900 3300005327 Bacteria 9174
7 Ga0070658_10009328 3300005327 Bacteria 7888
8 Ga0070658_10011442 3300005327 Bacteria 7117
9 Ga0070658_10085910 3300005327 Bacteria 2587
10 Ga0070658_10146239 3300005327 Bacteria 1977
11 Ga0070658_10202789 3300005327 Bacteria 1674
12 Ga0070676_10005019 3300005328 Bacteria 7012
13 Ga0070676_10010033 3300005328 Bacteria 5127
14 Ga0070676_10029694 3300005328 Bacteria 3111
15 Ga0070676_10058364 3300005328 Bacteria 2287
16 Ga0070676_10071636 3300005328 Bacteria 2082
17 Ga0070683_100005515 3300005329 Bacteria 10569
18 Ga0070683_100009152 3300005329 Bacteria 8452
19 Ga0070683_100010052 3300005329 Bacteria 8116
20 Ga0070683_100021633 3300005329 Bacteria 5741
21 Ga0070683_100047880 3300005329 Bacteria 3951
22 Ga0070683_100053812 3300005329 Bacteria 3731
23 Ga0070683_100072423 3300005329 Unclassified 3216
24 Ga0070683_100130543 3300005329 Bacteria 2378
25 Ga0070690_100013121 3300005330 Bacteria 4891
26 Ga0070670_100007484 3300005331 Bacteria 9273
27 Ga0070670_100012824 3300005331 Bacteria 7172
28 Ga0070670_100074551 3300005331 Bacteria 2915
29 Ga0070670_100109216 3300005331 Bacteria 2383
30 Ga0070670_100116523 3300005331 Bacteria 2303
31 Ga0070677_10035381 3300005333 Unclassified 1936
32 Ga0068869_100006235 3300005334 Bacteria 7551
33 Ga0068869_100103072 3300005334 Bacteria 2161
34 Ga0070666_10107508 3300005335 Bacteria 1927
35 Ga0070680_100059772 3300005336 Bacteria 3119
36 Ga0070680_100081615 3300005336 Bacteria 2668
37 Ga0070680_100106488 3300005336 Bacteria 2331
38 Ga0070682_100007301 3300005337 Bacteria 6231
39 Ga0070682_100007510 3300005337 Bacteria 6145
40 Ga0070682_100012590 3300005337 Bacteria 4853
41 Ga0070682_100014171 3300005337 Bacteria 4603
42 Ga0070682_100036576 3300005337 Unclassified 3002
43 Ga0068868_100001747 3300005338 Bacteria 14897
44 Ga0068868_100005459 3300005338 Bacteria 8938
45 Ga0068868_100041291 3300005338 Bacteria 3594
46 Ga0070660_100020487 3300005339 Bacteria 4861
47 Ga0070660_100029469 3300005339 Bacteria 4114
48 Ga0070660_100067257 3300005339 Bacteria 2791
49 Ga0070660_100074020 3300005339 Bacteria 2664
50 Ga0070689_100005456 3300005340 Bacteria 8685
51 Ga0070687_100005807 3300005343 Bacteria 5016
52 Ga0070687_100007863 3300005343 Unclassified 4481
53 Ga0070661_100004942 3300005344 Bacteria 9178
54 Ga0070661_100018467 3300005344 Bacteria 4957
55 Ga0070661_100034417 3300005344 Bacteria 3673
56 Ga0070661_100043123 3300005344 Bacteria 3295
57 Ga0070661_100085849 3300005344 Bacteria 2326
58 Ga0070661_100092599 3300005344 Bacteria 2239
59 Ga0070661_100099606 3300005344 Bacteria 2160
60 Ga0070661_100241222 3300005344 Bacteria 1392
61 Ga0070692_10006542 3300005345 Bacteria 5068
62 Ga0070692_10011558 3300005345 Bacteria 4056
63 Ga0070692_10014916 3300005345 Bacteria 3663
64 Ga0070692_10023315 3300005345 Bacteria 3032
65 Ga0070692_10117264 3300005345 Bacteria 1480
66 Ga0070668_100002912 3300005347 Bacteria 12649
67 Ga0070669_100008984 3300005353 Bacteria 7131
68 Ga0070675_100008799 3300005354 Bacteria 7841
69 Ga0070675_100026963 3300005354 Unclassified 4613
70 Ga0070675_100068231 3300005354 Unclassified 2944
71 Ga0070671_100040437 3300005355 Bacteria 3873
72 Ga0070674_100023876 3300005356 Bacteria 3964
73 Ga0070673_100018371 3300005364 Bacteria 4992
74 Ga0070673_100027811 3300005364 Bacteria 4196
75 Ga0070673_100119453 3300005364 Bacteria 2196
76 Ga0070688_100003789 3300005365 Bacteria 7835
77 Ga0070688_100069349 3300005365 Bacteria 2251
78 Ga0070659_100000186 3300005366 Bacteria 47629
79 Ga0070659_100013186 3300005366 Bacteria 6148
80 Ga0070659_100024770 3300005366 Bacteria 4603
81 Ga0070659_100051568 3300005366 Bacteria 3235
82 Ga0070667_100009605 3300005367 Bacteria 8023
83 Ga0070667_100052480 3300005367 Unclassified 3441
84 Ga0070709_10001271 3300005434 Bacteria 13777
85 Ga0070714_100017114 3300005435 Bacteria 5869
86 Ga0070710_10003336 3300005437 Bacteria 7612
87 Ga0070711_100018838 3300005439 Unclassified 4415
88 Ga0070700_100027130 3300005441 Bacteria 3392
89 Ga0070694_100028473 3300005444 Bacteria 3636
90 Ga0070708_100000900 3300005445 Bacteria 22509
91 Ga0070663_100014357 3300005455 Bacteria 5082
92 Ga0070663_100090248 3300005455 Bacteria 2269
93 Ga0070678_100077315 3300005456 Bacteria 2510
94 Ga0070662_100000676 3300005457 Bacteria 20794
95 Ga0070662_100010507 3300005457 Bacteria 6079
96 Ga0070662_100037579 3300005457 Unclassified 3434
97 Ga0070662_100041499 3300005457 Bacteria 3283
98 Ga0070662_100116270 3300005457 Bacteria 2044
99 Ga0070662_100175677 3300005457 Bacteria 1685
100 Ga0070662_100284020 3300005457 Bacteria 1340
101 Ga0070681_10000554 3300005458 Bacteria 30814
102 Ga0070681_10009944 3300005458 Bacteria 9374
103 Ga0070681_10026497 3300005458 Bacteria 5826
104 Ga0070681_10032752 3300005458 Bacteria 5218
105 Ga0070681_10192739 3300005458 Unclassified 1958
106 Ga0070681_10299551 3300005458 Bacteria 1518
107 Ga0068867_100006875 3300005459 Bacteria 8048
108 Ga0068867_100057666 3300005459 Bacteria 2876
109 Ga0068867_100069583 3300005459 Unclassified 2628
110 Ga0070685_10014111 3300005466 Bacteria 4226
111 Ga0070685_10026497 3300005466 Bacteria 3195
112 Ga0070706_100104330 3300005467 Bacteria 2637
113 Ga0070706_100131408 3300005467 Unclassified 2336
114 Ga0070698_100008862 3300005471 Bacteria 10815
115 Ga0070699_100022869 3300005518 Bacteria 5386
116 Ga0070699_100187958 3300005518 Bacteria 1834
117 Ga0070699_100311022 3300005518 Bacteria 1414
118 Ga0070679_100003536 3300005530 Bacteria 14313
119 Ga0070679_100011906 3300005530 Bacteria 8302
120 Ga0070679_100015959 3300005530 Bacteria 7232
121 Ga0070679_100024359 3300005530 Bacteria 5930
122 Ga0070679_100030914 3300005530 Bacteria 5290
123 Ga0070679_100049323 3300005530 Bacteria 4193
124 Ga0070679_100093660 3300005530 Bacteria 2991
125 Ga0070679_100157082 3300005530 Bacteria 2249
126 Ga0070684_100004423 3300005535 Bacteria 10696
127 Ga0070684_100004624 3300005535 Bacteria 10497
128 Ga0070684_100012801 3300005535 Bacteria 6737
129 Ga0070684_100013734 3300005535 Bacteria 6536
130 Ga0070684_100022724 3300005535 Bacteria 5235
131 Ga0070684_100028829 3300005535 Unclassified 4698
132 Ga0070684_100068550 3300005535 Bacteria 3118
133 Ga0068853_100017663 3300005539 Bacteria 5888
134 Ga0068853_100018867 3300005539 Bacteria 5712
135 Ga0070672_100022821 3300005543 Bacteria 4603
136 Ga0070672_100058841 3300005543 Bacteria 3022
137 Ga0070672_100063839 3300005543 Bacteria 2908
138 Ga0070686_100079015 3300005544 Bacteria 2174
139 Ga0070695_100008935 3300005545 Bacteria 5951
140 Ga0070695_100017337 3300005545 Unclassified 4367
141 Ga0070695_100163132 3300005545 Archaea 1566
142 Ga0070696_100026322 3300005546 Bacteria 3957
143 Ga0070693_100003324 3300005547 Bacteria 7473
144 Ga0070693_100008492 3300005547 Bacteria 5069
145 Ga0070693_100061481 3300005547 Unclassified 2183
146 Ga0070665_100066866 3300005548 Bacteria 3605
147 Ga0070665_100073255 3300005548 Bacteria 3432
148 Ga0068855_100001763 3300005563 Bacteria 27021
149 Ga0068855_100013745 3300005563 Bacteria 9757
150 Ga0068855_100032291 3300005563 Bacteria 6252
151 Ga0068855_100039331 3300005563 Bacteria 5614
152 Ga0068855_100072437 3300005563 Bacteria 4005
153 Ga0070664_100002389 3300005564 Bacteria 15079
154 Ga0070664_100011832 3300005564 Bacteria 7084
155 Ga0070664_100016836 3300005564 Bacteria 6000
156 Ga0070664_100020912 3300005564 Bacteria 5392
157 Ga0070664_100026483 3300005564 Bacteria 4809
158 Ga0070664_100106834 3300005564 Unclassified 2439
159 Ga0070664_100111539 3300005564 Bacteria 2387
160 Ga0070664_100202831 3300005564 Bacteria 1770
161 Ga0068857_100007029 3300005577 Bacteria 9688
162 Ga0068857_100022417 3300005577 Bacteria 5556
163 Ga0068857_100039600 3300005577 Unclassified 4175
164 Ga0068857_100059701 3300005577 Bacteria 3388
165 Ga0068854_100056453 3300005578 Bacteria 2830
166 Ga0068856_100021955 3300005614 Bacteria 6205
167 Ga0070702_100005827 3300005615 Bacteria 5778
168 Ga0070702_100033126 3300005615 Unclassified 2839
169 Ga0068852_100010225 3300005616 Bacteria 6995
170 Ga0068859_100070939 3300005617 Bacteria 3519
171 Ga0068859_100275900 3300005617 Bacteria 1774
172 Ga0068864_100019986 3300005618 Bacteria 5600
173 Ga0068864_100036453 3300005618 Bacteria 4192
174 Ga0068866_10026799 3300005718 Unclassified 2727
175 Ga0068866_10148078 3300005718 Bacteria 1356
176 Ga0068861_100032074 3300005719 Bacteria 3865
177 Ga0068851_10008230 3300005834 Bacteria 4814
178 Ga0068851_10012965 3300005834 Bacteria 3937
179 Ga0068870_10007972 3300005840 Bacteria 4741
180 Ga0068863_100022492 3300005841 Bacteria 6020
181 Ga0068863_100040700 3300005841 Bacteria 4419
182 Ga0068863_100116763 3300005841 Unclassified 2543
183 Ga0068858_100042404 3300005842 Bacteria 4219
184 Ga0068858_100482104 3300005842 Bacteria 1197
185 Ga0068860_100022585 3300005843 Bacteria 6082
186 Ga0068860_100056820 3300005843 Unclassified 3719
187 Ga0068860_100068085 3300005843 Bacteria 3382
188 Ga0068860_100197830 3300005843 Bacteria 1947
189 Ga0068862_100000266 3300005844 Bacteria 58197
190 Ga0068862_100018270 3300005844 Bacteria 5839
191 Ga0081539_10021382 3300005985 Bacteria 4325
192 Ga0070716_100001493 3300006173 Bacteria 10451
193 Ga0097621_100028188 3300006237 Unclassified 4425
194 Ga0068871_100042105 3300006358 Bacteria 3664
195 Ga0075428_100007832 3300006844 Bacteria 11840
196 Ga0075428_100117073 3300006844 Bacteria 2902
197 Ga0075428_100195936 3300006844 Bacteria 2185
198 Ga0075430_100002577 3300006846 Bacteria 15121
199 Ga0075430_100005810 3300006846 Bacteria 10409
200 Ga0075430_100010448 3300006846 Bacteria 7859
201 Ga0075431_100008288 3300006847 Bacteria 10391
202 Ga0075431_100053299 3300006847 Bacteria 4171
203 Ga0075431_100104888 3300006847 Bacteria 2917
204 Ga0075431_100195109 3300006847 Bacteria 2073
205 Ga0075433_10008693 3300006852 Bacteria 8101
206 Ga0075433_10076100 3300006852 Bacteria 2955
207 Ga0075434_100286622 3300006871 Bacteria 1667
208 Ga0075429_100043617 3300006880 Bacteria 3903
209 Ga0075429_100106166 3300006880 Bacteria 2453
210 Ga0068865_100003397 3300006881 Bacteria 9531
211 Ga0068865_100024669 3300006881 Unclassified 3947
212 Ga0075436_100001767 3300006914 Bacteria 14808
213 Ga0097620_100054113 3300006931 Unclassified 4037
214 Ga0097620_100070938 3300006931 Bacteria 3519
215 Ga0097620_100275885 3300006931 Bacteria 1774
216 Ga0075435_100114579 3300007076 Bacteria 2244
217 Ga0105240_10317225 3300009093 Bacteria 1778
218 Ga0111539_10028762 3300009094 Bacteria 6778
219 Ga0105245_10032628 3300009098 Bacteria 4610
220 Ga0105245_10070983 3300009098 Bacteria 3162
221 Ga0114129_10015180 3300009147 Bacteria 10962
222 Ga0114129_10043725 3300009147 Bacteria 6302
223 Ga0105243_10326812 3300009148 Unclassified 1399
224 Ga0105241_10012725 3300009174 Bacteria 6175
225 Ga0105241_10200680 3300009174 Bacteria 1666
226 Ga0105242_10013973 3300009176 Bacteria 6212
227 Ga0105242_10018857 3300009176 Bacteria 5402
228 Ga0105242_10031780 3300009176 Bacteria 4219
229 Ga0105242_10056427 3300009176 Unclassified 3214
230 Ga0105248_10008399 3300009177 Bacteria 11331
231 Ga0105248_10012636 3300009177 Bacteria 9316
232 Ga0105248_10041683 3300009177 Bacteria 5147
233 Ga0105248_10060962 3300009177 Unclassified 4235
234 Ga0105248_10080092 3300009177 Bacteria 3670
235 Ga0105248_10156529 3300009177 Unclassified 2571
236 Ga0105237_10040232 3300009545 Unclassified 4715
237 Ga0105249_10000199 3300009553 Bacteria 68792
238 Ga0105249_10011111 3300009553 Bacteria 7910
239 Ga0099796_10008603 3300010159 Unclassified 2726
240 Ga0105239_10010717 3300010375 Bacteria 10240
241 Ga0105246_10005862 3300011119 Bacteria 7495
242 Ga0157373_10027322 3300013100 Bacteria 4117
243 Ga0157373_10056584 3300013100 Bacteria 2784
244 Ga0157373_10097337 3300013100 Bacteria 2071
245 Ga0157373_10147584 3300013100 Bacteria 1654
246 Ga0157371_10009627 3300013102 Bacteria 7598
247 Ga0157371_10031456 3300013102 Bacteria 3823
248 Ga0157371_10054043 3300013102 Bacteria 2852
249 Ga0157370_10031129 3300013104 Bacteria 5222
250 Ga0157370_10035184 3300013104 Unclassified 4871
251 Ga0157369_10067506 3300013105 Bacteria 3844
252 Ga0157369_10136505 3300013105 Bacteria 2597
253 Ga0157369_10310592 3300013105 Bacteria 1639
254 Ga0157374_10051859 3300013296 Bacteria 3819
255 Ga0157378_10016876 3300013297 Bacteria 6399
256 Ga0157378_10017313 3300013297 Bacteria 6321
257 Ga0157378_10071174 3300013297 Bacteria 3123
258 Ga0157378_10206996 3300013297 Unclassified 1858
259 Ga0163162_10007224 3300013306 Bacteria 10785
260 Ga0163162_10018423 3300013306 Bacteria 6841
261 Ga0157372_10002220 3300013307 Bacteria 21062
262 Ga0157372_10004585 3300013307 Bacteria 14694
263 Ga0157372_10004618 3300013307 Bacteria 14645
264 Ga0157372_10018747 3300013307 Bacteria 7446
265 Ga0157372_10023423 3300013307 Bacteria 6692
266 Ga0157372_10027838 3300013307 Bacteria 6160
267 Ga0157372_10028968 3300013307 Bacteria 6042
268 Ga0157372_10035454 3300013307 Bacteria 5493
269 Ga0157372_10085437 3300013307 Unclassified 3578
270 Ga0157372_10116251 3300013307 Bacteria 3067
271 Ga0157372_10437730 3300013307 Bacteria 1524
272 Ga0157375_10015665 3300013308 Bacteria 6791
273 Ga0157375_10024573 3300013308 Bacteria 5579
274 Ga0157375_10037922 3300013308 Bacteria 4624
275 Ga0157375_10107270 3300013308 Bacteria 2886
276 Ga0157375_10184839 3300013308 Unclassified 2237
277 Ga0157375_10225059 3300013308 Bacteria 2035
278 Ga0163163_10016675 3300014325 Bacteria 6832
279 Ga0163163_10204949 3300014325 Bacteria 2021
280 Ga0157380_10011261 3300014326 Bacteria 6457
281 Ga0157380_10020606 3300014326 Bacteria 4931
282 Ga0157377_10001755 3300014745 Bacteria 9445
283 Ga0157377_10035261 3300014745 Bacteria 2743
284 Ga0157377_10046011 3300014745 Bacteria 2439
285 Ga0157379_10007895 3300014968 Bacteria 9224
286 Ga0157376_10005703 3300014969 Bacteria 8721
287 Ga0163161_10014742 3300017792 Bacteria 5444
288 Ga0163161_10021070 3300017792 Bacteria 4582
289 Ga0163161_10094535 3300017792 Bacteria 2216
290 Ga0207697_10001123 3300025315 Bacteria 14748
291 Ga0207656_10008771 3300025321 Bacteria 3737
292 Ga0207656_10129545 3300025321 Bacteria 1181
293 Ga0207682_10020672 3300025893 Unclassified 2585
294 Ga0207692_10011360 3300025898 Unclassified 3786
295 Ga0207642_10052811 3300025899 Bacteria 1846
296 Ga0207680_10135168 3300025903 Bacteria 1629
297 Ga0207680_10276019 3300025903 Bacteria 1167
298 Ga0207647_10044584 3300025904 Bacteria 2770
299 Ga0207645_10000183 3300025907 Bacteria 50122
300 Ga0207645_10017224 3300025907 Bacteria 4772
301 Ga0207645_10125409 3300025907 Unclassified 1669
302 Ga0207645_10170906 3300025907 Bacteria 1425
303 Ga0207643_10010824 3300025908 Bacteria 4919
304 Ga0207643_10040300 3300025908 Bacteria 2629
305 Ga0207705_10001349 3300025909 Bacteria 19610
306 Ga0207705_10010351 3300025909 Bacteria 6783
307 Ga0207705_10047758 3300025909 Bacteria 3078
308 Ga0207684_10062688 3300025910 Bacteria 3156
309 Ga0207684_10316541 3300025910 Bacteria 1345
310 Ga0207654_10019155 3300025911 Bacteria 3606
311 Ga0207707_10014789 3300025912 Bacteria 6799
312 Ga0207707_10016422 3300025912 Bacteria 6457
313 Ga0207707_10043588 3300025912 Bacteria 3913
314 Ga0207707_10047565 3300025912 Bacteria 3735
315 Ga0207707_10075168 3300025912 Unclassified 2947
316 Ga0207707_10137222 3300025912 Bacteria 2138
317 Ga0207707_10293139 3300025912 Bacteria 1407
318 Ga0207660_10009226 3300025917 Bacteria 6382
319 Ga0207660_10010778 3300025917 Bacteria 5940
320 Ga0207660_10024581 3300025917 Unclassified 4080
321 Ga0207660_10102826 3300025917 Bacteria 2136
322 Ga0207660_10129460 3300025917 Unclassified 1920
323 Ga0207662_10000847 3300025918 Bacteria 14100
324 Ga0207662_10010007 3300025918 Bacteria 5231
325 Ga0207657_10017403 3300025919 Bacteria 6892
326 Ga0207657_10031682 3300025919 Bacteria 4785
327 Ga0207657_10035223 3300025919 Bacteria 4490
328 Ga0207657_10040755 3300025919 Bacteria 4112
329 Ga0207657_10094189 3300025919 Bacteria 2494
330 Ga0207649_10006161 3300025920 Bacteria 6510
331 Ga0207649_10008781 3300025920 Bacteria 5516
332 Ga0207649_10018562 3300025920 Bacteria 3959
333 Ga0207649_10047122 3300025920 Bacteria 2651
334 Ga0207649_10078724 3300025920 Bacteria 2128
335 Ga0207649_10141229 3300025920 Bacteria 1648
336 Ga0207652_10011520 3300025921 Bacteria 7130
337 Ga0207652_10046948 3300025921 Bacteria 3688
338 Ga0207652_10048214 3300025921 Bacteria 3641
339 Ga0207652_10067849 3300025921 Bacteria 3093
340 Ga0207652_10116597 3300025921 Bacteria 2372
341 Ga0207646_10001932 3300025922 Bacteria 24884
342 Ga0207681_10001040 3300025923 Bacteria 17999
343 Ga0207681_10001982 3300025923 Bacteria 13144
344 Ga0207650_10005684 3300025925 Bacteria 8509
345 Ga0207650_10011860 3300025925 Bacteria 6004
346 Ga0207650_10014987 3300025925 Bacteria 5391
347 Ga0207650_10075851 3300025925 Bacteria 2539
348 Ga0207659_10007435 3300025926 Bacteria 6734
349 Ga0207659_10056736 3300025926 Bacteria 2806
350 Ga0207659_10117648 3300025926 Unclassified 2031
351 Ga0207664_10009605 3300025929 Bacteria 6797
352 Ga0207664_10161547 3300025929 Unclassified 1911
353 Ga0207644_10027682 3300025931 Bacteria 3918
354 Ga0207690_10023707 3300025932 Bacteria 3834
355 Ga0207690_10065771 3300025932 Bacteria 2480
356 Ga0207690_10076811 3300025932 Bacteria 2320
357 Ga0207706_10001070 3300025933 Bacteria 27801
358 Ga0207706_10001678 3300025933 Bacteria 21871
359 Ga0207706_10003094 3300025933 Bacteria 15992
360 Ga0207706_10024203 3300025933 Bacteria 5443
361 Ga0207706_10032861 3300025933 Bacteria 4617
362 Ga0207706_10053663 3300025933 Bacteria 3558
363 Ga0207706_10061015 3300025933 Bacteria 3320
364 Ga0207706_10066171 3300025933 Bacteria 3181
365 Ga0207686_10012031 3300025934 Unclassified 4752
366 Ga0207670_10061582 3300025936 Bacteria 2561
367 Ga0207669_10074567 3300025937 Bacteria 2146
368 Ga0207669_10115897 3300025937 Unclassified 1807
369 Ga0207704_10002871 3300025938 Bacteria 7786
370 Ga0207704_10077506 3300025938 Unclassified 2134
371 Ga0207665_10000392 3300025939 Bacteria 29995
372 Ga0207691_10000109 3300025940 Bacteria 73421
373 Ga0207691_10009194 3300025940 Bacteria 9485
374 Ga0207691_10018531 3300025940 Bacteria 6597
375 Ga0207691_10032695 3300025940 Bacteria 4849
376 Ga0207691_10092373 3300025940 Bacteria 2710
377 Ga0207691_10250835 3300025940 Bacteria 1528
378 Ga0207711_10033185 3300025941 Unclassified 4366
379 Ga0207711_10118553 3300025941 Unclassified 2361
380 Ga0207711_10177113 3300025941 Bacteria 1938
381 Ga0207711_10254601 3300025941 Unclassified 1613
382 Ga0207689_10018204 3300025942 Bacteria 5930
383 Ga0207661_10000259 3300025944 Bacteria 34162
384 Ga0207661_10004553 3300025944 Bacteria 9720
385 Ga0207661_10028431 3300025944 Bacteria 4281
386 Ga0207661_10048550 3300025944 Bacteria 3374
387 Ga0207661_10055903 3300025944 Unclassified 3167
388 Ga0207661_10157581 3300025944 Unclassified 1968
389 Ga0207679_10001249 3300025945 Bacteria 16150
390 Ga0207679_10005291 3300025945 Bacteria 8097
391 Ga0207679_10006640 3300025945 Bacteria 7321
392 Ga0207679_10007505 3300025945 Bacteria 6920
393 Ga0207679_10008469 3300025945 Bacteria 6550
394 Ga0207679_10017720 3300025945 Bacteria 4757
395 Ga0207679_10018068 3300025945 Bacteria 4716
396 Ga0207679_10021172 3300025945 Bacteria 4401
397 Ga0207679_10041610 3300025945 Unclassified 3296
398 Ga0207679_10175221 3300025945 Bacteria 1770
399 Ga0207667_10038146 3300025949 Bacteria 5132
400 Ga0207667_10047379 3300025949 Bacteria 4550
401 Ga0207712_10004302 3300025961 Bacteria 8987
402 Ga0207712_10005271 3300025961 Bacteria 8169
403 Ga0207668_10007562 3300025972 Bacteria 6465
404 Ga0207668_10014992 3300025972 Bacteria 4809
405 Ga0207668_10025475 3300025972 Bacteria 3829
406 Ga0207668_10402155 3300025972 Bacteria 1158
407 Ga0207677_10012389 3300026023 Bacteria 4900
408 Ga0207677_10019882 3300026023 Bacteria 4065
409 Ga0207703_10114716 3300026035 Bacteria 2304
410 Ga0207639_10020482 3300026041 Bacteria 4734
411 Ga0207639_10123613 3300026041 Bacteria 2130
412 Ga0207678_10059456 3300026067 Bacteria 3288
413 Ga0207678_10135366 3300026067 Bacteria 2102
414 Ga0207708_10001767 3300026075 Bacteria 15972
415 Ga0207708_10025271 3300026075 Bacteria 4492
416 Ga0207641_10045470 3300026088 Bacteria 3697
417 Ga0207641_10101336 3300026088 Bacteria 2537
418 Ga0207648_10015559 3300026089 Bacteria 6991
419 Ga0207648_10066041 3300026089 Bacteria 3155
420 Ga0207648_10089643 3300026089 Bacteria 2687
421 Ga0207648_10125678 3300026089 Unclassified 2256
422 Ga0207648_10234648 3300026089 Bacteria 1632
423 Ga0207676_10010465 3300026095 Bacteria 6607
424 Ga0207676_10048579 3300026095 Unclassified 3295
425 Ga0207674_10000081 3300026116 Bacteria 101724
426 Ga0207674_10004835 3300026116 Bacteria 16137
427 Ga0207674_10005912 3300026116 Bacteria 14478
428 Ga0207674_10011568 3300026116 Bacteria 9911
429 Ga0207674_10199808 3300026116 Bacteria 1948
430 Ga0207675_100003170 3300026118 Bacteria 16138
431 Ga0207675_100079840 3300026118 Bacteria 3066
432 Ga0207675_100153705 3300026118 Bacteria 2192
433 Ga0207683_10003448 3300026121 Bacteria 13790
434 Ga0207683_10074731 3300026121 Bacteria 2999
435 Ga0209968_1001374 3300027526 Bacteria 3689
436 Ga0209999_1006243 3300027543 Bacteria 2139
437 Ga0209971_1004108 3300027682 Bacteria 3448
438 Ga0209966_1001968 3300027695 Bacteria 3441
439 Ga0209998_10003546 3300027717 Bacteria 3403
440 Ga0268266_10065517 3300028379 Bacteria 3141
441 Ga0268265_10004350 3300028380 Bacteria 9846
442 Ga0268265_10006542 3300028380 Bacteria 7889
443 Ga0268264_10015398 3300028381 Bacteria 6270
444 Ga0268264_10128955 3300028381 Bacteria 2239
445 Ga0268264_10274984 3300028381 Bacteria 1575
446 Ga0307408_100004628 3300031548 Bacteria 9300
447 Ga0307408_100004704 3300031548 Bacteria 9219
448 Ga0307408_100008590 3300031548 Bacteria 6746
449 Ga0307408_100177555 3300031548 Bacteria 1705
450 Ga0307405_10015044 3300031731 Bacteria 4177
451 Ga0307405_10030794 3300031731 Unclassified 3150
452 Ga0307405_10051552 3300031731 Bacteria 2554
453 Ga0307413_10007860 3300031824 Bacteria 4988
454 Ga0307413_10047817 3300031824 Bacteria 2553
455 Ga0307410_10000493 3300031852 Bacteria 16042
456 Ga0307410_10001932 3300031852 Bacteria 9723
457 Ga0307410_10023804 3300031852 Bacteria 3815
458 Ga0307410_10041342 3300031852 Bacteria 3039
459 Ga0307406_10003932 3300031901 Bacteria 8072
460 Ga0307406_10013166 3300031901 Bacteria 4733
461 Ga0307407_10001287 3300031903 Bacteria 8959
462 Ga0307407_10018844 3300031903 Bacteria 3501
463 Ga0307407_10028487 3300031903 Bacteria 2986
464 Ga0307412_10010584 3300031911 Bacteria 5314
465 Ga0307412_10024461 3300031911 Bacteria 3728
466 Ga0307412_10088607 3300031911 Unclassified 2159
467 Ga0307409_100003324 3300031995 Bacteria 8695
468 Ga0307409_100029749 3300031995 Bacteria 3913
469 Ga0307409_100045217 3300031995 Unclassified 3322
470 Ga0307409_100076915 3300031995 Bacteria 2678
471 Ga0307416_100003449 3300032002 Bacteria 9286
472 Ga0307416_100004147 3300032002 Bacteria 8683
473 Ga0307416_100044163 3300032002 Bacteria 3496
474 Ga0307416_100080801 3300032002 Bacteria 2746
475 Ga0307416_100106907 3300032002 Unclassified 2454
476 Ga0307416_100163902 3300032002 Bacteria 2059
477 Ga0307414_10005899 3300032004 Bacteria 6778
478 Ga0307414_10022451 3300032004 Bacteria 3980
479 Ga0307414_10105264 3300032004 Unclassified 2133
480 Ga0307411_10000330 3300032005 Bacteria 15843
481 Ga0307411_10010918 3300032005 Bacteria 4870
482 Ga0307411_10061227 3300032005 Bacteria 2504
483 Ga0307415_100000550 3300032126 Bacteria 16427
484 Ga0307415_100005346 3300032126 Bacteria 6804
485 Ga0307415_100040027 3300032126 Bacteria 3102
486 Ga0307415_100236197 3300032126 Bacteria 1475
487 Ga0373944_0029935 3300035089 Bacteria 1630
488 Ga0373941_0048785 3300035115 Unclassified 1338
489 Ga0373960_0015989 3300035121 Bacteria 1924
490 Ga0373931_0015707 3300035691 Bacteria 3716
491 Ga0373931_0154326 3300035691 Unclassified 1341
492 Ga0373935_0098325 3300035692 Bacteria 1926
493 Ga0373947_0095334 3300035725 Unclassified 1862
494 Ga0436365_1909907 3300039437 Bacteria 2608
495 Ga0439455_0006554 3300042012 Bacteria 2424
496 Ga0451576_0161085 3300045051 Bacteria 2342
497 Ga0451576_0220905 3300045051 Unclassified 1978
498 Ga0466958_0204473 3300045836 Bacteria 1257
499 Ga0466967_0005498 3300045976 Bacteria 8790
500 Ga0495580_0100843 3300046472 Unclassified 2008
501 Ga0495639_0086280 3300046475 Bacteria 1468
502 Ga0495621_0041175 3300046539 Bacteria 1621
503 Ga0495588_0088840 3300046674 Bacteria 1618
504 Ga0495657_0162524 3300046675 Bacteria 1381
505 Ga0495613_0037463 3300046689 Bacteria 3595
506 Ga0495600_0138420 3300046809 Bacteria 1580
507 Ga0495685_038356 3300047447 Bacteria 1642
508 Ga0496106_0362011 3300048909 Bacteria 1165
509 Ga0496107_0236864 3300048910 Unclassified 1358
510 Ga0496108_0042718 3300048911 Bacteria 3785
511 Ga0496108_0190136 3300048911 Bacteria 1779
512 Ga0496109_0415751 3300048912 Bacteria 1271
513 Ga0496112_0008257 3300048915 Bacteria 9317
514 Ga0496112_0059436 3300048915 Unclassified 3766
515 Ga0496112_0222467 3300048915 Bacteria 1843
516 Ga0496113_0061743 3300048916 Bacteria 2828
517 Ga0496113_0071818 3300048916 Bacteria 2633
518 Ga0496115_0524578 3300048918 Bacteria 949
519 Ga0501299_017865 3300049522 Unclassified 1270
520 Ga0501033_0001992 3300049570 Bacteria 17800
521 Ga0501037_0080864 3300049573 Bacteria 2357
522 Ga0501039_0172608 3300049575 Unclassified 1700
523 Ga0501040_0004685 3300049576 Bacteria 8875
524 Ga0501042_0170649 3300049578 Bacteria 1569
525 Ga0501047_0012075 3300049581 Bacteria 8175
526 Ga0501048_0022002 3300049582 Bacteria 4667
527 Ga0501070_0076783 3300049586 Bacteria 2765
528 Ga0501075_0012812 3300049591 Bacteria 5969
529 Ga0501075_0176165 3300049591 Bacteria 1632
530 Ga0501209_017988 3300049656 Unclassified 1625
531 Ga0501222_004609 3300049662 Unclassified 1872
532 Ga0501233_003005 3300049668 Unclassified 3014
533 Ga0501235_000227 3300049669 Bacteria 10227
534 Ga0501242_005975 3300049674 Bacteria 1382
535 Ga0501249_002328 3300049679 Unclassified 3839
536 Ga0501252_001704 3300049682 Bacteria 2083
537 Ga0501253_001419 3300049683 Unclassified 2441
538 Ga0501258_002506 3300049687 Bacteria 1617
539 Ga0501261_008951 3300049690 Bacteria 1300
540 Ga0501221_000046 3300049704 Bacteria 12773
541 Ga0501225_0009295 3300049705 Unclassified 2801
542 Ga0501234_000477 3300049707 Bacteria 6142
543 Ga0501080_0190950 3300049742 Bacteria 1882
544 Ga0501081_0029948 3300049743 Bacteria 3681
545 Ga0501268_000234 3300049765 Bacteria 5532
546 Ga0501035_0226632 3300049822 Bacteria 1594
547 Ga0501044_0010699 3300049823 Bacteria 9954
548 Ga0501212_000447 3300049851 Unclassified 3979
549 nmdc:mga05p37_25594_c1 3300050507 Bacteria 7178
550 nmdc:mga09592_113900_c1 3300050508 Bacteria 2321
551 nmdc:mga09592_214464_c1 3300050508 Bacteria 1668
552 nmdc:mga09592_56396_c1 3300050508 Bacteria 3320
553 nmdc:mga0qj67_3559_c1 3300050509 Bacteria 11246
554 nmdc:mga0qj67_4207_c1 3300050509 Bacteria 10427
555 nmdc:mga0qj67_8766_c1 3300050509 Bacteria 7506
556 nmdc:mga0qj67_95095_c1 3300050509 Bacteria 2398
557 nmdc:mga06r32_11115_c1 3300050510 Bacteria 8104
558 nmdc:mga06r32_171184_c1 3300050510 Bacteria 2155
559 nmdc:mga06r32_35914_c1 3300050510 Bacteria 4678
560 nmdc:mga06r32_77267_c1 3300050510 Bacteria 3234
561 nmdc:mga08y16_618979_c1 3300050511 Bacteria 1090
562 nmdc:mga0n895_152345_c1 3300050512 Unclassified 2343
563 nmdc:mga0n895_223921_c1 3300050512 Bacteria 1909
564 nmdc:mga0n895_27862_c1 3300050512 Bacteria 5368
565 nmdc:mga0n895_5147_c1 3300050512 Bacteria 10874
566 nmdc:mga08x19_104685_c1 3300050514 Unclassified 1881
567 nmdc:mga0a205_9582_c1 3300050515 Bacteria 8863
568 Ga0501084_0352035 3300054114 Bacteria 1244
569 Ga0501082_0165566 3300060353 Bacteria 1921
570 Ga0065715_10009928
571 MRS1b_contig_1165057
572 Ga0065712_10073456
573 Ga0065715_10158917
574 Ga0070658_10004789
575 Ga0070658_10006900
576 Ga0070658_10009328
577 Ga0070658_10011442
578 Ga0070658_10085910
579 Ga0070658_10146239
580 Ga0070658_10202789
581 Ga0070676_10005019
582 Ga0070676_10010033
583 Ga0070676_10029694
584 Ga0070676_10058364
585 Ga0070676_10071636
586 Ga0070683_100005515
587 Ga0070683_100009152
588 Ga0070683_100010052
589 Ga0070683_100021633
590 Ga0070683_100047880
591 Ga0070683_100053812
592 Ga0070683_100072423
593 Ga0070683_100130543
594 Ga0070690_100013121
595 Ga0070670_100007484
596 Ga0070670_100012824
597 Ga0070670_100074551
598 Ga0070670_100109216
599 Ga0070670_100116523
600 Ga0070677_10035381
601 Ga0068869_100006235
602 Ga0068869_100103072
603 Ga0070666_10107508
604 Ga0070680_100059772
605 Ga0070680_100081615
606 Ga0070680_100106488
607 Ga0070682_100007301
608 Ga0070682_100007510
609 Ga0070682_100012590
610 Ga0070682_100014171
611 Ga0070682_100036576
612 Ga0068868_100001747
613 Ga0068868_100005459
614 Ga0068868_100041291
615 Ga0070660_100020487
616 Ga0070660_100029469
617 Ga0070660_100067257
618 Ga0070660_100074020
619 Ga0070689_100005456
620 Ga0070687_100005807
621 Ga0070687_100007863
622 Ga0070661_100004942
623 Ga0070661_100018467
624 Ga0070661_100034417
625 Ga0070661_100043123
626 Ga0070661_100085849
627 Ga0070661_100092599
628 Ga0070661_100099606
629 Ga0070661_100241222
630 Ga0070692_10006542
631 Ga0070692_10011558
632 Ga0070692_10014916
633 Ga0070692_10023315
634 Ga0070692_10117264
635 Ga0070668_100002912
636 Ga0070669_100008984
637 Ga0070675_100008799
638 Ga0070675_100026963
639 Ga0070675_100068231
640 Ga0070671_100040437
641 Ga0070674_100023876
642 Ga0070673_100018371
643 Ga0070673_100027811
644 Ga0070673_100119453
645 Ga0070688_100003789
646 Ga0070688_100069349
647 Ga0070659_100000186
648 Ga0070659_100013186
649 Ga0070659_100024770
650 Ga0070659_100051568
651 Ga0070667_100009605
652 Ga0070667_100052480
653 Ga0070709_10001271
654 Ga0070714_100017114
655 Ga0070710_10003336
656 Ga0070711_100018838
657 Ga0070700_100027130
658 Ga0070694_100028473
659 Ga0070708_100000900
660 Ga0070663_100014357
661 Ga0070663_100090248
662 Ga0070678_100077315
663 Ga0070662_100000676
664 Ga0070662_100010507
665 Ga0070662_100037579
666 Ga0070662_100041499
667 Ga0070662_100116270
668 Ga0070662_100175677
669 Ga0070662_100284020
670 Ga0070681_10000554
671 Ga0070681_10009944
672 Ga0070681_10026497
673 Ga0070681_10032752
674 Ga0070681_10192739
675 Ga0070681_10299551
676 Ga0068867_100006875
677 Ga0068867_100057666
678 Ga0068867_100069583
679 Ga0070685_10014111
680 Ga0070685_10026497
681 Ga0070706_100104330
682 Ga0070706_100131408
683 Ga0070698_100008862
684 Ga0070699_100022869
685 Ga0070699_100187958
686 Ga0070699_100311022
687 Ga0070679_100003536
688 Ga0070679_100011906
689 Ga0070679_100015959
690 Ga0070679_100024359
691 Ga0070679_100030914
692 Ga0070679_100049323
693 Ga0070679_100093660
694 Ga0070679_100157082
695 Ga0070684_100004423
696 Ga0070684_100004624
697 Ga0070684_100012801
698 Ga0070684_100013734
699 Ga0070684_100022724
700 Ga0070684_100028829
701 Ga0070684_100068550
702 Ga0068853_100017663
703 Ga0068853_100018867
704 Ga0070672_100022821
705 Ga0070672_100058841
706 Ga0070672_100063839
707 Ga0070686_100079015
708 Ga0070695_100008935
709 Ga0070695_100017337
710 Ga0070695_100163132
711 Ga0070696_100026322
712 Ga0070693_100003324
713 Ga0070693_100008492
714 Ga0070693_100061481
715 Ga0070665_100066866
716 Ga0070665_100073255
717 Ga0068855_100001763
718 Ga0068855_100013745
719 Ga0068855_100032291
720 Ga0068855_100039331
721 Ga0068855_100072437
722 Ga0070664_100002389
723 Ga0070664_100011832
724 Ga0070664_100016836
725 Ga0070664_100020912
726 Ga0070664_100026483
727 Ga0070664_100106834
728 Ga0070664_100111539
729 Ga0070664_100202831
730 Ga0068857_100007029
731 Ga0068857_100022417
732 Ga0068857_100039600
733 Ga0068857_100059701
734 Ga0068854_100056453
735 Ga0068856_100021955
736 Ga0070702_100005827
737 Ga0070702_100033126
738 Ga0068852_100010225
739 Ga0068859_100070939
740 Ga0068859_100275900
741 Ga0068864_100019986
742 Ga0068864_100036453
743 Ga0068866_10026799
744 Ga0068866_10148078
745 Ga0068861_100032074
746 Ga0068851_10008230
747 Ga0068851_10012965
748 Ga0068870_10007972
749 Ga0068863_100022492
750 Ga0068863_100040700
751 Ga0068863_100116763
752 Ga0068858_100042404
753 Ga0068858_100482104
754 Ga0068860_100022585
755 Ga0068860_100056820
756 Ga0068860_100068085
757 Ga0068860_100197830
758 Ga0068862_100000266
759 Ga0068862_100018270
760 Ga0081539_10021382
761 Ga0070716_100001493
762 Ga0097621_100028188
763 Ga0068871_100042105
764 Ga0075428_100007832
765 Ga0075428_100117073
766 Ga0075428_100195936
767 Ga0075430_100002577
768 Ga0075430_100005810
769 Ga0075430_100010448
770 Ga0075431_100008288
771 Ga0075431_100053299
772 Ga0075431_100104888
773 Ga0075431_100195109
774 Ga0075433_10008693
775 Ga0075433_10076100
776 Ga0075434_100286622
777 Ga0075429_100043617
778 Ga0075429_100106166
779 Ga0068865_100003397
780 Ga0068865_100024669
781 Ga0075436_100001767
782 Ga0097620_100054113
783 Ga0097620_100070938
784 Ga0097620_100275885
785 Ga0075435_100114579
786 Ga0105240_10317225
787 Ga0111539_10028762
788 Ga0105245_10032628
789 Ga0105245_10070983
790 Ga0114129_10015180
791 Ga0114129_10043725
792 Ga0105243_10326812
793 Ga0105241_10012725
794 Ga0105241_10200680
795 Ga0105242_10013973
796 Ga0105242_10018857
797 Ga0105242_10031780
798 Ga0105242_10056427
799 Ga0105248_10008399
800 Ga0105248_10012636
801 Ga0105248_10041683
802 Ga0105248_10060962
803 Ga0105248_10080092
804 Ga0105248_10156529
805 Ga0105237_10040232
806 Ga0105249_10000199
807 Ga0105249_10011111
808 Ga0099796_10008603
809 Ga0105239_10010717
810 Ga0105246_10005862
811 Ga0157373_10027322
812 Ga0157373_10056584
813 Ga0157373_10097337
814 Ga0157373_10147584
815 Ga0157371_10009627
816 Ga0157371_10031456
817 Ga0157371_10054043
818 Ga0157370_10031129
819 Ga0157370_10035184
820 Ga0157369_10067506
821 Ga0157369_10136505
822 Ga0157369_10310592
823 Ga0157374_10051859
824 Ga0157378_10016876
825 Ga0157378_10017313
826 Ga0157378_10071174
827 Ga0157378_10206996
828 Ga0163162_10007224
829 Ga0163162_10018423
830 Ga0157372_10002220
831 Ga0157372_10004585
832 Ga0157372_10004618
833 Ga0157372_10018747
834 Ga0157372_10023423
835 Ga0157372_10027838
836 Ga0157372_10028968
837 Ga0157372_10035454
838 Ga0157372_10085437
839 Ga0157372_10116251
840 Ga0157372_10437730
841 Ga0157375_10015665
842 Ga0157375_10024573
843 Ga0157375_10037922
844 Ga0157375_10107270
845 Ga0157375_10184839
846 Ga0157375_10225059
847 Ga0163163_10016675
848 Ga0163163_10204949
849 Ga0157380_10011261
850 Ga0157380_10020606
851 Ga0157377_10001755
852 Ga0157377_10035261
853 Ga0157377_10046011
854 Ga0157379_10007895
855 Ga0157376_10005703
856 Ga0163161_10014742
857 Ga0163161_10021070
858 Ga0163161_10094535
859 Ga0207697_10001123
860 Ga0207656_10008771
861 Ga0207656_10129545
862 Ga0207682_10020672
863 Ga0207692_10011360
864 Ga0207642_10052811
865 Ga0207680_10135168
866 Ga0207680_10276019
867 Ga0207647_10044584
868 Ga0207645_10000183
869 Ga0207645_10017224
870 Ga0207645_10125409
871 Ga0207645_10170906
872 Ga0207643_10010824
873 Ga0207643_10040300
874 Ga0207705_10001349
875 Ga0207705_10010351
876 Ga0207705_10047758
877 Ga0207684_10062688
878 Ga0207684_10316541
879 Ga0207654_10019155
880 Ga0207707_10014789
881 Ga0207707_10016422
882 Ga0207707_10043588
883 Ga0207707_10047565
884 Ga0207707_10075168
885 Ga0207707_10137222
886 Ga0207707_10293139
887 Ga0207660_10009226
888 Ga0207660_10010778
889 Ga0207660_10024581
890 Ga0207660_10102826
891 Ga0207660_10129460
892 Ga0207662_10000847
893 Ga0207662_10010007
894 Ga0207657_10017403
895 Ga0207657_10031682
896 Ga0207657_10035223
897 Ga0207657_10040755
898 Ga0207657_10094189
899 Ga0207649_10006161
900 Ga0207649_10008781
901 Ga0207649_10018562
902 Ga0207649_10047122
903 Ga0207649_10078724
904 Ga0207649_10141229
905 Ga0207652_10011520
906 Ga0207652_10046948
907 Ga0207652_10048214
908 Ga0207652_10067849
909 Ga0207652_10116597
910 Ga0207646_10001932
911 Ga0207681_10001040
912 Ga0207681_10001982
913 Ga0207650_10005684
914 Ga0207650_10011860
915 Ga0207650_10014987
916 Ga0207650_10075851
917 Ga0207659_10007435
918 Ga0207659_10056736
919 Ga0207659_10117648
920 Ga0207664_10009605
921 Ga0207664_10161547
922 Ga0207644_10027682
923 Ga0207690_10023707
924 Ga0207690_10065771
925 Ga0207690_10076811
926 Ga0207706_10001070
927 Ga0207706_10001678
928 Ga0207706_10003094
929 Ga0207706_10024203
930 Ga0207706_10032861
931 Ga0207706_10053663
932 Ga0207706_10061015
933 Ga0207706_10066171
934 Ga0207686_10012031
935 Ga0207670_10061582
936 Ga0207669_10074567
937 Ga0207669_10115897
938 Ga0207704_10002871
939 Ga0207704_10077506
940 Ga0207665_10000392
941 Ga0207691_10000109
942 Ga0207691_10009194
943 Ga0207691_10018531
944 Ga0207691_10032695
945 Ga0207691_10092373
946 Ga0207691_10250835
947 Ga0207711_10033185
948 Ga0207711_10118553
949 Ga0207711_10177113
950 Ga0207711_10254601
951 Ga0207689_10018204
952 Ga0207661_10000259
953 Ga0207661_10004553
954 Ga0207661_10028431
955 Ga0207661_10048550
956 Ga0207661_10055903
957 Ga0207661_10157581
958 Ga0207679_10001249
959 Ga0207679_10005291
960 Ga0207679_10006640
961 Ga0207679_10007505
962 Ga0207679_10008469
963 Ga0207679_10017720
964 Ga0207679_10018068
965 Ga0207679_10021172
966 Ga0207679_10041610
967 Ga0207679_10175221
968 Ga0207667_10038146
969 Ga0207667_10047379
970 Ga0207712_10004302
971 Ga0207712_10005271
972 Ga0207668_10007562
973 Ga0207668_10014992
974 Ga0207668_10025475
975 Ga0207668_10402155
976 Ga0207677_10012389
977 Ga0207677_10019882
978 Ga0207703_10114716
979 Ga0207639_10020482
980 Ga0207639_10123613
981 Ga0207678_10059456
982 Ga0207678_10135366
983 Ga0207708_10001767
984 Ga0207708_10025271
985 Ga0207641_10045470
986 Ga0207641_10101336
987 Ga0207648_10015559
988 Ga0207648_10066041
989 Ga0207648_10089643
990 Ga0207648_10125678
991 Ga0207648_10234648
992 Ga0207676_10010465
993 Ga0207676_10048579
994 Ga0207674_10000081
995 Ga0207674_10004835
996 Ga0207674_10005912
997 Ga0207674_10011568
998 Ga0207674_10199808
999 Ga0207675_100003170
1000 Ga0207675_100079840
1001 Ga0207675_100153705
1002 Ga0207683_10003448
1003 Ga0207683_10074731
1004 Ga0209968_1001374
1005 Ga0209999_1006243
1006 Ga0209971_1004108
1007 Ga0209966_1001968
1008 Ga0209998_10003546
1009 Ga0268266_10065517
1010 Ga0268265_10004350
1011 Ga0268265_10006542
1012 Ga0268264_10015398
1013 Ga0268264_10128955
1014 Ga0268264_10274984
1015 Ga0307408_100004628
1016 Ga0307408_100004704
1017 Ga0307408_100008590
1018 Ga0307408_100177555
1019 Ga0307405_10015044
1020 Ga0307405_10030794
1021 Ga0307405_10051552
1022 Ga0307413_10007860
1023 Ga0307413_10047817
1024 Ga0307410_10000493
1025 Ga0307410_10001932
1026 Ga0307410_10023804
1027 Ga0307410_10041342
1028 Ga0307406_10003932
1029 Ga0307406_10013166
1030 Ga0307407_10001287
1031 Ga0307407_10018844
1032 Ga0307407_10028487
1033 Ga0307412_10010584
1034 Ga0307412_10024461
1035 Ga0307412_10088607
1036 Ga0307409_100003324
1037 Ga0307409_100029749
1038 Ga0307409_100045217
1039 Ga0307409_100076915
1040 Ga0307416_100003449
1041 Ga0307416_100004147
1042 Ga0307416_100044163
1043 Ga0307416_100080801
1044 Ga0307416_100106907
1045 Ga0307416_100163902
1046 Ga0307414_10005899
1047 Ga0307414_10022451
1048 Ga0307414_10105264
1049 Ga0307411_10000330
1050 Ga0307411_10010918
1051 Ga0307411_10061227
1052 Ga0307415_100000550
1053 Ga0307415_100005346
1054 Ga0307415_100040027
1055 Ga0307415_100236197
1056 Ga0373944_0029935
1057 Ga0373941_0048785
1058 Ga0373960_0015989
1059 Ga0373931_0015707
1060 Ga0373931_0154326
1061 Ga0373935_0098325
1062 Ga0373947_0095334
1063 Ga0436365_1909907
1064 Ga0439455_0006554
1065 Ga0451576_0161085
1066 Ga0451576_0220905
1067 Ga0466958_0204473
1068 Ga0466967_0005498
1069 Ga0495580_0100843
1070 Ga0495639_0086280
1071 Ga0495621_0041175
1072 Ga0495588_0088840
1073 Ga0495657_0162524
1074 Ga0495613_0037463
1075 Ga0495600_0138420
1076 Ga0495685_038356
1077 Ga0496106_0362011
1078 Ga0496107_0236864
1079 Ga0496108_0042718
1080 Ga0496108_0190136
1081 Ga0496109_0415751
1082 Ga0496112_0008257
1083 Ga0496112_0059436
1084 Ga0496112_0222467
1085 Ga0496113_0061743
1086 Ga0496113_0071818
1087 Ga0496115_0524578
1088 Ga0501299_017865
1089 Ga0501033_0001992
1090 Ga0501037_0080864
1091 Ga0501039_0172608
1092 Ga0501040_0004685
1093 Ga0501042_0170649
1094 Ga0501047_0012075
1095 Ga0501048_0022002
1096 Ga0501070_0076783
1097 Ga0501075_0012812
1098 Ga0501075_0176165
1099 Ga0501209_017988
1100 Ga0501222_004609
1101 Ga0501233_003005
1102 Ga0501235_000227
1103 Ga0501242_005975
1104 Ga0501249_002328
1105 Ga0501252_001704
1106 Ga0501253_001419
1107 Ga0501258_002506
1108 Ga0501261_008951
1109 Ga0501221_000046
1110 Ga0501225_0009295
1111 Ga0501234_000477
1112 Ga0501080_0190950
1113 Ga0501081_0029948
1114 Ga0501268_000234
1115 Ga0501035_0226632
1116 Ga0501044_0010699
1117 Ga0501212_000447
1118 nmdc:mga05p37_25594_c1
1119 nmdc:mga09592_113900_c1
1120 nmdc:mga09592_214464_c1
1121 nmdc:mga09592_56396_c1
1122 nmdc:mga0qj67_3559_c1
1123 nmdc:mga0qj67_4207_c1
1124 nmdc:mga0qj67_8766_c1
1125 nmdc:mga0qj67_95095_c1
1126 nmdc:mga06r32_11115_c1
1127 nmdc:mga06r32_171184_c1
1128 nmdc:mga06r32_35914_c1
1129 nmdc:mga06r32_77267_c1
1130 nmdc:mga08y16_618979_c1
1131 nmdc:mga0n895_152345_c1
1132 nmdc:mga0n895_223921_c1
1133 nmdc:mga0n895_27862_c1
1134 nmdc:mga0n895_5147_c1
1135 nmdc:mga08x19_104685_c1
1136 nmdc:mga0a205_9582_c1
1137 Ga0501084_0352035
1138 Ga0501082_0165566

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
4xm8-assembly1.cif.gz_A anthrax toxin lethal factor with ligand-induced binding pocket 0.6465 90 200
5or5-assembly1.cif.gz_A nmr structure of the complex formed by an engineered region 2 of sigmae in complex with gtaaaa 0.546 239 333
1pwp-assembly1.cif.gz_A crystal structure of the anthrax lethal factor complexed with small molecule inhibitor nsc 12155 0.4918 28 200
4pkr-assembly1.cif.gz_A anthrax toxin lethal factor with bound small molecule inhibitor 10 0.474 28 200
5or5-assembly1.cif.gz_A nmr structure of the complex formed by an engineered region 2 of sigmae in complex with gtaaaa 0.4733 239 333
ID Description Score Start End Superfamily
4lupC00 Mainly Alpha;Orthogonal Bundle;Rna Polymerase Sigma Factor; Chain: A;RNA polymerase sigma factor, region 2, helix turn helix motif 0.5789 239 333 1.10.1740.10
af_Q9UTM8_17_271_3.40.605.10 Alpha Beta;3-Layer(aba) Sandwich;Aldehyde Dehydrogenase; Chain A, domain 1;Aldehyde Dehydrogenase; Chain A, domain 1 0.5648 263 301 3.40.605.10
3cqbA01 "Alpha Beta;2-Layer Sandwich;Zincin-like;Metalloproteases (""zincins""), catalytic domain" 0.5619 24 110 3.30.2010.10
2mapA00 Mainly Alpha;Orthogonal Bundle;Rna Polymerase Sigma Factor; Chain: A;RNA polymerase sigma factor, region 2, helix turn helix motif 0.5562 239 330 1.10.1740.10
5or5A00 Mainly Alpha;Orthogonal Bundle;Rna Polymerase Sigma Factor; Chain: A;RNA polymerase sigma factor, region 2, helix turn helix motif 0.546 239 333 1.10.1740.10
ID Description Score Start End GO Terms
AF-A0A0S8HGH8-F1-model_v4 Uncharacterized protein 0.9902 262 327
AF-A0A7V4UPC7-F1-model_v4 Uncharacterized protein 0.9816 238 331
AF-A0A2V9Q6A6-F1-model_v4 Zinc-binding metallo-peptidase 0.9727 13 162
AF-A0A3N5VN99-F1-model_v4 DUF2268 domain-containing protein 0.9665 8 230
AF-A0A7V4UPM6-F1-model_v4 Zinc-binding metallo-peptidase 0.9627 12 175

Map