F464684

General Info

Members Datasets Scaffolds Average Seq Length
568 522 162 279

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|3004195979|3004196672
Length 307
Sequence GMGELHLDIIVDRMRREFKVEANVGAPQVAYRETITRKHEQDYTHKKQTGGTGQFARVKILFEPNPDSSEFEFDTKIVGGAVPIGSPLQLEAIKPTGTKGFLDRRELIAVNIGGVGVITTGGQSFELQARDMLYLGMGTQDVSFASADEGAPAKFYLLSAPAHLAHPSRLIRIGDAKRLDLGSKDACNERSIFQFIHADGAKTCQLVVGMTQLAPGSIWNTMPCHVHDRRMEAYLYFDLAETARVFHFMGEPDETRHIVMANEEAVLSPGWSIHSGAGTSNYAFIWAMAGDNVDYTDVDPVALGDLR

Samples

Sample ID Description Type Environment
1 2503198000 Mesorhizobium opportunistum WSM2075 Isolate Nodule
2 2508501123 Mesorhizobium sp. WSM3626 Isolate Nodule
3 2508501127 Mesorhizobium sp. WSM2561 Isolate Nodule
4 2509276018 Mesorhizobium ciceri CMG6 Isolate Nodule
5 2509276019 Ensifer aridi TW10 Isolate Nodule
6 2509276022 Mesorhizobium australicum WSM2073 Isolate Nodule
7 2510065057 Sinorhizobium meliloti WSM1022 Isolate Nodule
8 2510065059 Mesorhizobium ciceri WSM4083 Isolate Nodule
9 2510461069 Rhizobium sp. PDO1-076 Isolate Rhizosphere
10 2510917028 Rhizobium sp. CF122 Isolate Rhizosphere
11 2511231027 Phyllobacterium sp. YR531 Isolate Rhizosphere
12 2511231052 Sinorhizobium meliloti AK58 Isolate Nodule
13 2512047086 Sinorhizobium arboris LMG 14919 Isolate Nodule
14 2513237086 Sinorhizobium meliloti MVII-I Isolate Nodule
15 2513237088 Rhizobium mesoamericanum STM6155 Isolate Nodule
16 2513237089 Sinorhizobium medicae DI28 Isolate Nodule
17 2513237090 Mesorhizobium sp. WSM3224 Isolate Nodule
18 2513237091 Sinorhizobium meliloti RRI128 Isolate Nodule
19 2513237140 Sinorhizobium meliloti GVPV12 Isolate Nodule
20 2513237143 Sinorhizobium meliloti Mlalz-1 Isolate Nodule
21 2513237156 Sinorhizobium medicae WSM1369 Isolate Nodule
22 2513237159 Rhizobium giardinii bv. giardinii H152 Isolate Nodule
23 2513237160 Sinorhizobium medicae WSM244 Isolate Nodule
24 2513237351 Mesorhizobium alhagi CCNWXJ12-2 Isolate Nodule
25 2515154107 Sinorhizobium meliloti 4H41 Isolate Nodule
26 2516653046 Sinorhizobium meliloti BO21CC Isolate Nodule
27 2517487022 Sinorhizobium medicae WSM4191 Isolate Nodule
28 2524023207 Ensifer sp. USDA 6670 Isolate Nodule
29 2534681796 Rhizobium grahamii CCGE 502 Isolate Nodule
30 2551306084 Sinorhizobium meliloti 5A14 Isolate Nodule
31 2551306085 Sinorhizobium meliloti AE608H Isolate Nodule
32 2551306086 Sinorhizobium meliloti AK11 Isolate Nodule
33 2551306087 Sinorhizobium meliloti A0643DD Isolate Nodule
34 2551306089 Sinorhizobium meliloti 1A42 Isolate Nodule
35 2551306090 Sinorhizobium meliloti A0641M Isolate Nodule
36 2551306091 Sinorhizobium meliloti C0431A Isolate Nodule
37 2551306092 Sinorhizobium meliloti AK75 Isolate Nodule
38 2551306093 Sinorhizobium meliloti C0438LL Isolate Nodule
39 2558860100 Sinorhizobium sp. PC2 Isolate Nodule
40 2582581283 Rhizobium sp. OK665 Isolate Rhizosphere
41 2582581867 Rhizobium sp. OV201 Isolate Rhizosphere
42 2585427590 Rhizobium sp. CF048 Isolate Rhizosphere
43 2597489875 Mesorhizobium ciceri ca181 Isolate Unclassified
44 2599185301 Mesorhizobium sp. NFR06 Isolate Rhizoplane
45 2643221557 Ensifer sp. Root558 Isolate Unclassified
46 2643221595 Mesorhizobium sp. Root695 Isolate Unclassified
47 2643221627 Mesorhizobium sp. Root102 Isolate Unclassified
48 2643221668 Ensifer sp. Root423 Isolate Unclassified
49 2643221734 Bosea sp. Root670 Isolate Unclassified
50 2687453392 Mesorhizobium ciceri biserrulae WSM1284 Isolate Unclassified
51 2693429783 Mesorhizobium sp. LCM 4577 Isolate Rhizosphere
52 2693429784 Mesorhizobium sp. LCM 4576 Isolate Rhizosphere
53 2738543024 Aminobacter sp. AP02 Isolate Unclassified
54 2765235802 Phyllobacterium bourgognense 31-25a Isolate Rhizoplane
55 2767802442 Phyllobacterium brassicacearum 29-15 Isolate Rhizoplane
56 2775506902 Phyllobacterium zundukense Tri-48 Isolate Unclassified
57 2775506904 Phyllobacterium zundukense Tri-38 Isolate Unclassified
58 2791354903 Mangrovibacter phragmitis MP23 Isolate Unclassified
59 2791355091 Sinorhizobium sp. FG01 Isolate Nodule
60 2791355092 Sinorhizobium sp. NG07B Isolate Nodule
61 2791355123 Mesorhizobium sophorae ICMP 19535 Isolate Unclassified
62 2802428858 Sinorhizobium medicae M14-1 Isolate Nodule
63 2802428859 Sinorhizobium medicae SF3.41 Isolate Nodule
64 2802428860 Sinorhizobium medicae M19-1 Isolate Nodule
65 2802428861 Sinorhizobium medicae USDA1037 Isolate Nodule
66 2802428862 Sinorhizobium medicae M7-4 Isolate Nodule
67 2802428863 Sinorhizobium medicae M26-2 Isolate Nodule
68 2818991467 Bosea vestrisii 3192 Isolate Unclassified
69 2838074704 Sinorhizobium terangae SEMIA 6460 Isolate Unclassified
70 2840764183 Phyllobacterium sophorae CCBAU 03422 Isolate Unclassified
71 2841734538 Mesorhizobium sp. M6A.T.Cr.TU.016.01.1.1 Isolate Nodule
72 2842521101 Rhizobium giardinii SEMIA 4084 Isolate Nodule
73 2842871566 Phyllobacterium sp. R-73111 Isolate Unclassified
74 2844009547 Mesorhizobium sp. M7A.F.Ce.TU.012.03.2.1 Isolate Nodule
75 2850079185 Ensifer aridi JNVU TP6 Isolate Unclassified
76 2855825444 Sinorhizobium meliloti CXM1-105 Isolate Nodule
77 2855839649 Sinorhizobium meliloti AK555 Isolate Unclassified
78 2856320880 Mesorhizobium sp. M8A.F.Ca.ET.165.01.1.1 Isolate Nodule
79 2856328259 Mesorhizobium sp. Primo-B Isolate Nodule
80 2856334872 Mesorhizobium sp. M7A.F.Ca.US.005.03.1.1 Isolate Nodule
81 2856342000 Mesorhizobium sp. M5C.F.Cr.IN.023.01.1.1 Isolate Nodule
82 2857367948 Mesorhizobium sp. M7A.F.Ca.US.002.01.1.1 Isolate Nodule
83 2858800743 Sinorhizobium meliloti AK170 Isolate Unclassified
84 2869162929 Mesorhizobium sanjuanii BSA136 Isolate Nodule
85 2869169390 Mesorhizobium sp. M7A.F.Ca.CA.001.10.2.1 Isolate Nodule
86 2869234852 Mesorhizobium sp. M7A.T.Ca.US.000.02.2.1 Isolate Nodule
87 2869242130 Mesorhizobium sp. M7A.F.Ca.CA.004.11.2.1 Isolate Nodule
88 2869249662 Mesorhizobium sp. M7A.F.Ca.CA.001.16.1.1 Isolate Nodule
89 2869256925 Mesorhizobium sp. M7A.F.Ca.MR.176.00.0.0 Isolate Nodule
90 2869264136 Mesorhizobium sp. M7A.F.Ca.CA.001.15.1.1 Isolate Nodule
91 2869271264 Mesorhizobium sp. M7A.F.Ca.AU.002.06.1.1 Isolate Nodule
92 2869278585 Mesorhizobium sp. M8A.F.Ca.ET.198.01.1.1 Isolate Nodule
93 2871435913 Mesorhizobium sp. M7A.F.Ca.MR.228.00.0.0 Isolate Nodule
94 2871451962 Mesorhizobium sp. M7A.F.Ca.US.006.01.1.1 Isolate Nodule
95 2871459585 Mesorhizobium sp. M7A.F.Ca.CA.001.09.1.1 Isolate Nodule
96 2871474448 Mesorhizobium sp. M6A.T.Cr.TU.017.01.1.1 Isolate Nodule
97 2871481445 Mesorhizobium sp. M7A.F.Ca.CA.004.02.1.1 Isolate Nodule
98 2871495908 Mesorhizobium sp. M1C.F.Ca.ET.193.01.1.1 Isolate Nodule
99 2874123672 Mesorhizobium sp. M00.F.Ca.ET.216.01.1.1 Isolate Nodule
100 2874131515 Mesorhizobium sp. M7A.F.Ca.CA.001.05.1.1 Isolate Nodule
101 2874139085 Mesorhizobium sp. M8A.F.Ca.ET.207.01.1.1 Isolate Nodule
102 2874162495 Mesorhizobium sp. M7A.F.Ca.CA.002.11.2.1 Isolate Nodule
103 2874168670 Mesorhizobium kowhaii Ach-343 Isolate Nodule
104 2876369609 Mesorhizobium sp. USDA-HM6 Isolate Unclassified
105 2876386047 Mesorhizobium sp. M7A.F.Ca.CA.004.07.1.1 Isolate Nodule
106 2876392853 Mesorhizobium sp. M1D.F.Ca.ET.234.01.1.1 Isolate Nodule
107 2876399893 Mesorhizobium sp. M7A.F.Ca.AU.002.03.1.1 Isolate Nodule
108 2876406927 Mesorhizobium sp. M7A.F.Ca.CA.002.03.2.1 Isolate Nodule
109 2876420981 Mesorhizobium sp. M7A.F.Ca.CA.004.08.1.1 Isolate Nodule
110 2878730984 Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.1 Isolate Nodule
111 2878738818 Mesorhizobium sp. M8A.F.Ca.ET.218.01.1.1 Isolate Nodule
112 2878760144 Mesorhizobium sp. M1C.F.Ca.ET.192.01.1.1 Isolate Nodule
113 2878767105 Mesorhizobium sp. M1C.F.Ca.ET.144.01.1.1 Isolate Nodule
114 2878774303 Mesorhizobium sp. M7A.F.Ca.CA.002.15.1.1 Isolate Nodule
115 2878781027 Mesorhizobium sp. M7A.F.Ca.CA.001.12.2.1 Isolate Nodule
116 2881147464 Mesorhizobium sp. M1B.F.Ca.ET.045.04.1.1 Isolate Nodule
117 2881161766 Mesorhizobium sp. M1D.F.Ca.ET.043.01.1.1 Isolate Nodule
118 2885305155 Mesorhizobium sp. M1E.F.Ca.ET.045.02.1.1 Isolate Nodule
119 2885312484 Mesorhizobium sp. M9A.F.Ca.ET.002.03.1.2 Isolate Nodule
120 2885326080 Mesorhizobium sp. M1E.F.Ca.ET.041.01.1.1 Isolate Nodule
121 2888343758 Mesorhizobium sp. AA22 Isolate Unclassified
122 2894817345 Aureimonas psammosilenae YIM DR1026 Isolate Unclassified
123 2896384573 Ensifer sp. MPMI2T Isolate Unclassified
124 2903513507 Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.2 Isolate Nodule
125 2903540706 Mesorhizobium sp. M1C.F.Ca.ET.212.01.1.1 Isolate Nodule
126 2904659560 Mesorhizobium sp. M1D.F.Ca.ET.184.01.1.1 Isolate Nodule
127 2906363423 Mesorhizobium sp. M7A.F.Ca.CA.001.14.1.1 Isolate Nodule
128 2906370794 Mesorhizobium sp. M7A.F.Ca.CA.001.13.1.1 Isolate Nodule
129 2906386501 Mesorhizobium sp. M7A.F.Ca.CA.003.01.2.1 Isolate Nodule
130 2906393657 Mesorhizobium sp. M7A.F.Ca.CA.001.11.2.1 Isolate Nodule
131 2906401398 Mesorhizobium sp. M7A.F.Ca.CA.004.10.1.1 Isolate Nodule
132 2906408224 Mesorhizobium sp. M7A.F.Ca.CA.002.03.1.1 Isolate Nodule
133 2906427513 Mesorhizobium sp. M7A.F.Ca.CA.004.05.1.1 Isolate Nodule
134 2915980308 Sinorhizobium medicae USDA1149 Isolate Nodule
135 2915986958 Sinorhizobium meliloti USDA1659 Isolate Nodule
136 2915993759 Sinorhizobium meliloti USDA1336 Isolate Nodule
137 2916000859 Sinorhizobium meliloti USDA1562 Isolate Nodule
138 2916007675 Sinorhizobium meliloti USDA1289 Isolate Nodule
139 2916014648 Sinorhizobium meliloti USDA1583 Isolate Nodule
140 2916021584 Sinorhizobium meliloti USDA1550 Isolate Nodule
141 2916028427 Sinorhizobium meliloti USDA1613 Isolate Nodule
142 2916035215 Sinorhizobium meliloti 3011 Isolate Nodule
143 2916041962 Sinorhizobium meliloti USDA1795 Isolate Nodule
144 2916048683 Sinorhizobium meliloti USDA1796 Isolate Nodule
145 2916055098 Sinorhizobium meliloti USDA1770 Isolate Nodule
146 2916061851 Sinorhizobium medicae USDA1638 Isolate Nodule
147 2916068649 Sinorhizobium meliloti USDA1220 Isolate Nodule
148 2916076590 Sinorhizobium meliloti USDA1661 Isolate Nodule
149 2917699015 Bosea sp. F3-2 Isolate Rhizosphere
150 2920760137 Ensifer psoraleae CCBAU 65732 Isolate Unclassified
151 2920822456 Ensifer sesbaniae CCBAU 65729 Isolate Unclassified
152 2921201388 Sinorhizobium meliloti USDA1692 Isolate Nodule
153 2921208531 Sinorhizobium meliloti USDA1660 Isolate Nodule
154 2921237296 Sinorhizobium meliloti USDA1508 Isolate Nodule
155 2921244191 Sinorhizobium meliloti 2119 Isolate Nodule
156 2921250672 Sinorhizobium medicae USDA1169 Isolate Nodule
157 2921257292 Sinorhizobium meliloti USDA1320 Isolate Nodule
158 2921263974 Sinorhizobium meliloti USDA1107 Isolate Nodule
159 2921282425 Sinorhizobium meliloti USDA1203 Isolate Nodule
160 2921289301 Sinorhizobium meliloti USDA1730 Isolate Nodule
161 2922151315 Mesorhizobium sp. M7A.F.Ca.US.007.01.2.1 Isolate Nodule
162 2922172374 Mesorhizobium sp. M7A.F.Ca.CA.002.06.1.1 Isolate Nodule
163 2922178524 Mesorhizobium sp. M7A.F.Ca.CA.002.09.1.1 Isolate Nodule
164 2923556063 Rhizobium tibeticum 3740 Isolate Unclassified
165 2924144063 Sinorhizobium meliloti USDA1022 Isolate Nodule
166 2924150972 Sinorhizobium meliloti USDA1700 Isolate Nodule
167 2924158325 Sinorhizobium meliloti USDA1146 Isolate Nodule
168 2924165586 Sinorhizobium meliloti USDA1264 Isolate Nodule
169 2924172951 Sinorhizobium meliloti USDA1626 Isolate Nodule
170 2924179722 Sinorhizobium meliloti USDA1280 Isolate Nodule
171 2924186466 Sinorhizobium meliloti USDA1389 Isolate Nodule
172 2924193448 Sinorhizobium meliloti USDA1158 Isolate Nodule
173 2924200457 Sinorhizobium meliloti USDA1007 Isolate Nodule
174 2924207177 Sinorhizobium meliloti USDA1589 Isolate Nodule
175 2924214083 Sinorhizobium meliloti USDA1702 Isolate Nodule
176 2924221636 Sinorhizobium meliloti USDA1416 Isolate Nodule
177 2924228884 Sinorhizobium meliloti USDA1581 Isolate Nodule
178 2924718760 Mesorhizobium sp. M8A.F.Ca.ET.023.01.1.1 Isolate Nodule
179 2924733363 Mesorhizobium sp. M7A.F.Ca.US.011.01.1.1 Isolate Nodule
180 2924741084 Mesorhizobium sp. M7A.F.Ca.CA.004.09.1.2 Isolate Nodule
181 2924748358 Mesorhizobium sp. M7A.F.Ca.CA.002.14.1.2 Isolate Nodule
182 2924754689 Mesorhizobium sp. M5C.F.Ca.IN.020.32.2.1 Isolate Nodule
183 2924762789 Mesorhizobium sp. WSM4303 Isolate Unclassified
184 2924776078 Mesorhizobium sp. M8A.F.Ca.ET.213.01.1.1 Isolate Nodule
185 2936996657 Sinorhizobium meliloti USDA1025 Isolate Nodule
186 2937002841 Sinorhizobium meliloti USDA1006 Isolate Nodule
187 2937009748 Sinorhizobium meliloti USDA1162 Isolate Nodule
188 2937016420 Sinorhizobium meliloti USDA1027 Isolate Nodule
189 2937023124 Sinorhizobium meliloti USDA1335 Isolate Nodule
190 2937029754 Sinorhizobium medicae USDA1624 Isolate Nodule
191 2937036028 Sinorhizobium medicae USDA1608 Isolate Nodule
192 2937042894 Sinorhizobium meliloti USDA1687 Isolate Nodule
193 2937049772 Sinorhizobium meliloti USDA1691 Isolate Nodule
194 2937056579 Sinorhizobium meliloti USDA1357 Isolate Nodule
195 2937063883 Sinorhizobium meliloti USDA1808 Isolate Nodule
196 2937071275 Sinorhizobium meliloti USDA1623 Isolate Nodule
197 2937078374 Sinorhizobium medicae USDA1004 Isolate Nodule
198 2937084907 Sinorhizobium medicae USDA1664 Isolate Nodule
199 2937091812 Sinorhizobium meliloti USDA1221 Isolate Nodule
200 2937098957 Sinorhizobium meliloti USDA1519 Isolate Nodule
201 2937106411 Sinorhizobium meliloti USDA1214 Isolate Nodule
202 2937113482 Sinorhizobium meliloti USDA1180 Isolate Nodule
203 2937119839 Sinorhizobium meliloti USDA1790 Isolate Nodule
204 2937126314 Sinorhizobium meliloti USDA1612 Isolate Nodule
205 2937822353 Mesorhizobium neociceri CCANP35 Isolate Nodule
206 2937836603 Mesorhizobium sp. M6A.T.Cr.TU.014.01.1.1 Isolate Nodule
207 2937843397 Mesorhizobium xinjiangense lm94 Isolate Rhizosphere
208 2937848649 Mesorhizobium sp. WSM4310 Isolate Unclassified
209 2937861824 Mesorhizobium sp. M7A.F.Ca.CA.001.07.2.1 Isolate Nodule
210 2937868953 Mesorhizobium sp. M7A.F.Ca.CA.001.13.2.1 Isolate Nodule
211 2937877337 Mesorhizobium sp. M8A.F.Ca.ET.161.01.1.1 Isolate Nodule
212 2937972304 Mesorhizobium sp. M8A.F.Ca.ET.173.01.1.1 Isolate Nodule
213 2937980651 Mesorhizobium sp. M7A.F.Ca.CA.004.04.2.1 Isolate Nodule
214 2937994558 Mesorhizobium sp. M1C.F.Ca.ET.187.01.1.1 Isolate Nodule
215 2957375807 Sinorhizobium medicae USDA1632 Isolate Nodule
216 2957382221 Sinorhizobium meliloti USDA1919 Isolate Nodule
217 2957388812 Sinorhizobium meliloti USDA1195 Isolate Nodule
218 2957395598 Sinorhizobium meliloti USDA1237 Isolate Nodule
219 2957402308 Sinorhizobium meliloti USDA1794 Isolate Nodule
220 2957408893 Sinorhizobium meliloti USDA1163 Isolate Nodule
221 2957415311 Sinorhizobium meliloti USDA1724 Isolate Nodule
222 2957422303 Sinorhizobium meliloti USDA1497 Isolate Nodule
223 2957430029 Sinorhizobium meliloti USDA1590 Isolate Nodule
224 2957437181 Sinorhizobium medicae USDA1694 Isolate Nodule
225 2957443900 Sinorhizobium meliloti USDA1734 Isolate Nodule
226 2957450854 Sinorhizobium meliloti USDA1655 Isolate Nodule
227 2957457609 Sinorhizobium meliloti USDA1751 Isolate Nodule
228 2957464669 Sinorhizobium meliloti USDA1520 Isolate Nodule
229 2957471148 Sinorhizobium meliloti USDA1204 Isolate Nodule
230 2957478035 Sinorhizobium meliloti USDA1171 Isolate Nodule
231 2957484790 Sinorhizobium meliloti USDA1464 Isolate Nodule
232 2957491536 Sinorhizobium meliloti USDA1804 Isolate Nodule
233 2957498199 Sinorhizobium meliloti USDA1561 Isolate Nodule
234 2957505466 Sinorhizobium meliloti USDA1696 Isolate Nodule
235 2958034702 Mesorhizobium sp. M8A.F.Ca.ET.202.01.1.1 Isolate Nodule
236 2958041894 Mesorhizobium sp. M00.F.Ca.ET.149.01.1.1 Isolate Nodule
237 2958064165 Mesorhizobium sp. SARCC-RB16n Isolate Unclassified
238 2958071322 Mesorhizobium sp. M6A.T.Ce.TU.016.01.1.1 Isolate Nodule
239 2958084443 Mesorhizobium sp. M8A.F.Ca.ET.142.01.1.1 Isolate Nodule
240 2958092219 Mesorhizobium sp. M8A.F.Ca.ET.059.01.1.1 Isolate Nodule
241 2958108152 Mesorhizobium sp. M7A.F.Ca.CA.004.11.1.1 Isolate Nodule
242 2958122699 Mesorhizobium sp. M7A.F.Ca.US.001.04.2.1 Isolate Nodule
243 2958137437 Mesorhizobium sp. M7A.F.Ca.CA.002.04.1.1 Isolate Nodule
244 2958144490 Mesorhizobium sp. M8A.F.Ca.ET.021.01.1.1 Isolate Nodule
245 2958158011 Mesorhizobium sp. M7A.F.Ca.CA.002.15.2.1 Isolate Nodule
246 2958165035 Mesorhizobium sp. M1C.F.Ca.ET.196.01.1.1 Isolate Nodule
247 2960584000 Sinorhizobium meliloti USDA1530 Isolate Nodule
248 2960591022 Sinorhizobium medicae USDA1066 Isolate Nodule
249 2960597568 Sinorhizobium meliloti 3085 Isolate Nodule
250 2960603979 Sinorhizobium meliloti USDA1580 Isolate Nodule
251 2960610863 Sinorhizobium meliloti USDA1792 Isolate Nodule
252 2960617483 Sinorhizobium meliloti USDA1719 Isolate Nodule
253 2960624210 Sinorhizobium meliloti USDA1415 Isolate Nodule
254 2960631154 Sinorhizobium medicae USDA1629 Isolate Nodule
255 2960637947 Sinorhizobium meliloti USDA1202 Isolate Nodule
256 2960645483 Sinorhizobium meliloti USDA1703 Isolate Nodule
257 2960652885 Sinorhizobium meliloti USDA1199 Isolate Nodule
258 2960660292 Sinorhizobium meliloti USDA1883 Isolate Nodule
259 2960667422 Sinorhizobium meliloti USDA1170 Isolate Nodule
260 2960674078 Sinorhizobium meliloti USDA1666 Isolate Nodule
261 2960680706 Sinorhizobium medicae USDA1150 Isolate Nodule
262 2960687367 Sinorhizobium meliloti USDA1462 Isolate Nodule
263 2960693952 Sinorhizobium medicae USDA1630 Isolate Nodule
264 2961114664 Mesorhizobium sp. M1D.F.Ca.ET.231.01.1.1 Isolate Nodule
265 2961136820 Mesorhizobium sp. M7A.F.Ca.AU.001.01.1.1 Isolate Nodule
266 2961163497 Mesorhizobium sp. M1C.F.Ca.ET.176.01.1.1 Isolate Nodule
267 2961183825 Mesorhizobium sp. M7A.F.Ca.CA.001.12.1.1 Isolate Nodule
268 2964607997 Sinorhizobium meliloti USDA1212 Isolate Nodule
269 2964615318 Sinorhizobium meliloti USDA1248 Isolate Nodule
270 2964621998 Sinorhizobium meliloti USDA1235 Isolate Nodule
271 2964628898 Sinorhizobium meliloti USDA1191 Isolate Nodule
272 2964636051 Sinorhizobium meliloti USDA1594 Isolate Nodule
273 2964643177 Sinorhizobium meliloti USDA1760 Isolate Nodule
274 2964649959 Sinorhizobium meliloti USDA1591 Isolate Nodule
275 2964656573 Sinorhizobium meliloti USDA1308 Isolate Nodule
276 2964663802 Sinorhizobium meliloti USDA1688 Isolate Nodule
277 2964670856 Sinorhizobium meliloti USDA1211 Isolate Nodule
278 2964678106 Sinorhizobium meliloti USDA1210 Isolate Nodule
279 2964685014 Sinorhizobium meliloti USDA1232 Isolate Nodule
280 2964691889 Sinorhizobium meliloti USDA1379 Isolate Nodule
281 2964698721 Sinorhizobium meliloti USDA1656 Isolate Nodule
282 2964705432 Sinorhizobium meliloti USDA1614 Isolate Nodule
283 2964712639 Sinorhizobium meliloti USDA1616 Isolate Nodule
284 2964719344 Sinorhizobium meliloti USDA1456 Isolate Nodule
285 2965018300 Mesorhizobium sp. M1C.F.Ca.ET.188.01.1.1 Isolate Nodule
286 2965025482 Mesorhizobium sp. Primo-A Isolate Nodule
287 2965032056 Mesorhizobium sp. M7A.F.Ca.US.006.04.2.1 Isolate Nodule
288 2965040258 Mesorhizobium sp. M7A.F.Ca.CA.001.06.1.1 Isolate Nodule
289 2965047637 Mesorhizobium sp. M7A.F.Ca.US.014.04.1.1 Isolate Nodule
290 2965089291 Mesorhizobium sp. M7A.F.Ca.CA.001.04.1.1 Isolate Nodule
291 2965102966 Mesorhizobium sp. M7A.F.Ca.AU.002.02.1.1 Isolate Nodule
292 2967664464 Sinorhizobium meliloti USDA1208 Isolate Nodule
293 2967671571 Sinorhizobium meliloti USDA1496 Isolate Nodule
294 2967678726 Sinorhizobium meliloti USDA1467 Isolate Nodule
295 2967686174 Sinorhizobium medicae USDA1641 Isolate Nodule
296 2967693043 Sinorhizobium meliloti USDA1183 Isolate Nodule
297 2967699805 Sinorhizobium meliloti USDA1695 Isolate Nodule
298 2967706974 Sinorhizobium meliloti USDA1206 Isolate Nodule
299 2967714385 Sinorhizobium meliloti USDA1023 Isolate Nodule
300 2967721400 Sinorhizobium meliloti USDA1742 Isolate Nodule
301 2967728569 Sinorhizobium medicae USDA1607 Isolate Nodule
302 2967735183 Sinorhizobium meliloti USDA1710 Isolate Nodule
303 2967748971 Sinorhizobium meliloti USDA1024A Isolate Nodule
304 2967755722 Sinorhizobium meliloti USDA1302 Isolate Nodule
305 2967762386 Sinorhizobium meliloti USDA1397 Isolate Nodule
306 2967769361 Sinorhizobium meliloti USDA1005 Isolate Nodule
307 2967775926 Sinorhizobium meliloti USDA1678 Isolate Nodule
308 2968016561 Mesorhizobium sp. M8A.F.Ca.ET.182.01.1.1 Isolate Nodule
309 2968110612 Mesorhizobium sp. M1D.F.Ca.ET.183.01.1.1 Isolate Nodule
310 2968138860 Mesorhizobium sp. M7A.F.Ca.ET.027.03.2.1 Isolate Nodule
311 2968171901 Mesorhizobium sp. M1C.F.Ca.ET.189.01.1.1 Isolate Nodule
312 2970019648 Sinorhizobium meliloti USDA1603 Isolate Nodule
313 2970026789 Sinorhizobium medicae USDA1611 Isolate Nodule
314 2970033650 Sinorhizobium meliloti USDA1565 Isolate Nodule
315 2970040964 Sinorhizobium meliloti USDA1501 Isolate Nodule
316 2970047711 Sinorhizobium meliloti USDA1793 Isolate Nodule
317 2970054988 Sinorhizobium meliloti USDA1031 Isolate Nodule
318 2970061556 Sinorhizobium meliloti USDA1810 Isolate Nodule
319 2970068827 Sinorhizobium meliloti USDA1227 Isolate Nodule
320 2970076120 Sinorhizobium meliloti USDA1706 Isolate Nodule
321 2970082768 Sinorhizobium meliloti USDA1803 Isolate Nodule
322 2970088815 Sinorhizobium meliloti USDA1819 Isolate Nodule
323 2970095765 Sinorhizobium meliloti USDA1225 Isolate Nodule
324 2970102677 Sinorhizobium meliloti USDA1325 Isolate Nodule
325 2970109326 Sinorhizobium meliloti USDA1186 Isolate Nodule
326 2970116247 Sinorhizobium meliloti USDA1566 Isolate Nodule
327 2970122695 Sinorhizobium medicae 3082 Isolate Nodule
328 2970129317 Sinorhizobium meliloti USDA1008 Isolate Nodule
329 2970136068 Sinorhizobium meliloti USDA1699 Isolate Nodule
330 2970143518 Sinorhizobium medicae USDA1652 Isolate Nodule
331 2970149975 Sinorhizobium meliloti USDA1215 Isolate Nodule
332 2970156795 Sinorhizobium meliloti USDA1491 Isolate Nodule
333 2970164137 Sinorhizobium meliloti USDA1018 Isolate Nodule
334 2970170962 Sinorhizobium meliloti USDA1571 Isolate Nodule
335 2970177841 Sinorhizobium meliloti USDA1533 Isolate Nodule
336 2970184632 Sinorhizobium meliloti USDA1593 Isolate Nodule
337 2970191845 Sinorhizobium meliloti USDA1187 Isolate Nodule
338 2970469710 Mesorhizobium sp. M8A.F.Ca.ET.181.01.1.1 Isolate Nodule
339 2970489779 Mesorhizobium sp. M7A.F.Ca.US.008.03.1.1 Isolate Nodule
340 2970510686 Mesorhizobium sp. M7A.F.Ca.MR.148.00.0.0 Isolate Nodule
341 2970524798 Mesorhizobium sp. M5C.F.Ca.ET.164.01.1.1 Isolate Nodule
342 2970540015 Mesorhizobium sp. M5C.F.Ca.IN.020.29.1.1 Isolate Nodule
343 2970547951 Mesorhizobium sp. M7A.F.Ca.AU.002.04.1.1 Isolate Nodule
344 2970554993 Mesorhizobium sp. M1C.F.Ca.ET.210.01.1.1 Isolate Nodule
345 2970593180 Mesorhizobium sp. M8A.F.Ca.ET.197.01.1.1 Isolate Nodule
346 2970619444 Mesorhizobium sp. M7A.F.Ca.ET.027.02.1.1 Isolate Nodule
347 2970627176 Mesorhizobium sp. M7A.F.Ca.US.006.01.2.1 Isolate Nodule
348 2977516862 Sinorhizobium meliloti USDA1791 Isolate Nodule
349 2977523885 Sinorhizobium meliloti USDA1777 Isolate Nodule
350 2977530762 Sinorhizobium medicae USDA1606 Isolate Nodule
351 2977537788 Sinorhizobium meliloti USDA1184 Isolate Nodule
352 2977544691 Sinorhizobium medicae USDA1631 Isolate Nodule
353 2977551784 Sinorhizobium meliloti USDA1035 Isolate Nodule
354 2977558990 Sinorhizobium meliloti USDA1222 Isolate Nodule
355 2977565890 Sinorhizobium meliloti USDA1617 Isolate Nodule
356 2977572785 Sinorhizobium meliloti USDA1767 Isolate Nodule
357 2977579622 Sinorhizobium meliloti USDA1161 Isolate Nodule
358 2977851361 Mesorhizobium sp. M7A.F.Ca.CA.004.06.2.1 Isolate Nodule
359 2977864932 Mesorhizobium tamadayense DSM 28320 Isolate Nodule
360 2977872689 Mesorhizobium sp. M7A.F.Ca.US.001.04.1.1 Isolate Nodule
361 2977898635 Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.1 Isolate Nodule
362 2977907340 Mesorhizobium sp. M7A.F.Ca.CA.004.12.1.1 Isolate Nodule
363 2977915119 Mesorhizobium sp. M7A.F.Ca.CA.001.09.2.1 Isolate Nodule
364 2977922695 Mesorhizobium sp. WSM4305 Isolate Unclassified
365 2977935797 Mesorhizobium sp. M7A.F.Ca.CA.002.12.1.1 Isolate Nodule
366 2977950692 Mesorhizobium sp. M7A.F.Ca.CA.001.04.2.1 Isolate Nodule
367 2977957713 Mesorhizobium sp. M7A.F.Ca.US.001.02.1.1 Isolate Nodule
368 2979764755 Mesorhizobium sp. M7A.F.Ca.CA.004.05.2.1 Isolate Nodule
369 2979772303 Mesorhizobium sp. M7A.F.Ca.CA.004.04.1.1 Isolate Nodule
370 2979793036 Mesorhizobium sp. M7A.F.Ca.US.007.01.1.1 Isolate Nodule
371 2987645492 Mesorhizobium sp. M7A.F.Ca.CA.002.10.1.1 Isolate Nodule
372 2987659509 Mesorhizobium sp. M1C.F.Ca.ET.204.01.1.1 Isolate Nodule
373 2987666974 Mesorhizobium sp. WSM4306 Isolate Unclassified
374 2987673487 Mesorhizobium sp. M7A.F.Ca.US.003.02.1.1 Isolate Nodule
375 2996336353 Mesorhizobium sp. YM1C-6-2 Isolate Unclassified
376 2996348954 Mesorhizobium sp. M8A.F.Ca.ET.167.01.1.1 Isolate Nodule
377 2996386984 Mesorhizobium sp. M7A.F.Ca.MR.245.00.0.0 Isolate Nodule
378 2996887358 Rhizobium sp. R711 Isolate Nodule
379 3004188549 Mesorhizobium sp. M1C.F.Ca.ET.195.01.1.1 Isolate Nodule
380 3004195979 Mesorhizobium sp. M7A.F.Ca.CA.001.08.2.1 Isolate Nodule
381 3004211236 Mesorhizobium sp. WSM4307 Isolate Unclassified
382 3004218560 Mesorhizobium sp. WSM4315 Isolate Unclassified
383 3004232784 Mesorhizobium sp. M7A.T.Ca.US.000.02.1.1 Isolate Nodule
384 3004239961 Mesorhizobium sp. M7A.F.Ca.US.005.03.2.1 Isolate Nodule
385 3004248173 Mesorhizobium sp. M7A.F.Ca.CA.004.06.1.1 Isolate Nodule
386 3004268573 Mesorhizobium sp. M7A.F.Ca.US.010.02.1.1 Isolate Nodule
387 3004275668 Mesorhizobium sp. M8A.F.Ca.ET.208.01.1.1 Isolate Nodule
388 3004289098 Mesorhizobium sp. M8A.F.Ca.ET.023.02.2.1 Isolate Nodule
389 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
390 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
391 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
392 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
393 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
394 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
395 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
396 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
397 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
398 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
399 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
400 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
401 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
402 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
403 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
404 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
405 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
406 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
407 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
408 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
409 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
410 3300009766 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule Metagenome Nodule
411 3300013249 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.3_F06 Metagenome Rhizosphere
412 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
413 3300015690 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 Metagenome Rhizosphere
414 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
415 3300022739 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - brown nodules Metagenome Nodule
416 3300022740 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - pink nodules Metagenome Nodule
417 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
418 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
419 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
420 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
421 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
422 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
423 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
424 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
425 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
426 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
427 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
428 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
429 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
430 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
431 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
432 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
433 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
434 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
435 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
436 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
437 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
438 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
439 3300031967 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - elongated nodules Metagenome Nodule
440 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
441 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
442 3300033430 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - small nodules Metagenome Nodule
443 3300033464 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - branched nodules Metagenome Nodule
444 3300038725 Seagrass microbial communities from Seahorse Key, FL, USA - HV0818 Metagenome Unclassified
445 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
446 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
447 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
448 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
449 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
450 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
451 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
452 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
453 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
454 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
455 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
456 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
457 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
458 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
459 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
460 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
461 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
462 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
463 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
464 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
465 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
466 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
467 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
468 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
469 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
470 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
471 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
472 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
473 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
474 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
475 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
476 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
477 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
478 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
479 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
480 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
481 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
482 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
483 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
484 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
485 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
486 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
487 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
488 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
489 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
490 3300049778 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control Metagenome Rhizosphere
491 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
492 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
493 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
494 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
495 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
496 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
497 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
498 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
499 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
500 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
501 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
502 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
503 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
504 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
505 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
506 648276728 Sinorhizobium meliloti BL225C Isolate Nodule
507 649633066 Mesorhizobium ciceri bv. biserrulae WSM1271 Isolate Nodule
508 8003992118 Sinorhizobium meliloti RRI128 Isolate Nodule
509 8003999396 Sinorhizobium medicae WSM1115 Isolate Nodule
510 8004300914 Mesorhizobium sp. M7A.F.Ca.CA.002.07.1.1 Isolate Nodule
511 8004312739 Mesorhizobium sp. M7A.F.Ca.MR.362.00.0.0 Isolate Nodule
512 8004361976 Mesorhizobium sp. M7A.F.Ca.CA.001.08.1.1 Isolate Nodule
513 8004395343 Mesorhizobium sp. M5C.F.Ca.IN.020.14.1.1 Isolate Nodule
514 8004633249 Mesorhizobium sp. M6A.T.Ce.TU.002.03.1.1 Isolate Nodule
515 8004695233 Mesorhizobium sp. M7A.F.Ca.US.001.01.1.1 Isolate Nodule
516 8004727605 Mesorhizobium sp. M7A.F.Ca.CA.004.01.1.1 Isolate Nodule
517 8005258706 Rhizobium sp. R693 Isolate Nodule
518 8005321885 Rhizobium sp. R72 Isolate Nodule
519 8005542996 Rhizobium grahamii CCGM3 Isolate Unclassified
520 8054460903 Agrobacterium vaccinii B7.6 Isolate Unclassified
521 8055617313 Mesorhizobium onobrychidis OM4 Isolate Nodule
522 8056875544 Rhizobium halophilum TRM95001 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 28.52
Metatranscriptomes 0
Isolates 71.48

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 9.33
Nodule 64.79
Rhizoplane 2.29
Rhizosphere 13.2
Stem 0
Stem Tuber 0
Unclassified 10.39

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25157J39369_1003336 3300002741 Bacteria 3326
2 JGI25152J39213_1005341 3300002773 Bacteria 3776
3 JGI25406J46586_10013564 3300003203 Bacteria 3494
4 rootH2_10005148 3300003320 Bacteria 8399
5 Ga0055526_1000049 3300003771 Bacteria 118394
6 Ga0055526_1008287 3300003771 Bacteria 5214
7 Ga0055526_1017562 3300003771 Bacteria 2726
8 Ga0055524_1004345 3300003775 Bacteria 6556
9 Ga0055524_1014834 3300003775 Bacteria 2869
10 Ga0055528_1025676 3300003790 Bacteria 1719
11 Ga0055540_1002996 3300003792 Bacteria 8457
12 Ga0055531_10028500 3300003794 Bacteria 1924
13 Ga0070682_100025925 3300005337 Bacteria 3503
14 Ga0070672_100001180 3300005543 Bacteria 15977
15 Ga0068856_100040848 3300005614 Bacteria 4557
16 Ga0081539_10008993 3300005985 Bacteria 8493
17 Ga0075365_10089230 3300006038 Bacteria 2099
18 Ga0075368_10118050 3300006042 Bacteria 1097
19 Ga0075364_10012341 3300006051 Bacteria 5222
20 Ga0075364_10024204 3300006051 Bacteria 3852
21 Ga0075362_10021063 3300006177 Bacteria 2731
22 Ga0075367_10002312 3300006178 Bacteria 8657
23 Ga0075366_10035368 3300006195 Bacteria 2945
24 Ga0105251_10051426 3300009011 Bacteria 1965
25 Ga0105249_10091909 3300009553 Bacteria 2840
26 Ga0123342_1024199 3300009766 Bacteria 3834
27 Ga0171463_1002 3300013249 Bacteria 1274851
28 Ga0163163_10130050 3300014325 Bacteria 2558
29 Ga0183363_1046 3300015690 Bacteria 40582
30 Ga0214543_1000018 3300021327 Bacteria 272335
31 Ga0228711_1028457 3300022739 Bacteria 3225
32 Ga0228711_1028458 3300022739 Bacteria 3225
33 Ga0228710_1008201 3300022740 Bacteria 15068
34 Ga0209026_1000032 3300025250 Bacteria 322378
35 Ga0209759_1000500 3300025256 Bacteria 43016
36 Ga0209129_1000690 3300025258 Bacteria 22130
37 Ga0209673_1008881 3300025273 Bacteria 4421
38 Ga0209673_1016543 3300025273 Bacteria 2752
39 Ga0209675_1001412 3300025291 Bacteria 13878
40 Ga0209675_1004432 3300025291 Bacteria 6237
41 Ga0209025_1000016 3300025294 Bacteria 770739
42 Ga0209025_1000187 3300025294 Bacteria 154788
43 Ga0209025_1005866 3300025294 Bacteria 9819
44 Ga0209025_1027939 3300025294 Bacteria 2780
45 Ga0209564_1000015 3300025295 Bacteria 615324
46 Ga0209564_1000035 3300025295 Bacteria 442446
47 Ga0209564_1000052 3300025295 Bacteria 356578
48 Ga0209564_1001102 3300025295 Bacteria 32029
49 Ga0209758_1058673 3300025297 Bacteria 1286
50 Ga0209256_1000025 3300025299 Bacteria 442449
51 Ga0209256_1000099 3300025299 Bacteria 203782
52 Ga0209256_1000240 3300025299 Bacteria 97229
53 Ga0209256_1000260 3300025299 Bacteria 93956
54 Ga0209256_1007658 3300025299 Bacteria 5252
55 Ga0209256_1024693 3300025299 Bacteria 1765
56 Ga0209256_1034990 3300025299 Bacteria 1331
57 Ga0209051_1001177 3300025303 Bacteria 23706
58 Ga0209257_1004297 3300025304 Bacteria 11202
59 Ga0207695_10033428 3300025913 Bacteria 5608
60 Ga0207691_10003007 3300025940 Bacteria 16461
61 Ga0207668_10086436 3300025972 Bacteria 2291
62 Ga0207674_10056000 3300026116 Bacteria 4005
63 Ga0209281_1000087 3300027111 Bacteria 246142
64 Ga0209281_1000188 3300027111 Bacteria 141823
65 Ga0209281_1001780 3300027111 Bacteria 10880
66 Ga0209282_1000008 3300027666 Bacteria 248526
67 Ga0268266_10123917 3300028379 Bacteria 2303
68 Ga0268265_10088971 3300028380 Bacteria 2462
69 Ga0307517_10234158 3300028786 Bacteria 1098
70 Ga0307410_10144361 3300031852 Bacteria 1765
71 Ga0307406_10008302 3300031901 Bacteria 5787
72 Ga0315914_1000011 3300031967 Bacteria 170175
73 Ga0307416_100296756 3300032002 Bacteria 1604
74 Ga0307416_100817271 3300032002 Bacteria 1029
75 Ga0307414_10117631 3300032004 Bacteria 2037
76 Ga0315913_1000008 3300033430 Bacteria 155397
77 Ga0315915_1000009 3300033464 Bacteria 252178
78 Ga0400484_09109 3300038725 Bacteria 1368
79 Ga0400490_25049 3300038726 Bacteria 1245
80 Ga0400483_099725 3300039062 Bacteria 3786
81 Ga0439436_0012751 3300041404 Bacteria 2549
82 Ga0439465_0114268 3300041413 Bacteria 942
83 Ga0451795_1228475 3300041456 Bacteria 867
84 Ga0451807_2668761 3300041486 Bacteria 886
85 Ga0451853_0966572 3300041512 Bacteria 1108
86 Ga0439445_0022790 3300042004 Bacteria 1582
87 Ga0439449_0061999 3300042007 Bacteria 1380
88 Ga0450918_010596 3300042531 Bacteria 1609
89 Ga0495638_0013394 3300046460 Bacteria 5583
90 Ga0495687_063284 3300047443 Bacteria 1515
91 Ga0496102_0212052 3300048905 Bacteria 1826
92 Ga0496104_0044391 3300048907 Bacteria 4176
93 Ga0496105_0001811 3300048908 Bacteria 15296
94 Ga0496108_0261487 3300048911 Bacteria 1506
95 Ga0496109_0274790 3300048912 Bacteria 1588
96 Ga0496111_0123075 3300048914 Bacteria 1916
97 Ga0496113_0124718 3300048916 Bacteria 2016
98 Ga0496114_0010906 3300048917 Bacteria 7241
99 Ga0496117_0103533 3300048920 Bacteria 1794
100 Ga0496117_0153043 3300048920 Bacteria 1362
101 Ga0496119_0001603 3300048922 Bacteria 26894
102 Ga0496119_0049344 3300048922 Bacteria 2603
103 Ga0496120_0065603 3300048923 Bacteria 2010
104 Ga0496121_0000710 3300048924 Bacteria 61765
105 Ga0496121_0035067 3300048924 Bacteria 4502
106 Ga0496121_0283281 3300048924 Bacteria 1132
107 Ga0496122_0065842 3300048925 Bacteria 2623
108 Ga0496122_0099732 3300048925 Bacteria 1946
109 Ga0496123_0009553 3300048926 Bacteria 8718
110 Ga0496123_0059400 3300048926 Bacteria 2472
111 Ga0496124_0000929 3300048927 Bacteria 47255
112 Ga0496124_0228362 3300048927 Bacteria 1394
113 Ga0501031_0000064 3300049568 Bacteria 56925
114 Ga0501031_0045601 3300049568 Bacteria 2860
115 Ga0501032_0002801 3300049569 Bacteria 13564
116 Ga0501032_0328443 3300049569 Bacteria 986
117 Ga0501033_0000053 3300049570 Bacteria 109042
118 Ga0501033_0035020 3300049570 Bacteria 3763
119 Ga0501033_0042295 3300049570 Bacteria 3397
120 Ga0501034_0000030 3300049571 Bacteria 248180
121 Ga0501036_0002921 3300049572 Bacteria 13571
122 Ga0501036_0106781 3300049572 Bacteria 2367
123 Ga0501036_0116982 3300049572 Bacteria 2251
124 Ga0501037_0002386 3300049573 Bacteria 13559
125 Ga0501037_0018615 3300049573 Bacteria 5117
126 Ga0501037_0293090 3300049573 Bacteria 1131
127 Ga0501038_0004075 3300049574 Bacteria 13587
128 Ga0501038_0382560 3300049574 Bacteria 1091
129 Ga0501039_0000008 3300049575 Bacteria 274778
130 Ga0501040_0046065 3300049576 Bacteria 2976
131 Ga0501040_0051941 3300049576 Bacteria 2805
132 Ga0501042_0038606 3300049578 Bacteria 3390
133 Ga0501043_0003198 3300049579 Bacteria 13545
134 Ga0501046_0154085 3300049580 Bacteria 1732
135 Ga0501047_0003942 3300049581 Bacteria 13947
136 Ga0501047_0135346 3300049581 Bacteria 2344
137 Ga0501048_0026586 3300049582 Bacteria 4212
138 Ga0501068_0004893 3300049584 Bacteria 7296
139 Ga0501070_0072570 3300049586 Bacteria 2849
140 Ga0501073_0111707 3300049589 Bacteria 1895
141 Ga0501074_0103694 3300049590 Bacteria 2036
142 Ga0501282_009526 3300049778 Bacteria 1042
143 Ga0501035_0000031 3300049822 Bacteria 175591
144 Ga0501044_0000008 3300049823 Bacteria 274778
145 Ga0501044_0055728 3300049823 Bacteria 4060
146 Ga0501044_0164078 3300049823 Bacteria 2196
147 Ga0501045_0077958 3300049824 Bacteria 2442
148 nmdc:mga03683_67621_c1 3300050489 Bacteria 1521
149 nmdc:mga00v17_1012_c1 3300050491 Bacteria 15037
150 nmdc:mga00v17_169786_c1 3300050491 Bacteria 1406
151 nmdc:mga00v17_17227_c1 3300050491 Bacteria 4085
152 nmdc:mga00v17_376150_c1 3300050491 Bacteria 923
153 nmdc:mga0yw44_216871_c1 3300050492 Bacteria 1267
154 nmdc:mga0k408_45228_c1 3300050493 Bacteria 2540
155 nmdc:mga06z11_91874_c1 3300050494 Bacteria 1649
156 nmdc:mga0sz30_21463_c2 3300050516 Bacteria 1638
157 Ga0500643_018082 3300053087 Bacteria 2347
158 Ga0500572_001986 3300053111 Bacteria 5108
159 Ga0500568_0000357 3300053139 Bacteria 35510
160 Ga0500620_000440 3300053155 Bacteria 7553
161 Ga0500636_0000656 3300053177 Bacteria 18686
162 Ga0501082_0287237 3300060353 Bacteria 1432

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048907 Ga0496104_0044391 Ga0496104_0044391_11_748 245
2 3300041512 Ga0451853_0966572 Ga0451853_0966572_43_825 260
3 3300041456 Ga0451795_1228475 Ga0451795_1228475_14_802 262
4 3300041486 Ga0451807_2668761 Ga0451807_2668761_72_863 262
5 3300050491 nmdc:mga00v17_376150_c1 nmdc:mga00v17_376150_c1_109_897 262
6 iso_pu_bacteria 2906427513 2906431035 262
7 iso_pu_bacteria 3004195979 3004196672 262
8 3300048927 Ga0496124_0228362 Ga0496124_0228362_20_817 265
9 3300026116 Ga0207674_10056000 Ga0207674_100560004 271
10 iso_pu_bacteria 2791354903 2791923099 272
11 iso_pu_bacteria 2513237159 2514002168 273
12 iso_pu_bacteria 2765235802 2765464146 273
13 iso_pu_bacteria 2842521101 2842523870 273
14 iso_pu_bacteria 2894817345 2894819274 273
15 iso_pu_bacteria 2582581283 2585167306 274
16 iso_pu_bacteria 2643221557 2643809544 274
17 iso_pu_bacteria 2643221668 2644375885 274
18 iso_pu_bacteria 2643221734 2644738062 274
19 iso_pu_bacteria 2818991467 2819721515 274
20 iso_pu_bacteria 2917699015 2917702466 274
21 iso_pu_bacteria 2920822456 2920827526 274
22 iso_pu_bacteria 2937843397 2937843679 274
23 iso_pu_bacteria 2738543024 2739306938 275
24 iso_pu_bacteria 2979793036 2979799693 275
25 3300005337 Ga0070682_100025925 Ga0070682_1000259255 276
26 3300005543 Ga0070672_100001180 Ga0070672_1000011803 276
27 3300006195 Ga0075366_10035368 Ga0075366_100353684 276
28 3300025940 Ga0207691_10003007 Ga0207691_100030071 276
29 3300038725 Ga0400484_09109 Ga0400484_09109_319_1149 276
30 3300038726 Ga0400490_25049 Ga0400490_25049_78_908 276
31 3300039062 Ga0400483_099725 Ga0400483_099725_2792_3622 276
32 3300050493 nmdc:mga0k408_45228_c1 nmdc:mga0k408_45228_c1_381_1211 276
33 iso_pu_bacteria 2510461069 2510840777 276
34 iso_pu_bacteria 2510917028 2511184932 276
35 iso_pu_bacteria 2534681796 2535520441 276
36 iso_pu_bacteria 2582581867 2585402919 276
37 iso_pu_bacteria 2585427590 2585820105 276
38 iso_pu_bacteria 2923556063 2923560960 276
39 iso_pu_bacteria 2996887358 2996887848 276
40 iso_pu_bacteria 8005258706 8005259213 276
41 iso_pu_bacteria 8005321885 8005322375 276
42 iso_pu_bacteria 8005542996 8005548193 276
43 iso_pu_bacteria 8054460903 8054464647 276
44 3300006051 Ga0075364_10024204 Ga0075364_100242045 277
45 3300025297 Ga0209758_1058673 Ga0209758_10586732 277
46 3300028379 Ga0268266_10123917 Ga0268266_101239173 277
47 3300032002 Ga0307416_100296756 Ga0307416_1002967562 277
48 3300041404 Ga0439436_0012751 Ga0439436_0012751_474_1307 277
49 3300042007 Ga0439449_0061999 Ga0439449_0061999_86_919 277
50 3300042531 Ga0450918_010596 Ga0450918_010596_711_1544 277
51 3300049568 Ga0501031_0045601 Ga0501031_0045601_1583_2425 277
52 3300049569 Ga0501032_0328443 Ga0501032_0328443_26_868 277
53 3300049570 Ga0501033_0042295 Ga0501033_0042295_2327_3169 277
54 3300049572 Ga0501036_0106781 Ga0501036_0106781_193_1035 277
55 3300049572 Ga0501036_0116982 Ga0501036_0116982_1290_2132 277
56 3300049573 Ga0501037_0018615 Ga0501037_0018615_3163_4005 277
57 3300049574 Ga0501038_0382560 Ga0501038_0382560_230_1072 277
58 3300049576 Ga0501040_0051941 Ga0501040_0051941_1914_2756 277
59 3300049578 Ga0501042_0038606 Ga0501042_0038606_926_1768 277
60 3300049580 Ga0501046_0154085 Ga0501046_0154085_185_1027 277
61 3300049581 Ga0501047_0135346 Ga0501047_0135346_985_1827 277
62 3300049582 Ga0501048_0026586 Ga0501048_0026586_814_1656 277
63 3300049584 Ga0501068_0004893 Ga0501068_0004893_1259_2101 277
64 3300049586 Ga0501070_0072570 Ga0501070_0072570_1897_2739 277
65 3300049590 Ga0501074_0103694 Ga0501074_0103694_1173_2015 277
66 3300049823 Ga0501044_0164078 Ga0501044_0164078_837_1679 277
67 3300049824 Ga0501045_0077958 Ga0501045_0077958_1401_2243 277
68 3300050491 nmdc:mga00v17_17227_c1 nmdc:mga00v17_17227_c1_22_855 277
69 iso_pu_bacteria 2513237089 2513604878 277
70 iso_pu_bacteria 2513237156 2513983728 277
71 iso_pu_bacteria 2513237160 2514006589 277
72 iso_pu_bacteria 2517487022 2517565796 277
73 iso_pu_bacteria 2767802442 2770196446 277
74 iso_pu_bacteria 2775506902 2776272737 277
75 iso_pu_bacteria 2775506904 2776284680 277
76 iso_pu_bacteria 2802428858 2802721411 277
77 iso_pu_bacteria 2802428859 2802726681 277
78 iso_pu_bacteria 2802428860 2802732575 277
79 iso_pu_bacteria 2802428861 2802739696 277
80 iso_pu_bacteria 2802428862 2802747117 277
81 iso_pu_bacteria 2802428863 2802748827 277
82 iso_pu_bacteria 2840764183 2840768405 277
83 iso_pu_bacteria 2915980308 2915981931 277
84 iso_pu_bacteria 2916061851 2916064418 277
85 iso_pu_bacteria 2921250672 2921251932 277
86 iso_pu_bacteria 2937029754 2937034187 277
87 iso_pu_bacteria 2937036028 2937037388 277
88 iso_pu_bacteria 2937078374 2937083575 277
89 iso_pu_bacteria 2937084907 2937085695 277
90 iso_pu_bacteria 2957375807 2957379310 277
91 iso_pu_bacteria 2957437181 2957438464 277
92 iso_pu_bacteria 2960591022 2960594518 277
93 iso_pu_bacteria 2960631154 2960632376 277
94 iso_pu_bacteria 2960680706 2960681996 277
95 iso_pu_bacteria 2960693952 2960700448 277
96 iso_pu_bacteria 2967686174 2967692716 277
97 iso_pu_bacteria 2967728569 2967732267 277
98 iso_pu_bacteria 2970026789 2970031284 277
99 iso_pu_bacteria 2970122695 2970127119 277
100 iso_pu_bacteria 2970143518 2970147481 277
101 iso_pu_bacteria 2977530762 2977535476 277
102 iso_pu_bacteria 2977544691 2977551585 277
103 iso_pu_bacteria 8003999396 8004004280 277
104 3300003771 Ga0055526_1000049 Ga0055526_100004937 278
105 3300003775 Ga0055524_1004345 Ga0055524_10043453 278
106 3300003794 Ga0055531_10028500 Ga0055531_100285002 278
107 3300013249 Ga0171463_1002 Ga0171463_1002378 278
108 3300015690 Ga0183363_1046 Ga0183363_104617 278
109 3300025291 Ga0209675_1001412 Ga0209675_10014129 278
110 3300025291 Ga0209675_1004432 Ga0209675_10044324 278
111 3300025294 Ga0209025_1000016 Ga0209025_1000016325 278
112 3300025294 Ga0209025_1000187 Ga0209025_1000187100 278
113 3300025294 Ga0209025_1027939 Ga0209025_10279392 278
114 3300025295 Ga0209564_1000015 Ga0209564_1000015430 278
115 3300025295 Ga0209564_1000035 Ga0209564_1000035133 278
116 3300025295 Ga0209564_1000052 Ga0209564_1000052303 278
117 3300025299 Ga0209256_1000025 Ga0209256_1000025313 278
118 3300025299 Ga0209256_1000099 Ga0209256_1000099152 278
119 3300025299 Ga0209256_1000240 Ga0209256_100024035 278
120 3300025299 Ga0209256_1000260 Ga0209256_100026036 278
121 3300025304 Ga0209257_1004297 Ga0209257_10042972 278
122 3300027111 Ga0209281_1001780 Ga0209281_10017807 278
123 3300031901 Ga0307406_10008302 Ga0307406_100083026 278
124 3300048920 Ga0496117_0103533 Ga0496117_0103533_656_1492 278
125 3300048920 Ga0496117_0153043 Ga0496117_0153043_317_1153 278
126 3300048922 Ga0496119_0049344 Ga0496119_0049344_38_874 278
127 3300048925 Ga0496122_0099732 Ga0496122_0099732_415_1251 278
128 3300048926 Ga0496123_0009553 Ga0496123_0009553_6691_7527 278
129 3300048926 Ga0496123_0059400 Ga0496123_0059400_1192_2028 278
130 3300049573 Ga0501037_0293090 Ga0501037_0293090_264_1100 278
131 iso_pu_bacteria 2509276019 2509378472 278
132 iso_pu_bacteria 2510065057 2510303873 278
133 iso_pu_bacteria 2511231052 2511498003 278
134 iso_pu_bacteria 2512047086 2512529161 278
135 iso_pu_bacteria 2513237086 2513583767 278
136 iso_pu_bacteria 2513237091 2513617290 278
137 iso_pu_bacteria 2513237140 2513882473 278
138 iso_pu_bacteria 2513237143 2513904092 278
139 iso_pu_bacteria 2515154107 2515612558 278
140 iso_pu_bacteria 2516653046 2516896352 278
141 iso_pu_bacteria 2524023207 2524449783 278
142 iso_pu_bacteria 2551306084 2551676169 278
143 iso_pu_bacteria 2551306085 2551685636 278
144 iso_pu_bacteria 2551306086 2551695207 278
145 iso_pu_bacteria 2551306087 2551700582 278
146 iso_pu_bacteria 2551306089 2551709980 278
147 iso_pu_bacteria 2551306090 2551723380 278
148 iso_pu_bacteria 2551306091 2551726651 278
149 iso_pu_bacteria 2551306092 2551732412 278
150 iso_pu_bacteria 2551306093 2551741870 278
151 iso_pu_bacteria 2558860100 2558861862 278
152 iso_pu_bacteria 2558860100 2558865482 278
153 iso_pu_bacteria 2791355091 2792619725 278
154 iso_pu_bacteria 2791355092 2792627500 278
155 iso_pu_bacteria 2838074704 2838077648 278
156 iso_pu_bacteria 2850079185 2850084097 278
157 iso_pu_bacteria 2855825444 2855828822 278
158 iso_pu_bacteria 2855839649 2855843946 278
159 iso_pu_bacteria 2858800743 2858806811 278
160 iso_pu_bacteria 2896384573 2896389319 278
161 iso_pu_bacteria 2915986958 2915993461 278
162 iso_pu_bacteria 2915993759 2915994601 278
163 iso_pu_bacteria 2916000859 2916006332 278
164 iso_pu_bacteria 2916007675 2916010236 278
165 iso_pu_bacteria 2916014648 2916020683 278
166 iso_pu_bacteria 2916021584 2916027089 278
167 iso_pu_bacteria 2916028427 2916031612 278
168 iso_pu_bacteria 2916035215 2916036178 278
169 iso_pu_bacteria 2916041962 2916044219 278
170 iso_pu_bacteria 2916048683 2916050864 278
171 iso_pu_bacteria 2916055098 2916061318 278
172 iso_pu_bacteria 2916068649 2916069220 278
173 iso_pu_bacteria 2916076590 2916078166 278
174 iso_pu_bacteria 2920760137 2920764910 278
175 iso_pu_bacteria 2921201388 2921203420 278
176 iso_pu_bacteria 2921208531 2921210551 278
177 iso_pu_bacteria 2921237296 2921238671 278
178 iso_pu_bacteria 2921244191 2921245514 278
179 iso_pu_bacteria 2921257292 2921262323 278
180 iso_pu_bacteria 2921263974 2921265599 278
181 iso_pu_bacteria 2921282425 2921282514 278
182 iso_pu_bacteria 2921289301 2921289379 278
183 iso_pu_bacteria 2924144063 2924145841 278
184 iso_pu_bacteria 2924150972 2924152629 278
185 iso_pu_bacteria 2924158325 2924159582 278
186 iso_pu_bacteria 2924165586 2924170119 278
187 iso_pu_bacteria 2924172951 2924178067 278
188 iso_pu_bacteria 2924179722 2924182107 278
189 iso_pu_bacteria 2924186466 2924190653 278
190 iso_pu_bacteria 2924193448 2924199461 278
191 iso_pu_bacteria 2924200457 2924205176 278
192 iso_pu_bacteria 2924207177 2924208326 278
193 iso_pu_bacteria 2924214083 2924215282 278
194 iso_pu_bacteria 2924221636 2924225348 278
195 iso_pu_bacteria 2924228884 2924229217 278
196 iso_pu_bacteria 2936996657 2937001942 278
197 iso_pu_bacteria 2937002841 2937008575 278
198 iso_pu_bacteria 2937009748 2937015887 278
199 iso_pu_bacteria 2937016420 2937022690 278
200 iso_pu_bacteria 2937023124 2937024164 278
201 iso_pu_bacteria 2937042894 2937044496 278
202 iso_pu_bacteria 2937049772 2937054428 278
203 iso_pu_bacteria 2937056579 2937061198 278
204 iso_pu_bacteria 2937063883 2937066639 278
205 iso_pu_bacteria 2937071275 2937072090 278
206 iso_pu_bacteria 2937091812 2937098652 278
207 iso_pu_bacteria 2937098957 2937105333 278
208 iso_pu_bacteria 2937106411 2937107888 278
209 iso_pu_bacteria 2937113482 2937114358 278
210 iso_pu_bacteria 2937119839 2937122744 278
211 iso_pu_bacteria 2937126314 2937128496 278
212 iso_pu_bacteria 2957382221 2957384222 278
213 iso_pu_bacteria 2957388812 2957390389 278
214 iso_pu_bacteria 2957395598 2957401139 278
215 iso_pu_bacteria 2957402308 2957407997 278
216 iso_pu_bacteria 2957408893 2957409733 278
217 iso_pu_bacteria 2957415311 2957420602 278
218 iso_pu_bacteria 2957422303 2957425770 278
219 iso_pu_bacteria 2957430029 2957436005 278
220 iso_pu_bacteria 2957443900 2957448842 278
221 iso_pu_bacteria 2957450854 2957452010 278
222 iso_pu_bacteria 2957457609 2957462945 278
223 iso_pu_bacteria 2957464669 2957467399 278
224 iso_pu_bacteria 2957471148 2957477734 278
225 iso_pu_bacteria 2957478035 2957484541 278
226 iso_pu_bacteria 2957484790 2957488095 278
227 iso_pu_bacteria 2957491536 2957497527 278
228 iso_pu_bacteria 2957498199 2957501523 278
229 iso_pu_bacteria 2957505466 2957509732 278
230 iso_pu_bacteria 2960584000 2960589960 278
231 iso_pu_bacteria 2960597568 2960598625 278
232 iso_pu_bacteria 2960603979 2960608663 278
233 iso_pu_bacteria 2960610863 2960615480 278
234 iso_pu_bacteria 2960617483 2960622960 278
235 iso_pu_bacteria 2960624210 2960630411 278
236 iso_pu_bacteria 2960637947 2960641934 278
237 iso_pu_bacteria 2960645483 2960649615 278
238 iso_pu_bacteria 2960652885 2960657943 278
239 iso_pu_bacteria 2960660292 2960664620 278
240 iso_pu_bacteria 2960667422 2960667784 278
241 iso_pu_bacteria 2960674078 2960678226 278
242 iso_pu_bacteria 2960687367 2960693625 278
243 iso_pu_bacteria 2964607997 2964613312 278
244 iso_pu_bacteria 2964615318 2964615914 278
245 iso_pu_bacteria 2964621998 2964627514 278
246 iso_pu_bacteria 2964628898 2964632403 278
247 iso_pu_bacteria 2964636051 2964636739 278
248 iso_pu_bacteria 2964643177 2964648464 278
249 iso_pu_bacteria 2964649959 2964656034 278
250 iso_pu_bacteria 2964656573 2964657293 278
251 iso_pu_bacteria 2964663802 2964670653 278
252 iso_pu_bacteria 2964670856 2964676231 278
253 iso_pu_bacteria 2964678106 2964682564 278
254 iso_pu_bacteria 2964685014 2964688422 278
255 iso_pu_bacteria 2964691889 2964697979 278
256 iso_pu_bacteria 2964698721 2964703973 278
257 iso_pu_bacteria 2964705432 2964709468 278
258 iso_pu_bacteria 2964712639 2964714263 278
259 iso_pu_bacteria 2964719344 2964724530 278
260 iso_pu_bacteria 2967664464 2967666884 278
261 iso_pu_bacteria 2967671571 2967674085 278
262 iso_pu_bacteria 2967678726 2967684307 278
263 iso_pu_bacteria 2967693043 2967693720 278
264 iso_pu_bacteria 2967699805 2967704695 278
265 iso_pu_bacteria 2967706974 2967710957 278
266 iso_pu_bacteria 2967714385 2967715543 278
267 iso_pu_bacteria 2967721400 2967725121 278
268 iso_pu_bacteria 2967735183 2967736065 278
269 iso_pu_bacteria 2967748971 2967751146 278
270 iso_pu_bacteria 2967755722 2967762101 278
271 iso_pu_bacteria 2967762386 2967768258 278
272 iso_pu_bacteria 2967769361 2967775444 278
273 iso_pu_bacteria 2967775926 2967779672 278
274 iso_pu_bacteria 2970019648 2970022931 278
275 iso_pu_bacteria 2970033650 2970037918 278
276 iso_pu_bacteria 2970040964 2970042039 278
277 iso_pu_bacteria 2970047711 2970053204 278
278 iso_pu_bacteria 2970054988 2970055470 278
279 iso_pu_bacteria 2970061556 2970065079 278
280 iso_pu_bacteria 2970068827 2970071672 278
281 iso_pu_bacteria 2970076120 2970080668 278
282 iso_pu_bacteria 2970082768 2970088684 278
283 iso_pu_bacteria 2970088815 2970092281 278
284 iso_pu_bacteria 2970095765 2970100502 278
285 iso_pu_bacteria 2970102677 2970103558 278
286 iso_pu_bacteria 2970109326 2970114696 278
287 iso_pu_bacteria 2970116247 2970116554 278
288 iso_pu_bacteria 2970129317 2970130519 278
289 iso_pu_bacteria 2970136068 2970138527 278
290 iso_pu_bacteria 2970149975 2970155154 278
291 iso_pu_bacteria 2970156795 2970157367 278
292 iso_pu_bacteria 2970164137 2970165764 278
293 iso_pu_bacteria 2970170962 2970177603 278
294 iso_pu_bacteria 2970177841 2970180381 278
295 iso_pu_bacteria 2970184632 2970186023 278
296 iso_pu_bacteria 2970191845 2970192151 278
297 iso_pu_bacteria 2977516862 2977518132 278
298 iso_pu_bacteria 2977523885 2977528285 278
299 iso_pu_bacteria 2977537788 2977538939 278
300 iso_pu_bacteria 2977551784 2977552517 278
301 iso_pu_bacteria 2977558990 2977561950 278
302 iso_pu_bacteria 2977565890 2977570746 278
303 iso_pu_bacteria 2977572785 2977579330 278
304 iso_pu_bacteria 2977579622 2977580872 278
305 iso_pu_bacteria 2996336353 2996339568 278
306 iso_pu_bacteria 648276728 648737556 278
307 iso_pu_bacteria 8003992118 8003996518 278
308 iso_pu_bacteria 8056875544 8056876385 278
309 3300032002 Ga0307416_100817271 Ga0307416_1008172711 279
310 3300049568 Ga0501031_0000064 Ga0501031_0000064_1298_2146 279
311 3300049569 Ga0501032_0002801 Ga0501032_0002801_11419_12267 279
312 3300049570 Ga0501033_0000053 Ga0501033_0000053_1298_2146 279
313 3300049570 Ga0501033_0035020 Ga0501033_0035020_2444_3286 279
314 3300049571 Ga0501034_0000030 Ga0501034_0000030_246035_246883 279
315 3300049572 Ga0501036_0002921 Ga0501036_0002921_11439_12287 279
316 3300049573 Ga0501037_0002386 Ga0501037_0002386_11414_12262 279
317 3300049574 Ga0501038_0004075 Ga0501038_0004075_11442_12290 279
318 3300049575 Ga0501039_0000008 Ga0501039_0000008_272633_273481 279
319 3300049576 Ga0501040_0046065 Ga0501040_0046065_932_1780 279
320 3300049579 Ga0501043_0003198 Ga0501043_0003198_11402_12250 279
321 3300049581 Ga0501047_0003942 Ga0501047_0003942_1270_2118 279
322 3300049822 Ga0501035_0000031 Ga0501035_0000031_173446_174294 279
323 3300049823 Ga0501044_0000008 Ga0501044_0000008_272633_273481 279
324 3300049823 Ga0501044_0055728 Ga0501044_0055728_1759_2601 279
325 iso_pu_bacteria 2503198000 2503199225 279
326 iso_pu_bacteria 2508501123 2509117216 279
327 iso_pu_bacteria 2509276018 2509371726 279
328 iso_pu_bacteria 2509276022 2509394162 279
329 iso_pu_bacteria 2510065059 2510318145 279
330 iso_pu_bacteria 2511231027 2511390418 279
331 iso_pu_bacteria 2513237090 2513610460 279
332 iso_pu_bacteria 2513237351 2514588511 279
333 iso_pu_bacteria 2599185301 2599937140 279
334 iso_pu_bacteria 2643221595 2643988327 279
335 iso_pu_bacteria 2643221627 2644154756 279
336 iso_pu_bacteria 2687453392 2688596506 279
337 iso_pu_bacteria 2693429783 2694631674 279
338 iso_pu_bacteria 2693429784 2694638083 279
339 iso_pu_bacteria 2791355123 2792747764 279
340 iso_pu_bacteria 2842871566 2842875950 279
341 iso_pu_bacteria 2844009547 2844011334 279
342 iso_pu_bacteria 2856320880 2856327365 279
343 iso_pu_bacteria 2856328259 2856328347 279
344 iso_pu_bacteria 2856334872 2856337769 279
345 iso_pu_bacteria 2857367948 2857375215 279
346 iso_pu_bacteria 2869162929 2869165949 279
347 iso_pu_bacteria 2869169390 2869175540 279
348 iso_pu_bacteria 2869234852 2869237929 279
349 iso_pu_bacteria 2869242130 2869247060 279
350 iso_pu_bacteria 2869249662 2869249970 279
351 iso_pu_bacteria 2869256925 2869257240 279
352 iso_pu_bacteria 2869264136 2869266350 279
353 iso_pu_bacteria 2869271264 2869273802 279
354 iso_pu_bacteria 2869278585 2869280596 279
355 iso_pu_bacteria 2871435913 2871438108 279
356 iso_pu_bacteria 2871451962 2871459374 279
357 iso_pu_bacteria 2871459585 2871461935 279
358 iso_pu_bacteria 2871481445 2871482191 279
359 iso_pu_bacteria 2871495908 2871500349 279
360 iso_pu_bacteria 2874123672 2874130250 279
361 iso_pu_bacteria 2874131515 2874132836 279
362 iso_pu_bacteria 2874139085 2874140035 279
363 iso_pu_bacteria 2874162495 2874165419 279
364 iso_pu_bacteria 2874168670 2874176655 279
365 iso_pu_bacteria 2876369609 2876376109 279
366 iso_pu_bacteria 2876386047 2876390114 279
367 iso_pu_bacteria 2876392853 2876393119 279
368 iso_pu_bacteria 2876399893 2876405390 279
369 iso_pu_bacteria 2876406927 2876409033 279
370 iso_pu_bacteria 2876420981 2876423977 279
371 iso_pu_bacteria 2878730984 2878734380 279
372 iso_pu_bacteria 2878738818 2878741936 279
373 iso_pu_bacteria 2878760144 2878764438 279
374 iso_pu_bacteria 2878767105 2878771539 279
375 iso_pu_bacteria 2878774303 2878779387 279
376 iso_pu_bacteria 2878781027 2878782545 279
377 iso_pu_bacteria 2881147464 2881148707 279
378 iso_pu_bacteria 2881161766 2881165487 279
379 iso_pu_bacteria 2885305155 2885307343 279
380 iso_pu_bacteria 2885326080 2885327293 279
381 iso_pu_bacteria 2903513507 2903518031 279
382 iso_pu_bacteria 2903540706 2903545162 279
383 iso_pu_bacteria 2904659560 2904662435 279
384 iso_pu_bacteria 2906363423 2906366174 279
385 iso_pu_bacteria 2906370794 2906377719 279
386 iso_pu_bacteria 2906386501 2906388697 279
387 iso_pu_bacteria 2906393657 2906394313 279
388 iso_pu_bacteria 2906401398 2906404751 279
389 iso_pu_bacteria 2906408224 2906410083 279
390 iso_pu_bacteria 2922151315 2922154074 279
391 iso_pu_bacteria 2922172374 2922173504 279
392 iso_pu_bacteria 2922178524 2922178872 279
393 iso_pu_bacteria 2924718760 2924719342 279
394 iso_pu_bacteria 2924733363 2924734469 279
395 iso_pu_bacteria 2924741084 2924745911 279
396 iso_pu_bacteria 2924748358 2924753509 279
397 iso_pu_bacteria 2924776078 2924779620 279
398 iso_pu_bacteria 2937848649 2937852758 279
399 iso_pu_bacteria 2937861824 2937864399 279
400 iso_pu_bacteria 2937868953 2937876891 279
401 iso_pu_bacteria 2937877337 2937878112 279
402 iso_pu_bacteria 2937972304 2937972980 279
403 iso_pu_bacteria 2937980651 2937984006 279
404 iso_pu_bacteria 2937994558 2937999009 279
405 iso_pu_bacteria 2958034702 2958036468 279
406 iso_pu_bacteria 2958041894 2958046123 279
407 iso_pu_bacteria 2958064165 2958068488 279
408 iso_pu_bacteria 2958084443 2958085226 279
409 iso_pu_bacteria 2958092219 2958098248 279
410 iso_pu_bacteria 2958108152 2958110005 279
411 iso_pu_bacteria 2958122699 2958129326 279
412 iso_pu_bacteria 2958137437 2958140571 279
413 iso_pu_bacteria 2958144490 2958145957 279
414 iso_pu_bacteria 2958158011 2958162889 279
415 iso_pu_bacteria 2958165035 2958169483 279
416 iso_pu_bacteria 2961114664 2961116203 279
417 iso_pu_bacteria 2961136820 2961144723 279
418 iso_pu_bacteria 2961163497 2961167943 279
419 iso_pu_bacteria 2961183825 2961189814 279
420 iso_pu_bacteria 2965018300 2965022762 279
421 iso_pu_bacteria 2965025482 2965030881 279
422 iso_pu_bacteria 2965032056 2965036858 279
423 iso_pu_bacteria 2965040258 2965043541 279
424 iso_pu_bacteria 2965047637 2965049362 279
425 iso_pu_bacteria 2965089291 2965090131 279
426 iso_pu_bacteria 2965102966 2965103781 279
427 iso_pu_bacteria 2968016561 2968023405 279
428 iso_pu_bacteria 2968138860 2968145867 279
429 iso_pu_bacteria 2968171901 2968176343 279
430 iso_pu_bacteria 2970469710 2970475987 279
431 iso_pu_bacteria 2970489779 2970493643 279
432 iso_pu_bacteria 2970510686 2970512182 279
433 iso_pu_bacteria 2970547951 2970550259 279
434 iso_pu_bacteria 2970554993 2970559282 279
435 iso_pu_bacteria 2970593180 2970595250 279
436 iso_pu_bacteria 2970619444 2970619760 279
437 iso_pu_bacteria 2970627176 2970630986 279
438 iso_pu_bacteria 2977851361 2977852223 279
439 iso_pu_bacteria 2977864932 2977871432 279
440 iso_pu_bacteria 2977872689 2977873902 279
441 iso_pu_bacteria 2977898635 2977900710 279
442 iso_pu_bacteria 2977907340 2977913080 279
443 iso_pu_bacteria 2977915119 2977921782 279
444 iso_pu_bacteria 2977922695 2977926379 279
445 iso_pu_bacteria 2977935797 2977941732 279
446 iso_pu_bacteria 2977950692 2977957346 279
447 iso_pu_bacteria 2977957713 2977964015 279
448 iso_pu_bacteria 2979764755 2979766030 279
449 iso_pu_bacteria 2979772303 2979773383 279
450 iso_pu_bacteria 2987645492 2987645519 279
451 iso_pu_bacteria 2987659509 2987663957 279
452 iso_pu_bacteria 2987673487 2987675579 279
453 iso_pu_bacteria 2996348954 2996354570 279
454 iso_pu_bacteria 2996386984 2996387714 279
455 iso_pu_bacteria 3004188549 3004193012 279
456 iso_pu_bacteria 3004211236 3004218188 279
457 iso_pu_bacteria 3004218560 3004222860 279
458 iso_pu_bacteria 3004232784 3004234940 279
459 iso_pu_bacteria 3004239961 3004242085 279
460 iso_pu_bacteria 3004248173 3004250345 279
461 iso_pu_bacteria 3004268573 3004269034 279
462 iso_pu_bacteria 3004275668 3004281218 279
463 iso_pu_bacteria 3004289098 3004290926 279
464 iso_pu_bacteria 649633066 649871057 279
465 iso_pu_bacteria 8004300914 8004305167 279
466 iso_pu_bacteria 8004312739 8004314661 279
467 iso_pu_bacteria 8004361976 8004362531 279
468 iso_pu_bacteria 8004695233 8004697383 279
469 iso_pu_bacteria 8004727605 8004734235 279
470 3300002773 JGI25152J39213_1005341 JGI25152J39213_10053414 280
471 3300003771 Ga0055526_1017562 Ga0055526_10175623 280
472 3300003790 Ga0055528_1025676 Ga0055528_10256763 280
473 3300006042 Ga0075368_10118050 Ga0075368_101180501 280
474 3300006051 Ga0075364_10012341 Ga0075364_100123417 280
475 3300006178 Ga0075367_10002312 Ga0075367_100023125 280
476 3300009011 Ga0105251_10051426 Ga0105251_100514262 280
477 3300009553 Ga0105249_10091909 Ga0105249_100919092 280
478 3300014325 Ga0163163_10130050 Ga0163163_101300504 280
479 3300025258 Ga0209129_1000690 Ga0209129_100069020 280
480 3300025273 Ga0209673_1008881 Ga0209673_10088815 280
481 3300025273 Ga0209673_1016543 Ga0209673_10165432 280
482 3300025294 Ga0209025_1005866 Ga0209025_10058669 280
483 3300025295 Ga0209564_1001102 Ga0209564_100110211 280
484 3300025299 Ga0209256_1007658 Ga0209256_10076586 280
485 3300025299 Ga0209256_1024693 Ga0209256_10246932 280
486 3300025299 Ga0209256_1034990 Ga0209256_10349902 280
487 3300025303 Ga0209051_1001177 Ga0209051_10011776 280
488 3300028380 Ga0268265_10088971 Ga0268265_100889712 280
489 3300048908 Ga0496105_0001811 Ga0496105_0001811_13633_14475 280
490 3300048911 Ga0496108_0261487 Ga0496108_0261487_575_1417 280
491 3300048914 Ga0496111_0123075 Ga0496111_0123075_284_1126 280
492 3300048917 Ga0496114_0010906 Ga0496114_0010906_5268_6110 280
493 3300048922 Ga0496119_0001603 Ga0496119_0001603_25270_26112 280
494 3300048924 Ga0496121_0000710 Ga0496121_0000710_48790_49632 280
495 3300048924 Ga0496121_0283281 Ga0496121_0283281_120_962 280
496 3300048925 Ga0496122_0065842 Ga0496122_0065842_134_976 280
497 3300049589 Ga0501073_0111707 Ga0501073_0111707_546_1391 280
498 3300053139 Ga0500568_0000357 Ga0500568_0000357_33177_34019 280
499 3300053177 Ga0500636_0000656 Ga0500636_0000656_9817_10659 280
500 3300060353 Ga0501082_0287237 Ga0501082_0287237_13_858 280
501 iso_pu_bacteria 2968110612 2968113500 280
502 3300003320 rootH2_10005148 rootH2_100051486 281
503 3300003792 Ga0055540_1002996 Ga0055540_100299610 281
504 3300006177 Ga0075362_10021063 Ga0075362_100210633 281
505 3300022739 Ga0228711_1028457 Ga0228711_10284572 281
506 3300022739 Ga0228711_1028458 Ga0228711_10284584 281
507 3300022740 Ga0228710_1008201 Ga0228710_10082012 281
508 3300027111 Ga0209281_1000087 Ga0209281_100008729 281
509 3300027666 Ga0209282_1000008 Ga0209282_100000830 281
510 3300031967 Ga0315914_1000011 Ga0315914_1000011143 281
511 3300033430 Ga0315913_1000008 Ga0315913_1000008127 281
512 3300033464 Ga0315915_1000009 Ga0315915_1000009186 281
513 3300048924 Ga0496121_0035067 Ga0496121_0035067_957_1811 281
514 3300049778 Ga0501282_009526 Ga0501282_009526_106_951 281
515 3300050489 nmdc:mga03683_67621_c1 nmdc:mga03683_67621_c1_513_1358 281
516 3300050516 nmdc:mga0sz30_21463_c2 nmdc:mga0sz30_21463_c2_744_1589 281
517 3300053087 Ga0500643_018082 Ga0500643_018082_183_1028 281
518 iso_pu_bacteria 2508501127 2509144236 281
519 iso_pu_bacteria 2597489875 2597811724 281
520 iso_pu_bacteria 2841734538 2841736928 281
521 iso_pu_bacteria 2856342000 2856345278 281
522 iso_pu_bacteria 2871474448 2871481144 281
523 iso_pu_bacteria 2885312484 2885313610 281
524 iso_pu_bacteria 2888343758 2888344894 281
525 iso_pu_bacteria 2924754689 2924759359 281
526 iso_pu_bacteria 2924762789 2924765464 281
527 iso_pu_bacteria 2937822353 2937825380 281
528 iso_pu_bacteria 2937836603 2937841220 281
529 iso_pu_bacteria 2958071322 2958073204 281
530 iso_pu_bacteria 2970524798 2970526622 281
531 iso_pu_bacteria 2970540015 2970540992 281
532 iso_pu_bacteria 2987666974 2987669808 281
533 iso_pu_bacteria 8004395343 8004395405 281
534 iso_pu_bacteria 8004633249 8004634012 281
535 iso_pu_bacteria 8055617313 8055618448 281
536 3300003771 Ga0055526_1008287 Ga0055526_10082874 282
537 3300003775 Ga0055524_1014834 Ga0055524_10148342 282
538 3300009766 Ga0123342_1024199 Ga0123342_10241992 282
539 3300021327 Ga0214543_1000018 Ga0214543_1000018172 282
540 3300025972 Ga0207668_10086436 Ga0207668_100864363 282
541 3300027111 Ga0209281_1000188 Ga0209281_100018889 282
542 3300031852 Ga0307410_10144361 Ga0307410_101443612 282
543 3300032004 Ga0307414_10117631 Ga0307414_101176313 282
544 3300041413 Ga0439465_0114268 Ga0439465_0114268_72_920 282
545 3300046460 Ga0495638_0013394 Ga0495638_0013394_4653_5534 282
546 3300048916 Ga0496113_0124718 Ga0496113_0124718_622_1476 282
547 3300048927 Ga0496124_0000929 Ga0496124_0000929_8527_9384 282
548 3300050491 nmdc:mga00v17_1012_c1 nmdc:mga00v17_1012_c1_9909_10790 282
549 3300050494 nmdc:mga06z11_91874_c1 nmdc:mga06z11_91874_c1_227_1102 282
550 3300053111 Ga0500572_001986 Ga0500572_001986_2992_3873 282
551 iso_pu_bacteria 2513237088 2513595901 282
552 3300002741 JGI25157J39369_1003336 JGI25157J39369_10033362 283
553 3300003203 JGI25406J46586_10013564 JGI25406J46586_100135644 283
554 3300005614 Ga0068856_100040848 Ga0068856_1000408482 283
555 3300005985 Ga0081539_10008993 Ga0081539_100089937 283
556 3300006038 Ga0075365_10089230 Ga0075365_100892303 283
557 3300025250 Ga0209026_1000032 Ga0209026_1000032254 283
558 3300025256 Ga0209759_1000500 Ga0209759_10005007 283
559 3300025913 Ga0207695_10033428 Ga0207695_100334285 283
560 3300028786 Ga0307517_10234158 Ga0307517_102341582 283
561 3300042004 Ga0439445_0022790 Ga0439445_0022790_370_1230 283
562 3300047443 Ga0495687_063284 Ga0495687_063284_504_1358 283
563 3300048905 Ga0496102_0212052 Ga0496102_0212052_717_1568 283
564 3300048912 Ga0496109_0274790 Ga0496109_0274790_554_1405 283
565 3300048923 Ga0496120_0065603 Ga0496120_0065603_581_1432 283
566 3300050491 nmdc:mga00v17_169786_c1 nmdc:mga00v17_169786_c1_539_1393 283
567 3300050492 nmdc:mga0yw44_216871_c1 nmdc:mga0yw44_216871_c1_78_929 283
568 3300053155 Ga0500620_000440 Ga0500620_000440_5143_5997 283

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03764

EFG_IV

Elongation factor G, domain IV

27

112

0.96

PF14492

EFG_III

Elongation Factor G, domain III

1

26

0.96

PF04962

KduI

KduI/IolB family

69

300

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
1xru-assembly1.cif.gz_A crystal structure of 5-keto-4-deoxyuronate isomerase from eschericia coli 0.9694 7 283
7yrs-assembly4.cif.gz_D crystal structure of lactobacillus rhamnosus 4-deoxy-l-threo-5-hexosulose-uronate ketol-isomerase kdui complexed with mops 0.9688 6 268
1ywk-assembly3.cif.gz_C crystal structure of 4-deoxy-1-threo-5-hexosulose-uronate ketol-isomerase from enterococcus faecalis 0.9681 7 266
7ye3-assembly1.cif.gz_C crystal structure of lactobacillus rhamnosus 4-deoxy-l-threo-5-hexosulose-uronate ketol-isomerase kdui complexed with mes 0.968 6 279
1ywk-assembly6.cif.gz_F crystal structure of 4-deoxy-1-threo-5-hexosulose-uronate ketol-isomerase from enterococcus faecalis 0.9679 7 266
ID Description Score Start End Superfamily
af_Q46938_25_265_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9716 33 268 2.60.120.10
1ywkB00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.968 6 266 2.60.120.10
1ywkB00 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9568 6 266 2.60.120.10
1x8mA02 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.949 152 268 2.60.120.10
af_Q46938_25_265_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9479 33 268 2.60.120.10
ID Description Score Start End GO Terms
AF-A0A526VBP8-F1-model_v4 5-dehydro-4-deoxy-D-glucuronate isomerase (EC 5.3.1.17) 0.9931 1 150 GO:0008697
GO:0019698
GO:0042840
GO:0045490
GO:0046872
AF-A0A5J4SUE0-F1-model_v4 5-dehydro-4-deoxy-D-glucuronate isomerase (EC 5.3.1.17) 0.9918 6 121 GO:0008697
GO:0019698
GO:0042840
GO:0045490
GO:0046872
AF-A0A484YH81-F1-model_v4 5-keto-4-deoxyuronate isomerase (EC 5.3.1.17) 0.9913 74 147 GO:0008697
GO:0019698
GO:0042840
GO:0045490
GO:0046872
AF-A0A351RGT4-F1-model_v4 deleted 0.9878 9 143
AF-A0A526VBP8-F1-model_v4 5-dehydro-4-deoxy-D-glucuronate isomerase (EC 5.3.1.17) 0.9865 1 150 GO:0008697
GO:0019698
GO:0042840
GO:0045490
GO:0046872

Feature Viewer

pLDDT pTM Quality
93.19 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map