F464677

General Info

Members Datasets Scaffolds Average Seq Length
568 320 554 318

Family's Representative Sequence

Representative Sequence 3300053077|Ga0495601_0014337|Ga0495601_0014337_2881_3939
Length 352
Sequence MRARPPGLDGAGQMAPAGRYAAPMTTMRAIQMTEFGGPEVLELADLPIPEPAAGEVLIRVSRAGVNFADTHTRTNSYVRKATLPLVPGGEVAGTIARAPAEGGGLEEGARVVALTGTGGYAEYATAPAAHAFAIPDGVEDGTALALIVQGTTAWHLYRTAGRVAEGESVVVHSAAGGVGSLAVQLGHALGAGRVIGTASSEKRRELALSLGADAAVDPAPEGLTERLLQANGGEPVDVVLDMAGGATFDASYEALSHFGRIVVCGISSEEPNRVSTGSLLRHSRAVVGFYLFHCLQRPGMFGEALADLFARVARGELQAVVGGTYPLAEAARAHEDLRGRRTTGKLLLDPAA

Samples

Sample ID Description Type Environment
1 2585427649 Amycolatopsis japonica MG417-CF17, DSM 44213 Isolate Unclassified
2 2751185734 Saccharothrix sp. NRRL B-16314 Isolate Rhizosphere
3 2795385472 Herbihabitans rhizosphaerae DSM 101727 Isolate Rhizosphere
4 2808606522 Amycolatopsis sp. BJA-103 Isolate Unclassified
5 2833709550 Microbacterium sp. 3290 Isolate Rhizosphere
6 2837183177 Egibacter rhizosphaerae EGI 80759 Isolate Unclassified
7 2862574272 Streptomyces sp. AcE210 Isolate Nodule
8 2870721527 Saccharothrix ecbatanensis DSM 45486 Isolate Rhizosphere
9 2915768154 Amycolatopsis pittospori PIP199 Isolate Unclassified
10 2917736166 Amycolatopsis dendrobii DR6-1 Isolate Unclassified
11 2995463766 Streptacidiphilus fuscans NEAU-YB345 Isolate Unclassified
12 2997451912 Streptomyces piniterrae jys28 Isolate Rhizosphere
13 3006321560 Actinacidiphila epipremni PRB2-1 Isolate Unclassified
14 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
15 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
16 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
17 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
18 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
19 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
20 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
21 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
22 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
23 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
24 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
25 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
26 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
27 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
28 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
29 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
30 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
31 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
32 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
33 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
34 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
35 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
36 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
37 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
38 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
39 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
40 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
41 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
42 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
43 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
44 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
45 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
46 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
47 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
48 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
49 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
50 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
51 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
52 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
53 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
54 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
55 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
56 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
57 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
58 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
59 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
60 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
61 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
62 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
63 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
64 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
65 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
66 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
67 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
68 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
69 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
70 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
71 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
72 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
73 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
74 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
75 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
76 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
77 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
78 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
79 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
80 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
81 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
82 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
83 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
84 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
85 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
86 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
87 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
88 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
89 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
90 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
91 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
92 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
93 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
94 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
95 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
96 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
97 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
98 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
99 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
100 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
101 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
102 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
103 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
104 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
105 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
106 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
107 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
108 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
109 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
110 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
111 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
112 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
113 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
114 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
115 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
116 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
117 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
118 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
119 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
173 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
174 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
175 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
176 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
177 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
180 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
181 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
182 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
183 3300030736 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 Metagenome Rhizosphere
184 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
185 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
186 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
187 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
188 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
189 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
190 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
191 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
192 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
193 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
194 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
195 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
196 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
197 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
198 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
199 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
200 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
201 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
202 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
203 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
204 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
205 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
206 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
207 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
208 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
209 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
210 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
211 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
212 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
213 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
214 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
215 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
216 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
217 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
218 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
219 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
220 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
221 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
222 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
223 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
224 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
225 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
226 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
227 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
228 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
229 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
230 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
231 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
232 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
233 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
234 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
235 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
236 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
237 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
238 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
239 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
240 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
241 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
242 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
243 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
244 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
245 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
246 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
247 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
248 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
249 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
250 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
251 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
252 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
253 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
254 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
255 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
256 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
257 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
258 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
259 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
260 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
261 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
262 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
263 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
264 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
265 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
266 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
267 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
268 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
269 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
270 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
271 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
272 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
273 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
274 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
275 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
276 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
277 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
278 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
279 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
280 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
281 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
282 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
283 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
284 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
285 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
286 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
287 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
288 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
289 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
290 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
291 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
292 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
293 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
294 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
295 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
296 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
297 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
298 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
299 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
300 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
301 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
302 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
303 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
304 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
305 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
306 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
307 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
308 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
309 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
310 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
311 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
312 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
313 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
314 3300053126 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere Metagenome Endosphere
315 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
316 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
317 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
318 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
319 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
320 8047710418 Umezawaea endophytica DSM 103496 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 97.18
Metatranscriptomes 0.35
Isolates 2.46

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.58
Nodule 0.18
Rhizoplane 8.27
Rhizosphere 87.15
Stem 0
Stem Tuber 0
Unclassified 2.82

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24735J21928_10008106 3300002067 Bacteria 3408
2 JGI25160J50197_1027544 3300003354 Bacteria 1544
3 Ga0070658_10149554 3300005327 Bacteria 1954
4 Ga0070676_10016946 3300005328 Bacteria 4028
5 Ga0070676_10078983 3300005328 Bacteria 1991
6 Ga0070676_10099842 3300005328 Bacteria 1791
7 Ga0070683_100021152 3300005329 Bacteria 5801
8 Ga0070690_100057431 3300005330 Bacteria 2498
9 Ga0070670_100003423 3300005331 Bacteria 13166
10 Ga0070670_100003853 3300005331 Bacteria 12508
11 Ga0070670_100151587 3300005331 Bacteria 2006
12 Ga0070677_10006162 3300005333 Bacteria 3980
13 Ga0068869_100002225 3300005334 Bacteria 11665
14 Ga0068869_100053236 3300005334 Bacteria 2941
15 Ga0068869_100298279 3300005334 Bacteria 1300
16 Ga0070666_10075883 3300005335 Bacteria 2292
17 Ga0070666_10078019 3300005335 Bacteria 2261
18 Ga0070680_100140990 3300005336 Bacteria 2021
19 Ga0070680_100168411 3300005336 Bacteria 1843
20 Ga0070682_100008989 3300005337 Bacteria 5646
21 Ga0070682_100099709 3300005337 Bacteria 1915
22 Ga0068868_100000506 3300005338 Bacteria 26045
23 Ga0068868_100002416 3300005338 Bacteria 12929
24 Ga0068868_100086667 3300005338 Bacteria 2517
25 Ga0068868_100128776 3300005338 Bacteria 2070
26 Ga0070660_100073883 3300005339 Bacteria 2666
27 Ga0070660_100245163 3300005339 Bacteria 1460
28 Ga0070689_100195733 3300005340 Bacteria 1648
29 Ga0070691_10003548 3300005341 Bacteria 7035
30 Ga0070687_100015465 3300005343 Bacteria 3452
31 Ga0070661_100013545 3300005344 Bacteria 5725
32 Ga0070661_100162632 3300005344 Bacteria 1691
33 Ga0070692_10025409 3300005345 Bacteria 2918
34 Ga0070675_100002379 3300005354 Bacteria 14006
35 Ga0070675_100036729 3300005354 Bacteria 3988
36 Ga0070675_100183178 3300005354 Bacteria 1812
37 Ga0070671_100015608 3300005355 Bacteria 6137
38 Ga0070671_100110448 3300005355 Bacteria 2309
39 Ga0070674_100034607 3300005356 Bacteria 3375
40 Ga0070674_100046514 3300005356 Bacteria 2969
41 Ga0070673_100000290 3300005364 Bacteria 26028
42 Ga0070673_100090496 3300005364 Bacteria 2500
43 Ga0070667_100300496 3300005367 Bacteria 1445
44 Ga0070667_100334616 3300005367 Bacteria 1368
45 Ga0070709_10036390 3300005434 Bacteria 2998
46 Ga0070713_100029854 3300005436 Bacteria 4323
47 Ga0070713_100070019 3300005436 Bacteria 2960
48 Ga0070710_10000271 3300005437 Bacteria 24519
49 Ga0070710_10029817 3300005437 Bacteria 2930
50 Ga0070710_10117396 3300005437 Bacteria 1606
51 Ga0070710_10193769 3300005437 Bacteria 1279
52 Ga0070711_100000326 3300005439 Bacteria 24637
53 Ga0070711_100420716 3300005439 Bacteria 1089
54 Ga0070700_100007928 3300005441 Bacteria 5763
55 Ga0070700_100128890 3300005441 Bacteria 1704
56 Ga0070700_100169288 3300005441 Bacteria 1511
57 Ga0070663_100002860 3300005455 Bacteria 9823
58 Ga0070663_100199127 3300005455 Bacteria 1562
59 Ga0070678_100002873 3300005456 Bacteria 9539
60 Ga0070678_100006404 3300005456 Bacteria 6906
61 Ga0070678_100041381 3300005456 Bacteria 3266
62 Ga0070662_100045540 3300005457 Bacteria 3148
63 Ga0070662_100091596 3300005457 Bacteria 2284
64 Ga0070662_100306071 3300005457 Bacteria 1292
65 Ga0070681_10017899 3300005458 Bacteria 7082
66 Ga0070681_10020771 3300005458 Bacteria 6578
67 Ga0068867_100009938 3300005459 Bacteria 6703
68 Ga0068867_100056416 3300005459 Bacteria 2906
69 Ga0070685_10033859 3300005466 Bacteria 2874
70 Ga0070707_100061114 3300005468 Bacteria 3613
71 Ga0070698_100402490 3300005471 Bacteria 1302
72 Ga0070699_100305811 3300005518 Bacteria 1427
73 Ga0070679_100022494 3300005530 Bacteria 6161
74 Ga0070679_100022860 3300005530 Bacteria 6115
75 Ga0070679_100045732 3300005530 Bacteria 4362
76 Ga0070684_100248828 3300005535 Bacteria 1624
77 Ga0068853_100103336 3300005539 Bacteria 2522
78 Ga0068853_100162990 3300005539 Bacteria 2013
79 Ga0070672_100003493 3300005543 Bacteria 10182
80 Ga0070686_100149891 3300005544 Bacteria 1632
81 Ga0070693_100002484 3300005547 Bacteria 8496
82 Ga0070693_100170341 3300005547 Bacteria 1394
83 Ga0070665_100027256 3300005548 Bacteria 5754
84 Ga0070665_100062791 3300005548 Bacteria 3724
85 Ga0070665_100526605 3300005548 Bacteria 1194
86 Ga0068855_100167154 3300005563 Bacteria 2493
87 Ga0070664_100005082 3300005564 Bacteria 10551
88 Ga0070664_100090735 3300005564 Bacteria 2644
89 Ga0070664_100105592 3300005564 Bacteria 2453
90 Ga0068854_100001523 3300005578 Bacteria 14057
91 Ga0068854_100018014 3300005578 Bacteria 4735
92 Ga0068856_100007435 3300005614 Bacteria 10690
93 Ga0068856_100158159 3300005614 Bacteria 2276
94 Ga0070702_100001869 3300005615 Bacteria 8805
95 Ga0070702_100003637 3300005615 Bacteria 6936
96 Ga0070702_100011469 3300005615 Bacteria 4409
97 Ga0070702_100017476 3300005615 Bacteria 3700
98 Ga0070702_100282862 3300005615 Bacteria 1139
99 Ga0068852_100001955 3300005616 Bacteria 14037
100 Ga0068852_100039516 3300005616 Bacteria 3972
101 Ga0068852_100077349 3300005616 Bacteria 2941
102 Ga0068852_100227546 3300005616 Bacteria 1776
103 Ga0068859_100510001 3300005617 Bacteria 1298
104 Ga0068864_100051888 3300005618 Bacteria 3534
105 Ga0068864_100110090 3300005618 Bacteria 2452
106 Ga0068864_100248548 3300005618 Bacteria 1650
107 Ga0068866_10018149 3300005718 Bacteria 3177
108 Ga0068866_10216622 3300005718 Bacteria 1153
109 Ga0068861_100179309 3300005719 Bacteria 1762
110 Ga0068861_100181051 3300005719 Bacteria 1754
111 Ga0068851_10006943 3300005834 Bacteria 5190
112 Ga0068870_10204620 3300005840 Bacteria 1199
113 Ga0068863_100016289 3300005841 Bacteria 7133
114 Ga0068863_100024215 3300005841 Bacteria 5790
115 Ga0068863_100033462 3300005841 Bacteria 4897
116 Ga0068863_100437582 3300005841 Bacteria 1282
117 Ga0068858_100068154 3300005842 Bacteria 3297
118 Ga0068858_100105978 3300005842 Bacteria 2624
119 Ga0068858_100328979 3300005842 Bacteria 1461
120 Ga0081538_10003652 3300005981 Bacteria 14456
121 Ga0081538_10011533 3300005981 Bacteria 7153
122 Ga0081540_1000863 3300005983 Bacteria 27456
123 Ga0081539_10005001 3300005985 Bacteria 14004
124 Ga0081539_10096977 3300005985 Bacteria 1511
125 Ga0070717_10415975 3300006028 Bacteria 1209
126 Ga0070717_10447360 3300006028 Bacteria 1164
127 Ga0075432_10018453 3300006058 Bacteria 2380
128 Ga0070712_100051663 3300006175 Bacteria 2864
129 Ga0070712_100234177 3300006175 Bacteria 1460
130 Ga0097621_100005925 3300006237 Bacteria 8639
131 Ga0068871_100006079 3300006358 Bacteria 8496
132 Ga0068871_100011522 3300006358 Bacteria 6486
133 Ga0068871_100470214 3300006358 Bacteria 1129
134 Ga0075428_100010486 3300006844 Bacteria 10297
135 Ga0075428_100084841 3300006844 Bacteria 3455
136 Ga0075430_100185583 3300006846 Bacteria 1729
137 Ga0075431_100046941 3300006847 Bacteria 4453
138 Ga0075431_100063053 3300006847 Bacteria 3824
139 Ga0075433_10150727 3300006852 Bacteria 2069
140 Ga0075434_100012093 3300006871 Bacteria 8173
141 Ga0075429_100020347 3300006880 Bacteria 5756
142 Ga0075429_100062582 3300006880 Bacteria 3242
143 Ga0075429_100111907 3300006880 Bacteria 2386
144 Ga0068865_100040225 3300006881 Bacteria 3175
145 Ga0068865_100050351 3300006881 Bacteria 2877
146 Ga0075436_100029586 3300006914 Bacteria 3766
147 Ga0097620_100509959 3300006931 Bacteria 1298
148 Ga0075435_100000815 3300007076 Bacteria 19432
149 Ga0105251_10050701 3300009011 Bacteria 1982
150 Ga0105240_10007499 3300009093 Bacteria 15829
151 Ga0105240_10012503 3300009093 Bacteria 11713
152 Ga0105240_10057686 3300009093 Bacteria 4849
153 Ga0105240_10129707 3300009093 Bacteria 3026
154 Ga0111539_10290268 3300009094 Bacteria 1903
155 Ga0105245_10009265 3300009098 Bacteria 8587
156 Ga0105245_10060811 3300009098 Bacteria 3403
157 Ga0105245_10278219 3300009098 Bacteria 1635
158 Ga0105245_10357817 3300009098 Bacteria 1448
159 Ga0105245_10511661 3300009098 Bacteria 1218
160 Ga0114129_10016322 3300009147 Bacteria 10571
161 Ga0114129_10056024 3300009147 Bacteria 5524
162 Ga0114129_10166952 3300009147 Bacteria 3003
163 Ga0105243_10009731 3300009148 Bacteria 7322
164 Ga0105243_10026406 3300009148 Bacteria 4444
165 Ga0105243_10124834 3300009148 Bacteria 2176
166 Ga0105243_10612658 3300009148 Bacteria 1050
167 Ga0105241_10003029 3300009174 Bacteria 12554
168 Ga0105248_10016037 3300009177 Bacteria 8246
169 Ga0105248_10082167 3300009177 Bacteria 3622
170 Ga0105248_10095342 3300009177 Bacteria 3350
171 Ga0105248_10420450 3300009177 Bacteria 1505
172 Ga0105237_10000431 3300009545 Bacteria 59607
173 Ga0105237_10153808 3300009545 Bacteria 2296
174 Ga0105238_10027344 3300009551 Bacteria 5811
175 Ga0105238_10207821 3300009551 Bacteria 1933
176 Ga0105249_10071695 3300009553 Bacteria 3201
177 Ga0105239_10021851 3300010375 Bacteria 7054
178 Ga0105239_10228790 3300010375 Bacteria 2086
179 Ga0105246_10001085 3300011119 Bacteria 15741
180 Ga0157370_10140191 3300013104 Bacteria 2253
181 Ga0157369_10438335 3300013105 Bacteria 1353
182 Ga0157374_10000911 3300013296 Bacteria 25717
183 Ga0157374_10188364 3300013296 Bacteria 2018
184 Ga0157374_10204772 3300013296 Bacteria 1933
185 Ga0157374_10427324 3300013296 Bacteria 1324
186 Ga0157378_10076496 3300013297 Bacteria 3016
187 Ga0163162_10006814 3300013306 Bacteria 11084
188 Ga0157372_10000022 3300013307 Bacteria 206038
189 Ga0157372_10568161 3300013307 Bacteria 1322
190 Ga0157375_10001769 3300013308 Bacteria 18549
191 Ga0157375_10036375 3300013308 Bacteria 4710
192 Ga0163163_10023671 3300014325 Bacteria 5832
193 Ga0163163_10143792 3300014325 Bacteria 2428
194 Ga0163163_10319002 3300014325 Bacteria 1607
195 Ga0182008_10234623 3300014497 Bacteria 942
196 Ga0157377_10032234 3300014745 Bacteria 2852
197 Ga0157377_10060511 3300014745 Bacteria 2162
198 Ga0157377_10076425 3300014745 Bacteria 1948
199 Ga0157379_10214132 3300014968 Bacteria 1745
200 Ga0157376_10005443 3300014969 Bacteria 8901
201 Ga0157376_10097525 3300014969 Bacteria 2561
202 Ga0163161_10024730 3300017792 Bacteria 4245
203 Ga0206353_10182179 3300020082 Bacteria 2079
204 Ga0207426_1002250 3300025302 Bacteria 12808
205 Ga0207656_10006689 3300025321 Bacteria 4164
206 Ga0207713_1052834 3300025735 Bacteria 1605
207 Ga0207682_10003415 3300025893 Bacteria 6909
208 Ga0207682_10021726 3300025893 Bacteria 2525
209 Ga0207692_10000110 3300025898 Bacteria 24396
210 Ga0207692_10039479 3300025898 Bacteria 2323
211 Ga0207642_10071238 3300025899 Bacteria 1655
212 Ga0207710_10040903 3300025900 Bacteria 2055
213 Ga0207688_10001198 3300025901 Bacteria 13408
214 Ga0207688_10099623 3300025901 Bacteria 1676
215 Ga0207688_10122542 3300025901 Bacteria 1518
216 Ga0207680_10170816 3300025903 Bacteria 1464
217 Ga0207699_10109962 3300025906 Bacteria 1764
218 Ga0207645_10006949 3300025907 Bacteria 8060
219 Ga0207643_10000125 3300025908 Bacteria 53016
220 Ga0207643_10038359 3300025908 Bacteria 2691
221 Ga0207705_10028217 3300025909 Bacteria 4001
222 Ga0207684_10031595 3300025910 Bacteria 4503
223 Ga0207654_10063063 3300025911 Bacteria 2174
224 Ga0207695_10006100 3300025913 Bacteria 15724
225 Ga0207695_10073737 3300025913 Bacteria 3477
226 Ga0207671_10001590 3300025914 Bacteria 25816
227 Ga0207671_10131395 3300025914 Bacteria 1922
228 Ga0207693_10039655 3300025915 Bacteria 3708
229 Ga0207693_10063941 3300025915 Bacteria 2883
230 Ga0207693_10193426 3300025915 Bacteria 1601
231 Ga0207663_10000379 3300025916 Bacteria 19428
232 Ga0207663_10125655 3300025916 Bacteria 1764
233 Ga0207660_10017794 3300025917 Bacteria 4729
234 Ga0207660_10279483 3300025917 Bacteria 1325
235 Ga0207657_10035210 3300025919 Bacteria 4492
236 Ga0207649_10004951 3300025920 Bacteria 7200
237 Ga0207652_10066100 3300025921 Bacteria 3133
238 Ga0207646_10389653 3300025922 Bacteria 1259
239 Ga0207694_10049972 3300025924 Bacteria 3238
240 Ga0207694_10203102 3300025924 Bacteria 1613
241 Ga0207650_10005762 3300025925 Bacteria 8450
242 Ga0207650_10017951 3300025925 Bacteria 4958
243 Ga0207650_10066187 3300025925 Bacteria 2709
244 Ga0207659_10000428 3300025926 Bacteria 25327
245 Ga0207659_10035778 3300025926 Bacteria 3435
246 Ga0207687_10048994 3300025927 Bacteria 2936
247 Ga0207687_10068102 3300025927 Bacteria 2535
248 Ga0207687_10123589 3300025927 Bacteria 1939
249 Ga0207700_10053448 3300025928 Bacteria 3027
250 Ga0207664_10406746 3300025929 Bacteria 1211
251 Ga0207644_10000583 3300025931 Bacteria 23344
252 Ga0207690_10135985 3300025932 Bacteria 1805
253 Ga0207706_10030590 3300025933 Bacteria 4801
254 Ga0207706_10036583 3300025933 Bacteria 4361
255 Ga0207706_10063915 3300025933 Bacteria 3240
256 Ga0207669_10115848 3300025937 Bacteria 1807
257 Ga0207704_10246539 3300025938 Bacteria 1338
258 Ga0207691_10000948 3300025940 Bacteria 28719
259 Ga0207691_10102816 3300025940 Bacteria 2548
260 Ga0207711_10120421 3300025941 Bacteria 2342
261 Ga0207711_10179348 3300025941 Bacteria 1925
262 Ga0207711_10194299 3300025941 Bacteria 1850
263 Ga0207689_10000198 3300025942 Bacteria 53018
264 Ga0207689_10004523 3300025942 Bacteria 12591
265 Ga0207661_10003071 3300025944 Bacteria 11554
266 Ga0207661_10003247 3300025944 Bacteria 11270
267 Ga0207679_10004505 3300025945 Bacteria 8677
268 Ga0207679_10049257 3300025945 Bacteria 3073
269 Ga0207679_10121514 3300025945 Bacteria 2080
270 Ga0207679_10412110 3300025945 Bacteria 1191
271 Ga0207667_10067350 3300025949 Bacteria 3730
272 Ga0207651_10014981 3300025960 Bacteria 4492
273 Ga0207651_10017968 3300025960 Bacteria 4194
274 Ga0207651_10044129 3300025960 Bacteria 2981
275 Ga0207640_10034098 3300025981 Bacteria 3174
276 Ga0207640_10151067 3300025981 Bacteria 1706
277 Ga0207677_10000856 3300026023 Bacteria 17405
278 Ga0207677_10023483 3300026023 Bacteria 3811
279 Ga0207678_10000141 3300026067 Bacteria 59147
280 Ga0207678_10110680 3300026067 Bacteria 2343
281 Ga0207708_10011989 3300026075 Bacteria 6459
282 Ga0207708_10016633 3300026075 Bacteria 5533
283 Ga0207708_10152849 3300026075 Bacteria 1818
284 Ga0207708_10209491 3300026075 Bacteria 1558
285 Ga0207702_10006992 3300026078 Bacteria 9657
286 Ga0207702_10012008 3300026078 Bacteria 7200
287 Ga0207702_10081251 3300026078 Bacteria 2814
288 Ga0207641_10017988 3300026088 Bacteria 5791
289 Ga0207641_10026463 3300026088 Bacteria 4787
290 Ga0207648_10008599 3300026089 Bacteria 9873
291 Ga0207648_10009609 3300026089 Bacteria 9252
292 Ga0207648_10193459 3300026089 Bacteria 1803
293 Ga0207676_10001346 3300026095 Bacteria 18259
294 Ga0207676_10009032 3300026095 Bacteria 7096
295 Ga0207676_10076926 3300026095 Bacteria 2698
296 Ga0207674_10540757 3300026116 Bacteria 1125
297 Ga0207675_100111926 3300026118 Bacteria 2576
298 Ga0207683_10000172 3300026121 Bacteria 55979
299 Ga0207683_10000313 3300026121 Bacteria 44050
300 Ga0207683_10010950 3300026121 Bacteria 7735
301 Ga0207698_10015047 3300026142 Bacteria 5168
302 Ga0207698_10025915 3300026142 Bacteria 4140
303 Ga0209969_1001278 3300027360 Bacteria 3468
304 Ga0210000_1005439 3300027462 Bacteria 1846
305 Ga0209999_1000296 3300027543 Bacteria 7351
306 Ga0209971_1009581 3300027682 Bacteria 2294
307 Ga0209974_10002906 3300027876 Bacteria 6213
308 Ga0209974_10072904 3300027876 Bacteria 1173
309 Ga0268266_10058570 3300028379 Bacteria 3317
310 Ga0268264_10023387 3300028381 Bacteria 5042
311 Ga0265319_1054827 3300028563 Bacteria 1306
312 Ga0265318_10004816 3300028577 Bacteria 6459
313 Ga0307517_10010040 3300028786 Bacteria 13310
314 Ga0307517_10133063 3300028786 Bacteria 1781
315 Ga0316177_1042586 3300030731 Bacteria 5203
316 Ga0316180_1004638 3300030736 Bacteria 2188
317 Ga0265760_10001145 3300031090 Bacteria 7711
318 Ga0265330_10002094 3300031235 Bacteria 11025
319 Ga0265332_10000673 3300031238 Bacteria 22062
320 Ga0265320_10003250 3300031240 Bacteria 10986
321 Ga0265329_10006060 3300031242 Bacteria 4829
322 Ga0265339_10063293 3300031249 Bacteria 1987
323 Ga0265331_10002978 3300031250 Bacteria 11147
324 Ga0265327_10051674 3300031251 Bacteria 2144
325 Ga0265316_10008265 3300031344 Bacteria 9675
326 Ga0307509_10148950 3300031507 Bacteria 2260
327 Ga0307408_100069624 3300031548 Bacteria 2595
328 Ga0265314_10003101 3300031711 Bacteria 16353
329 Ga0265342_10002141 3300031712 Bacteria 17424
330 Ga0307516_10353047 3300031730 Bacteria 1136
331 Ga0307405_10023706 3300031731 Bacteria 3493
332 Ga0307405_10026517 3300031731 Bacteria 3344
333 Ga0307413_10039450 3300031824 Bacteria 2746
334 Ga0307518_10000036 3300031838 Bacteria 91114
335 Ga0307410_10010700 3300031852 Bacteria 5213
336 Ga0307409_100021443 3300031995 Bacteria 4429
337 Ga0307409_100033985 3300031995 Bacteria 3718
338 Ga0307416_100017969 3300032002 Bacteria 4966
339 Ga0307416_100058124 3300032002 Bacteria 3133
340 Ga0307416_100094899 3300032002 Bacteria 2574
341 Ga0307416_100556510 3300032002 Bacteria 1221
342 Ga0307415_100017115 3300032126 Bacteria 4339
343 Ga0373947_0056069 3300035725 Bacteria 2381
344 Ga0395899_0234581 3300037312 Bacteria 1265
345 Ga0395898_0117044 3300037466 Bacteria 2553
346 Ga0395898_0219930 3300037466 Bacteria 1812
347 Ga0395905_0024577 3300037471 Bacteria 5685
348 Ga0439463_045454 3300042016 Bacteria 1118
349 Ga0439459_0038488 3300042438 Bacteria 1006
350 Ga0451577_0328234 3300042876 Bacteria 1388
351 Ga0466969_0023038 3300044656 Bacteria 3211
352 Ga0466965_0034703 3300044683 Bacteria 2468
353 Ga0466966_0003085 3300044684 Bacteria 10980
354 Ga0466966_0039600 3300044684 Bacteria 3035
355 Ga0466966_0060323 3300044684 Bacteria 2395
356 Ga0466961_0000190 3300044693 Bacteria 40985
357 Ga0466961_0026551 3300044693 Bacteria 3722
358 Ga0466961_0030290 3300044693 Bacteria 3478
359 Ga0466961_0032781 3300044693 Bacteria 3338
360 Ga0466961_0037519 3300044693 Bacteria 3108
361 Ga0466964_0069070 3300044706 Bacteria 1489
362 Ga0466968_0151450 3300044735 Bacteria 1066
363 Ga0466959_0036084 3300045049 Bacteria 3653
364 Ga0466959_0043746 3300045049 Bacteria 3300
365 Ga0466958_0008873 3300045836 Bacteria 5585
366 Ga0466958_0061336 3300045836 Bacteria 2291
367 Ga0466958_0065926 3300045836 Bacteria 2210
368 Ga0466967_0410777 3300045976 Bacteria 1318
369 Ga0495592_0018018 3300046454 Bacteria 5364
370 Ga0495629_0019151 3300046459 Bacteria 4893
371 Ga0495629_0028004 3300046459 Bacteria 4002
372 Ga0495651_0048938 3300046462 Bacteria 3264
373 Ga0495653_0001671 3300046463 Bacteria 17440
374 Ga0495653_0014011 3300046463 Bacteria 6538
375 Ga0495580_0080079 3300046472 Bacteria 2278
376 Ga0495580_0085059 3300046472 Bacteria 2203
377 Ga0495605_0075585 3300046474 Bacteria 1584
378 Ga0495662_0008122 3300046476 Bacteria 5169
379 Ga0495664_0000073 3300046477 Bacteria 49243
380 Ga0495664_0030446 3300046477 Bacteria 3161
381 Ga0495664_0080641 3300046477 Bacteria 1950
382 Ga0495608_0014491 3300046511 Bacteria 5467
383 Ga0495608_0101175 3300046511 Bacteria 1858
384 Ga0495618_0000046 3300046514 Bacteria 93942
385 Ga0495628_0040560 3300046516 Bacteria 3720
386 Ga0495628_0268102 3300046516 Bacteria 1271
387 Ga0495630_0001117 3300046517 Bacteria 18462
388 Ga0495632_0030314 3300046519 Bacteria 2809
389 Ga0495643_0003006 3300046522 Bacteria 12686
390 Ga0495666_0059263 3300046526 Bacteria 1831
391 Ga0495666_0061023 3300046526 Bacteria 1801
392 Ga0495642_0090659 3300046528 Bacteria 1294
393 Ga0495652_0014520 3300046529 Bacteria 7068
394 Ga0495652_0035994 3300046529 Bacteria 4306
395 Ga0495640_0011689 3300046533 Bacteria 6739
396 Ga0495645_0000022 3300046543 Bacteria 137019
397 Ga0495645_0003048 3300046543 Bacteria 11343
398 Ga0495645_0004535 3300046543 Bacteria 9476
399 Ga0495667_0050042 3300046559 Bacteria 2758
400 Ga0495635_0008722 3300046663 Bacteria 7079
401 Ga0495657_0000041 3300046675 Bacteria 115251
402 Ga0495657_0014917 3300046675 Bacteria 5698
403 Ga0495657_0045523 3300046675 Bacteria 2977
404 Ga0495599_0053763 3300046678 Bacteria 2522
405 Ga0495623_0087283 3300046679 Bacteria 1922
406 Ga0495646_0012198 3300046680 Bacteria 5464
407 Ga0495646_0168533 3300046680 Bacteria 1208
408 Ga0495647_0085092 3300046681 Bacteria 1288
409 Ga0495669_0062539 3300046684 Bacteria 1687
410 Ga0495613_0002329 3300046689 Bacteria 14377
411 Ga0495613_0050954 3300046689 Bacteria 3052
412 Ga0495613_0116494 3300046689 Bacteria 1922
413 Ga0495670_0006343 3300046691 Bacteria 5810
414 Ga0495581_0020780 3300047315 Bacteria 3808
415 Ga0495581_0130179 3300047315 Bacteria 1466
416 Ga0495604_0000216 3300047317 Bacteria 52795
417 Ga0495604_0003567 3300047317 Bacteria 12404
418 Ga0495604_0021804 3300047317 Bacteria 5113
419 Ga0495604_0299046 3300047317 Bacteria 1081
420 Ga0495674_0002673 3300047319 Bacteria 17352
421 Ga0495676_0031407 3300047321 Bacteria 4492
422 Ga0495676_0044071 3300047321 Bacteria 3645
423 Ga0495675_0034732 3300047444 Bacteria 3219
424 Ga0495681_0006206 3300047470 Bacteria 7883
425 Ga0495684_0002822 3300047471 Bacteria 13698
426 Ga0495602_0074274 3300048088 Bacteria 2890
427 Ga0496100_0015459 3300048903 Bacteria 4458
428 Ga0496100_0038504 3300048903 Bacteria 3031
429 Ga0496101_0043891 3300048904 Bacteria 3197
430 Ga0496102_0000040 3300048905 Bacteria 196737
431 Ga0496102_0063027 3300048905 Bacteria 3394
432 Ga0496102_0072593 3300048905 Bacteria 3163
433 Ga0496103_0000294 3300048906 Bacteria 46122
434 Ga0496104_0000006 3300048907 Bacteria 536446
435 Ga0496104_0017947 3300048907 Bacteria 6451
436 Ga0496104_0065527 3300048907 Bacteria 3447
437 Ga0496104_0080101 3300048907 Bacteria 3113
438 Ga0496105_0004008 3300048908 Bacteria 11018
439 Ga0496105_0007657 3300048908 Bacteria 8370
440 Ga0496105_0109076 3300048908 Bacteria 2285
441 Ga0496106_0002994 3300048909 Bacteria 12576
442 Ga0496106_0281674 3300048909 Bacteria 1332
443 Ga0496108_0005808 3300048911 Bacteria 10003
444 Ga0496108_0026932 3300048911 Bacteria 4744
445 Ga0496108_0075204 3300048911 Bacteria 2853
446 Ga0496108_0213234 3300048911 Bacteria 1676
447 Ga0496108_0292630 3300048911 Bacteria 1418
448 Ga0496109_0015228 3300048912 Bacteria 6695
449 Ga0496109_0052239 3300048912 Bacteria 3724
450 Ga0496109_0053866 3300048912 Bacteria 3670
451 Ga0496109_0223390 3300048912 Bacteria 1771
452 Ga0496109_0406832 3300048912 Bacteria 1286
453 Ga0496110_0000044 3300048913 Bacteria 61218
454 Ga0496110_0019503 3300048913 Bacteria 5708
455 Ga0496110_0026526 3300048913 Bacteria 4959
456 Ga0496110_0029727 3300048913 Bacteria 4706
457 Ga0496110_0045394 3300048913 Bacteria 3841
458 Ga0496110_0074130 3300048913 Bacteria 3022
459 Ga0496111_0000304 3300048914 Bacteria 24108
460 Ga0496111_0042508 3300048914 Bacteria 3263
461 Ga0496111_0081176 3300048914 Bacteria 2367
462 Ga0496111_0149551 3300048914 Bacteria 1732
463 Ga0496112_0113577 3300048915 Bacteria 2679
464 Ga0496113_0034637 3300048916 Bacteria 3685
465 Ga0496113_0038427 3300048916 Bacteria 3519
466 Ga0496113_0095713 3300048916 Bacteria 2295
467 Ga0496113_0121837 3300048916 Bacteria 2039
468 Ga0496114_0161347 3300048917 Bacteria 1950
469 Ga0496114_0177593 3300048917 Bacteria 1858
470 Ga0496115_0000059 3300048918 Bacteria 102022
471 Ga0496115_0000087 3300048918 Bacteria 86513
472 Ga0496115_0151824 3300048918 Bacteria 1913
473 Ga0496115_0165275 3300048918 Bacteria 1830
474 Ga0496122_0157026 3300048925 Bacteria 1394
475 Ga0496124_0018661 3300048927 Bacteria 6488
476 Ga0496124_0034827 3300048927 Bacteria 4412
477 Ga0501031_0013765 3300049568 Bacteria 5273
478 Ga0501032_0002157 3300049569 Bacteria 15505
479 Ga0501032_0028281 3300049569 Bacteria 3852
480 Ga0501033_0017480 3300049570 Bacteria 5418
481 Ga0501033_0029993 3300049570 Bacteria 4087
482 Ga0501033_0035959 3300049570 Bacteria 3713
483 Ga0501033_0050003 3300049570 Bacteria 3102
484 Ga0501034_0009005 3300049571 Bacteria 10484
485 Ga0501034_0037215 3300049571 Bacteria 4927
486 Ga0501036_0017828 3300049572 Bacteria 5942
487 Ga0501036_0030117 3300049572 Bacteria 4585
488 Ga0501036_0126835 3300049572 Bacteria 2155
489 Ga0501037_0004888 3300049573 Bacteria 9746
490 Ga0501037_0034377 3300049573 Bacteria 3740
491 Ga0501037_0116875 3300049573 Bacteria 1919
492 Ga0501037_0141391 3300049573 Bacteria 1722
493 Ga0501038_0022596 3300049574 Bacteria 5633
494 Ga0501038_0033572 3300049574 Bacteria 4519
495 Ga0501038_0036163 3300049574 Bacteria 4334
496 Ga0501038_0178666 3300049574 Bacteria 1714
497 Ga0501039_0092640 3300049575 Bacteria 2355
498 Ga0501040_0006671 3300049576 Bacteria 7492
499 Ga0501041_0009101 3300049577 Bacteria 5843
500 Ga0501042_0012321 3300049578 Bacteria 5789
501 Ga0501042_0037421 3300049578 Bacteria 3443
502 Ga0501042_0106903 3300049578 Bacteria 2014
503 Ga0501043_0000952 3300049579 Bacteria 25679
504 Ga0501046_0008376 3300049580 Bacteria 9013
505 Ga0501047_0000261 3300049581 Bacteria 61793
506 Ga0501047_0000547 3300049581 Bacteria 40575
507 Ga0501047_0029622 3300049581 Bacteria 5278
508 Ga0501047_0036940 3300049581 Bacteria 4721
509 Ga0501047_0058535 3300049581 Bacteria 3722
510 Ga0501048_0137723 3300049582 Bacteria 1725
511 Ga0501067_0001659 3300049583 Bacteria 12224
512 Ga0501068_0001603 3300049584 Bacteria 12047
513 Ga0501068_0164821 3300049584 Bacteria 1397
514 Ga0501070_0054657 3300049586 Bacteria 3311
515 Ga0501070_0153481 3300049586 Bacteria 1899
516 Ga0501071_0009745 3300049587 Bacteria 6409
517 Ga0501071_0110115 3300049587 Bacteria 2035
518 Ga0501072_0028700 3300049588 Bacteria 4343
519 Ga0501073_0038136 3300049589 Bacteria 3410
520 Ga0501076_0137846 3300049592 Bacteria 1981
521 Ga0501079_0012317 3300049741 Bacteria 6524
522 Ga0501080_0117664 3300049742 Bacteria 2463
523 Ga0501080_0201499 3300049742 Bacteria 1827
524 Ga0501083_0005717 3300049744 Bacteria 8800
525 Ga0501035_0003878 3300049822 Bacteria 14268
526 Ga0501035_0013704 3300049822 Bacteria 7480
527 Ga0501044_0017091 3300049823 Bacteria 7784
528 Ga0501044_0033101 3300049823 Bacteria 5432
529 Ga0501044_0066204 3300049823 Bacteria 3684
530 Ga0501044_0263956 3300049823 Bacteria 1659
531 nmdc:mga05p37_8283_c1 3300050507 Bacteria 12292
532 nmdc:mga05p37_9413_c1 3300050507 Bacteria 3114
533 nmdc:mga09592_116029_c1 3300050508 Bacteria 2298
534 nmdc:mga09592_286195_c1 3300050508 Bacteria 1429
535 nmdc:mga09592_62259_c1 3300050508 Bacteria 3156
536 nmdc:mga06r32_12954_c1 3300050510 Bacteria 7540
537 nmdc:mga08y16_11879_c1 3300050511 Bacteria 9147
538 nmdc:mga08y16_16853_c1 3300050511 Bacteria 7691
539 nmdc:mga0n895_501_c1 3300050512 Bacteria 26516
540 nmdc:mga0rr50_78481_c1 3300050513 Bacteria 2541
541 nmdc:mga08x19_22229_c1 3300050514 Bacteria 3926
542 Ga0495601_0014337 3300053077 Bacteria 4774
543 Ga0495601_0016278 3300053077 Bacteria 4505
544 Ga0495601_0111260 3300053077 Bacteria 1774
545 Ga0495612_0000103 3300053078 Bacteria 36230
546 Ga0495655_0009659 3300053083 Bacteria 1878
547 Ga0500646_0000042 3300053090 Bacteria 35008
548 Ga0500569_003941 3300053109 Bacteria 3081
549 Ga0500621_071573 3300053126 Bacteria 1397
550 Ga0500652_014799 3300053131 Bacteria 2799
551 Ga0500561_0002038 3300053137 Bacteria 3359
552 Ga0500616_0026798 3300053153 Bacteria 3186
553 Ga0500633_0001764 3300053160 Bacteria 4226
554 Ga0501084_0303566 3300054114 Bacteria 1348

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046528 Ga0495642_0090659 Ga0495642_0090659_43_855 257
2 3300050510 nmdc:mga06r32_12954_c1 nmdc:mga06r32_12954_c1_6691_7503 257
3 3300049588 Ga0501072_0028700 Ga0501072_0028700_3518_4333 270
4 3300014497 Ga0182008_10234623 Ga0182008_102346231 289
5 3300046474 Ga0495605_0075585 Ga0495605_0075585_151_1074 292
6 3300009551 Ga0105238_10207821 Ga0105238_102078212 294
7 3300025924 Ga0207694_10049972 Ga0207694_100499722 294
8 3300048916 Ga0496113_0034637 Ga0496113_0034637_2302_3249 294
9 3300003354 JGI25160J50197_1027544 JGI25160J50197_10275442 295
10 3300025302 Ga0207426_1002250 Ga0207426_10022505 295
11 3300028786 Ga0307517_10010040 Ga0307517_100100405 295
12 3300031507 Ga0307509_10148950 Ga0307509_101489501 295
13 3300042876 Ga0451577_0328234 Ga0451577_0328234_428_1354 295
14 3300046519 Ga0495632_0030314 Ga0495632_0030314_1133_2101 295
15 3300046522 Ga0495643_0003006 Ga0495643_0003006_7905_8873 295
16 3300046691 Ga0495670_0006343 Ga0495670_0006343_1630_2598 295
17 3300047315 Ga0495581_0130179 Ga0495581_0130179_309_1277 295
18 3300047470 Ga0495681_0006206 Ga0495681_0006206_6214_7182 295
19 3300053083 Ga0495655_0009659 Ga0495655_0009659_857_1825 295
20 3300053109 Ga0500569_003941 Ga0500569_003941_1199_2167 295
21 3300053126 Ga0500621_071573 Ga0500621_071573_65_1033 295
22 3300053131 Ga0500652_014799 Ga0500652_014799_1267_2235 295
23 3300053137 Ga0500561_0002038 Ga0500561_0002038_1553_2521 295
24 3300053153 Ga0500616_0026798 Ga0500616_0026798_41_1009 295
25 3300053160 Ga0500633_0001764 Ga0500633_0001764_560_1528 295
26 3300013307 Ga0157372_10000022 Ga0157372_10000022183 296
27 3300006175 Ga0070712_100051663 Ga0070712_1000516632 298
28 3300025915 Ga0207693_10063941 Ga0207693_100639412 298
29 3300046472 Ga0495580_0080079 Ga0495580_0080079_1181_2134 298
30 3300047321 Ga0495676_0044071 Ga0495676_0044071_2200_3153 298
31 3300050508 nmdc:mga09592_116029_c1 nmdc:mga09592_116029_c1_686_1657 300
32 3300047471 Ga0495684_0002822 Ga0495684_0002822_11435_12355 301
33 3300046680 Ga0495646_0168533 Ga0495646_0168533_99_1088 303
34 3300006844 Ga0075428_100084841 Ga0075428_1000848412 304
35 3300006846 Ga0075430_100185583 Ga0075430_1001855831 304
36 3300006847 Ga0075431_100046941 Ga0075431_1000469412 304
37 3300006880 Ga0075429_100020347 Ga0075429_1000203475 304
38 3300009094 Ga0111539_10290268 Ga0111539_102902682 304
39 3300009098 Ga0105245_10511661 Ga0105245_105116611 304
40 3300009147 Ga0114129_10016322 Ga0114129_100163228 304
41 3300009148 Ga0105243_10009731 Ga0105243_100097315 304
42 3300009177 Ga0105248_10420450 Ga0105248_104204502 304
43 3300009553 Ga0105249_10071695 Ga0105249_100716952 304
44 3300013296 Ga0157374_10204772 Ga0157374_102047721 304
45 3300013297 Ga0157378_10076496 Ga0157378_100764962 304
46 3300014745 Ga0157377_10076425 Ga0157377_100764252 304
47 3300014968 Ga0157379_10214132 Ga0157379_102141322 304
48 3300014969 Ga0157376_10097525 Ga0157376_100975251 304
49 3300046681 Ga0495647_0085092 Ga0495647_0085092_255_1208 304
50 3300046684 Ga0495669_0062539 Ga0495669_0062539_648_1601 304
51 3300048911 Ga0496108_0292630 Ga0496108_0292630_55_1008 304
52 3300048912 Ga0496109_0406832 Ga0496109_0406832_294_1247 304
53 3300050507 nmdc:mga05p37_8283_c1 nmdc:mga05p37_8283_c1_2310_3263 304
54 3300050511 nmdc:mga08y16_16853_c1 nmdc:mga08y16_16853_c1_1320_2273 304
55 3300046517 Ga0495630_0001117 Ga0495630_0001117_2133_3122 306
56 3300046675 Ga0495657_0000041 Ga0495657_0000041_111972_112961 306
57 3300006028 Ga0070717_10415975 Ga0070717_104159751 307
58 3300035725 Ga0373947_0056069 Ga0373947_0056069_179_1183 307
59 iso_pu_bacteria 2862574272 2862583986 307
60 3300005328 Ga0070676_10078983 Ga0070676_100789832 308
61 3300005328 Ga0070676_10099842 Ga0070676_100998422 308
62 3300005329 Ga0070683_100021152 Ga0070683_1000211524 308
63 3300005330 Ga0070690_100057431 Ga0070690_1000574313 308
64 3300005331 Ga0070670_100003423 Ga0070670_10000342311 308
65 3300005331 Ga0070670_100151587 Ga0070670_1001515872 308
66 3300005333 Ga0070677_10006162 Ga0070677_100061622 308
67 3300005334 Ga0068869_100298279 Ga0068869_1002982791 308
68 3300005335 Ga0070666_10075883 Ga0070666_100758834 308
69 3300005336 Ga0070680_100168411 Ga0070680_1001684112 308
70 3300005338 Ga0068868_100000506 Ga0068868_1000005064 308
71 3300005343 Ga0070687_100015465 Ga0070687_1000154652 308
72 3300005344 Ga0070661_100013545 Ga0070661_1000135454 308
73 3300005354 Ga0070675_100002379 Ga0070675_1000023795 308
74 3300005355 Ga0070671_100110448 Ga0070671_1001104482 308
75 3300005356 Ga0070674_100034607 Ga0070674_1000346071 308
76 3300005356 Ga0070674_100046514 Ga0070674_1000465142 308
77 3300005364 Ga0070673_100000290 Ga0070673_1000002904 308
78 3300005367 Ga0070667_100300496 Ga0070667_1003004962 308
79 3300005367 Ga0070667_100334616 Ga0070667_1003346162 308
80 3300005441 Ga0070700_100128890 Ga0070700_1001288902 308
81 3300005455 Ga0070663_100199127 Ga0070663_1001991271 308
82 3300005456 Ga0070678_100006404 Ga0070678_1000064045 308
83 3300005457 Ga0070662_100045540 Ga0070662_1000455404 308
84 3300005457 Ga0070662_100091596 Ga0070662_1000915962 308
85 3300005458 Ga0070681_10017899 Ga0070681_100178993 308
86 3300005459 Ga0068867_100009938 Ga0068867_1000099382 308
87 3300005459 Ga0068867_100056416 Ga0068867_1000564163 308
88 3300005471 Ga0070698_100402490 Ga0070698_1004024901 308
89 3300005518 Ga0070699_100305811 Ga0070699_1003058112 308
90 3300005530 Ga0070679_100045732 Ga0070679_1000457322 308
91 3300005539 Ga0068853_100103336 Ga0068853_1001033362 308
92 3300005543 Ga0070672_100003493 Ga0070672_1000034935 308
93 3300005544 Ga0070686_100149891 Ga0070686_1001498911 308
94 3300005547 Ga0070693_100170341 Ga0070693_1001703411 308
95 3300005548 Ga0070665_100062791 Ga0070665_1000627914 308
96 3300005548 Ga0070665_100526605 Ga0070665_1005266051 308
97 3300005564 Ga0070664_100005082 Ga0070664_1000050823 308
98 3300005578 Ga0068854_100001523 Ga0068854_1000015237 308
99 3300005615 Ga0070702_100003637 Ga0070702_1000036372 308
100 3300005615 Ga0070702_100017476 Ga0070702_1000174762 308
101 3300005616 Ga0068852_100001955 Ga0068852_1000019552 308
102 3300005618 Ga0068864_100051888 Ga0068864_1000518883 308
103 3300005718 Ga0068866_10216622 Ga0068866_102166221 308
104 3300005719 Ga0068861_100181051 Ga0068861_1001810512 308
105 3300005834 Ga0068851_10006943 Ga0068851_100069435 308
106 3300005840 Ga0068870_10204620 Ga0068870_102046202 308
107 3300005841 Ga0068863_100024215 Ga0068863_1000242154 308
108 3300005842 Ga0068858_100328979 Ga0068858_1003289792 308
109 3300006028 Ga0070717_10447360 Ga0070717_104473601 308
110 3300006237 Ga0097621_100005925 Ga0097621_1000059253 308
111 3300006358 Ga0068871_100006079 Ga0068871_1000060795 308
112 3300006358 Ga0068871_100470214 Ga0068871_1004702141 308
113 3300006844 Ga0075428_100010486 Ga0075428_1000104869 308
114 3300006880 Ga0075429_100062582 Ga0075429_1000625822 308
115 3300006881 Ga0068865_100040225 Ga0068865_1000402253 308
116 3300009177 Ga0105248_10016037 Ga0105248_100160377 308
117 3300013296 Ga0157374_10000911 Ga0157374_1000091127 308
118 3300013306 Ga0163162_10006814 Ga0163162_1000681413 308
119 3300013308 Ga0157375_10001769 Ga0157375_100017694 308
120 3300014969 Ga0157376_10005443 Ga0157376_100054432 308
121 3300017792 Ga0163161_10024730 Ga0163161_100247303 308
122 3300025321 Ga0207656_10006689 Ga0207656_100066892 308
123 3300025893 Ga0207682_10003415 Ga0207682_100034152 308
124 3300025893 Ga0207682_10021726 Ga0207682_100217262 308
125 3300025899 Ga0207642_10071238 Ga0207642_100712382 308
126 3300025901 Ga0207688_10099623 Ga0207688_100996232 308
127 3300025903 Ga0207680_10170816 Ga0207680_101708161 308
128 3300025907 Ga0207645_10006949 Ga0207645_100069494 308
129 3300025908 Ga0207643_10038359 Ga0207643_100383592 308
130 3300025910 Ga0207684_10031595 Ga0207684_100315954 308
131 3300025917 Ga0207660_10279483 Ga0207660_102794832 308
132 3300025920 Ga0207649_10004951 Ga0207649_100049518 308
133 3300025925 Ga0207650_10017951 Ga0207650_100179514 308
134 3300025925 Ga0207650_10066187 Ga0207650_100661873 308
135 3300025926 Ga0207659_10000428 Ga0207659_1000042829 308
136 3300025926 Ga0207659_10035778 Ga0207659_100357783 308
137 3300025931 Ga0207644_10000583 Ga0207644_100005836 308
138 3300025933 Ga0207706_10036583 Ga0207706_100365834 308
139 3300025933 Ga0207706_10063915 Ga0207706_100639154 308
140 3300025937 Ga0207669_10115848 Ga0207669_101158482 308
141 3300025938 Ga0207704_10246539 Ga0207704_102465391 308
142 3300025940 Ga0207691_10000948 Ga0207691_100009489 308
143 3300025940 Ga0207691_10102816 Ga0207691_101028162 308
144 3300025941 Ga0207711_10120421 Ga0207711_101204212 308
145 3300025941 Ga0207711_10179348 Ga0207711_101793482 308
146 3300025942 Ga0207689_10004523 Ga0207689_100045233 308
147 3300025944 Ga0207661_10003071 Ga0207661_100030719 308
148 3300025945 Ga0207679_10004505 Ga0207679_1000450510 308
149 3300025945 Ga0207679_10412110 Ga0207679_104121101 308
150 3300025960 Ga0207651_10014981 Ga0207651_100149814 308
151 3300025960 Ga0207651_10017968 Ga0207651_100179682 308
152 3300025981 Ga0207640_10034098 Ga0207640_100340984 308
153 3300026023 Ga0207677_10000856 Ga0207677_1000085618 308
154 3300026067 Ga0207678_10110680 Ga0207678_101106803 308
155 3300026075 Ga0207708_10011989 Ga0207708_100119893 308
156 3300026088 Ga0207641_10017988 Ga0207641_100179884 308
157 3300026089 Ga0207648_10008599 Ga0207648_100085994 308
158 3300026089 Ga0207648_10009609 Ga0207648_100096097 308
159 3300026095 Ga0207676_10009032 Ga0207676_100090322 308
160 3300026116 Ga0207674_10540757 Ga0207674_105407571 308
161 3300026121 Ga0207683_10000313 Ga0207683_100003136 308
162 3300026142 Ga0207698_10015047 Ga0207698_100150472 308
163 3300027360 Ga0209969_1001278 Ga0209969_10012782 308
164 3300027462 Ga0210000_1005439 Ga0210000_10054392 308
165 3300027543 Ga0209999_1000296 Ga0209999_10002962 308
166 3300027682 Ga0209971_1009581 Ga0209971_10095812 308
167 3300027876 Ga0209974_10002906 Ga0209974_100029064 308
168 3300027876 Ga0209974_10072904 Ga0209974_100729041 308
169 3300028379 Ga0268266_10058570 Ga0268266_100585704 308
170 3300028577 Ga0265318_10004816 Ga0265318_100048163 308
171 3300031235 Ga0265330_10002094 Ga0265330_100020947 308
172 3300031238 Ga0265332_10000673 Ga0265332_1000067310 308
173 3300031240 Ga0265320_10003250 Ga0265320_100032505 308
174 3300031242 Ga0265329_10006060 Ga0265329_100060604 308
175 3300031249 Ga0265339_10063293 Ga0265339_100632933 308
176 3300031250 Ga0265331_10002978 Ga0265331_100029788 308
177 3300031251 Ga0265327_10051674 Ga0265327_100516742 308
178 3300031344 Ga0265316_10008265 Ga0265316_100082653 308
179 3300031711 Ga0265314_10003101 Ga0265314_100031011 308
180 3300031712 Ga0265342_10002141 Ga0265342_1000214119 308
181 3300048903 Ga0496100_0015459 Ga0496100_0015459_1877_2854 308
182 3300048909 Ga0496106_0281674 Ga0496106_0281674_235_1212 308
183 3300048911 Ga0496108_0005808 Ga0496108_0005808_6202_7179 308
184 3300048913 Ga0496110_0026526 Ga0496110_0026526_723_1700 308
185 3300048917 Ga0496114_0177593 Ga0496114_0177593_228_1205 308
186 3300009093 Ga0105240_10012503 Ga0105240_100125037 309
187 3300013307 Ga0157372_10568161 Ga0157372_105681612 309
188 3300031090 Ga0265760_10001145 Ga0265760_100011455 309
189 3300005436 Ga0070713_100029854 Ga0070713_1000298543 310
190 3300005530 Ga0070679_100022860 Ga0070679_1000228609 310
191 3300025916 Ga0207663_10125655 Ga0207663_101256552 310
192 3300025928 Ga0207700_10053448 Ga0207700_100534482 310
193 3300025929 Ga0207664_10406746 Ga0207664_104067462 310
194 3300044693 Ga0466961_0032781 Ga0466961_0032781_968_1921 310
195 3300045836 Ga0466958_0065926 Ga0466958_0065926_119_1072 310
196 3300048907 Ga0496104_0017947 Ga0496104_0017947_165_1118 310
197 3300048908 Ga0496105_0007657 Ga0496105_0007657_7078_8031 310
198 3300048911 Ga0496108_0213234 Ga0496108_0213234_340_1293 310
199 3300048912 Ga0496109_0223390 Ga0496109_0223390_643_1596 310
200 3300048913 Ga0496110_0045394 Ga0496110_0045394_869_1822 310
201 3300048914 Ga0496111_0081176 Ga0496111_0081176_75_1028 310
202 3300048916 Ga0496113_0095713 Ga0496113_0095713_251_1204 310
203 3300048918 Ga0496115_0151824 Ga0496115_0151824_207_1160 310
204 3300048927 Ga0496124_0018661 Ga0496124_0018661_15_1016 310
205 iso_pu_bacteria 2997451912 2997457330 310
206 3300014325 Ga0163163_10023671 Ga0163163_100236712 311
207 3300053078 Ga0495612_0000103 Ga0495612_0000103_31360_32352 311
208 3300005983 Ga0081540_1000863 Ga0081540_100086324 312
209 3300044656 Ga0466969_0023038 Ga0466969_0023038_1351_2304 312
210 3300044684 Ga0466966_0039600 Ga0466966_0039600_948_1901 312
211 3300044693 Ga0466961_0000190 Ga0466961_0000190_15105_16058 312
212 3300045049 Ga0466959_0043746 Ga0466959_0043746_380_1333 312
213 3300045836 Ga0466958_0008873 Ga0466958_0008873_4177_5130 312
214 iso_pu_bacteria 2751185734 2753076049 312
215 iso_pu_bacteria 2795385472 2795794280 312
216 iso_pu_bacteria 2833709550 2833711309 312
217 iso_pu_bacteria 2837183177 2837185764 312
218 iso_pu_bacteria 2870721527 2870730211 312
219 iso_pu_bacteria 2995463766 2995470999 312
220 iso_pu_bacteria 3006321560 3006327679 312
221 3300005985 Ga0081539_10005001 Ga0081539_100050017 313
222 3300037466 Ga0395898_0219930 Ga0395898_0219930_40_1008 313
223 iso_pu_bacteria 2585427649 2586058134 313
224 iso_pu_bacteria 2808606522 2809593019 313
225 iso_pu_bacteria 2915768154 2915768288 313
226 iso_pu_bacteria 2917736166 2917739793 313
227 iso_pu_bacteria 8047710418 8047718273 313
228 3300005334 Ga0068869_100053236 Ga0068869_1000532363 315
229 3300005337 Ga0070682_100008989 Ga0070682_1000089896 315
230 3300005338 Ga0068868_100086667 Ga0068868_1000866672 315
231 3300005339 Ga0070660_100245163 Ga0070660_1002451631 315
232 3300005344 Ga0070661_100162632 Ga0070661_1001626322 315
233 3300005354 Ga0070675_100183178 Ga0070675_1001831782 315
234 3300005437 Ga0070710_10117396 Ga0070710_101173962 315
235 3300005437 Ga0070710_10193769 Ga0070710_101937692 315
236 3300005439 Ga0070711_100000326 Ga0070711_1000003263 315
237 3300005439 Ga0070711_100420716 Ga0070711_1004207161 315
238 3300005441 Ga0070700_100007928 Ga0070700_1000079282 315
239 3300005456 Ga0070678_100041381 Ga0070678_1000413813 315
240 3300005457 Ga0070662_100306071 Ga0070662_1003060712 315
241 3300005468 Ga0070707_100061114 Ga0070707_1000611144 315
242 3300005535 Ga0070684_100248828 Ga0070684_1002488282 315
243 3300005539 Ga0068853_100162990 Ga0068853_1001629901 315
244 3300005564 Ga0070664_100090735 Ga0070664_1000907352 315
245 3300005614 Ga0068856_100158159 Ga0068856_1001581592 315
246 3300005615 Ga0070702_100282862 Ga0070702_1002828621 315
247 3300005616 Ga0068852_100077349 Ga0068852_1000773493 315
248 3300005618 Ga0068864_100110090 Ga0068864_1001100902 315
249 3300005719 Ga0068861_100179309 Ga0068861_1001793092 315
250 3300005841 Ga0068863_100437582 Ga0068863_1004375821 315
251 3300006175 Ga0070712_100234177 Ga0070712_1002341772 315
252 3300006881 Ga0068865_100050351 Ga0068865_1000503512 315
253 3300009093 Ga0105240_10007499 Ga0105240_1000749917 315
254 3300009093 Ga0105240_10057686 Ga0105240_100576862 315
255 3300009098 Ga0105245_10009265 Ga0105245_1000926510 315
256 3300009098 Ga0105245_10357817 Ga0105245_103578172 315
257 3300009148 Ga0105243_10124834 Ga0105243_101248342 315
258 3300009177 Ga0105248_10095342 Ga0105248_100953424 315
259 3300009545 Ga0105237_10000431 Ga0105237_1000043127 315
260 3300010375 Ga0105239_10021851 Ga0105239_100218515 315
261 3300013296 Ga0157374_10427324 Ga0157374_104273241 315
262 3300014325 Ga0163163_10319002 Ga0163163_103190022 315
263 3300025901 Ga0207688_10001198 Ga0207688_100011989 315
264 3300025913 Ga0207695_10006100 Ga0207695_100061001 315
265 3300025913 Ga0207695_10073737 Ga0207695_100737374 315
266 3300025914 Ga0207671_10001590 Ga0207671_1000159012 315
267 3300025915 Ga0207693_10039655 Ga0207693_100396552 315
268 3300025915 Ga0207693_10193426 Ga0207693_101934262 315
269 3300025916 Ga0207663_10000379 Ga0207663_100003793 315
270 3300025922 Ga0207646_10389653 Ga0207646_103896532 315
271 3300025927 Ga0207687_10068102 Ga0207687_100681021 315
272 3300025933 Ga0207706_10030590 Ga0207706_100305902 315
273 3300025945 Ga0207679_10049257 Ga0207679_100492573 315
274 3300026075 Ga0207708_10016633 Ga0207708_100166332 315
275 3300026078 Ga0207702_10081251 Ga0207702_100812513 315
276 3300026095 Ga0207676_10076926 Ga0207676_100769262 315
277 3300026121 Ga0207683_10010950 Ga0207683_100109503 315
278 3300028563 Ga0265319_1054827 Ga0265319_10548271 315
279 3300032002 Ga0307416_100556510 Ga0307416_1005565101 315
280 3300044735 Ga0466968_0151450 Ga0466968_0151450_53_1006 315
281 3300045836 Ga0466958_0061336 Ga0466958_0061336_718_1671 315
282 3300046463 Ga0495653_0014011 Ga0495653_0014011_2224_3201 315
283 3300046477 Ga0495664_0000073 Ga0495664_0000073_36802_37797 315
284 3300046514 Ga0495618_0000046 Ga0495618_0000046_8299_9285 315
285 3300046529 Ga0495652_0014520 Ga0495652_0014520_5918_6895 315
286 3300046543 Ga0495645_0000022 Ga0495645_0000022_62025_63011 315
287 3300047317 Ga0495604_0003567 Ga0495604_0003567_9501_10505 315
288 3300048905 Ga0496102_0000040 Ga0496102_0000040_13581_14558 315
289 3300048905 Ga0496102_0072593 Ga0496102_0072593_1602_2555 315
290 3300048906 Ga0496103_0000294 Ga0496103_0000294_13597_14574 315
291 3300048907 Ga0496104_0000006 Ga0496104_0000006_390395_391408 315
292 3300048907 Ga0496104_0080101 Ga0496104_0080101_92_1045 315
293 3300048908 Ga0496105_0109076 Ga0496105_0109076_1014_1967 315
294 3300048911 Ga0496108_0075204 Ga0496108_0075204_779_1732 315
295 3300048912 Ga0496109_0015228 Ga0496109_0015228_156_1103 315
296 3300048912 Ga0496109_0052239 Ga0496109_0052239_1346_2299 315
297 3300048913 Ga0496110_0000044 Ga0496110_0000044_28572_29585 315
298 3300048913 Ga0496110_0029727 Ga0496110_0029727_2053_3006 315
299 3300048914 Ga0496111_0000304 Ga0496111_0000304_18004_19017 315
300 3300048915 Ga0496112_0113577 Ga0496112_0113577_1386_2339 315
301 3300048916 Ga0496113_0121837 Ga0496113_0121837_252_1205 315
302 3300048918 Ga0496115_0000059 Ga0496115_0000059_23395_24348 315
303 3300048918 Ga0496115_0000087 Ga0496115_0000087_81779_82732 315
304 3300048925 Ga0496122_0157026 Ga0496122_0157026_133_1086 315
305 3300048927 Ga0496124_0034827 Ga0496124_0034827_1969_2922 315
306 3300049570 Ga0501033_0017480 Ga0501033_0017480_1043_1996 315
307 3300049573 Ga0501037_0116875 Ga0501037_0116875_368_1321 315
308 3300049578 Ga0501042_0012321 Ga0501042_0012321_271_1224 315
309 3300049582 Ga0501048_0137723 Ga0501048_0137723_362_1315 315
310 3300049584 Ga0501068_0164821 Ga0501068_0164821_240_1193 315
311 3300049586 Ga0501070_0153481 Ga0501070_0153481_616_1569 315
312 3300049587 Ga0501071_0110115 Ga0501071_0110115_256_1209 315
313 3300049742 Ga0501080_0201499 Ga0501080_0201499_313_1266 315
314 3300049823 Ga0501044_0263956 Ga0501044_0263956_394_1347 315
315 3300053077 Ga0495601_0014337 Ga0495601_0014337_2881_3939 315
316 3300053077 Ga0495601_0016278 Ga0495601_0016278_1306_2283 315
317 3300054114 Ga0501084_0303566 Ga0501084_0303566_158_1111 315
318 3300005338 Ga0068868_100128776 Ga0068868_1001287762 316
319 3300005578 Ga0068854_100018014 Ga0068854_1000180146 316
320 3300005615 Ga0070702_100011469 Ga0070702_1000114696 316
321 3300005616 Ga0068852_100227546 Ga0068852_1002275463 316
322 3300005617 Ga0068859_100510001 Ga0068859_1005100012 316
323 3300005718 Ga0068866_10018149 Ga0068866_100181492 316
324 3300005842 Ga0068858_100068154 Ga0068858_1000681543 316
325 3300005981 Ga0081538_10003652 Ga0081538_1000365210 316
326 3300005981 Ga0081538_10011533 Ga0081538_100115338 316
327 3300005985 Ga0081539_10096977 Ga0081539_100969772 316
328 3300006880 Ga0075429_100111907 Ga0075429_1001119073 316
329 3300006931 Ga0097620_100509959 Ga0097620_1005099592 316
330 3300009098 Ga0105245_10278219 Ga0105245_102782192 316
331 3300009147 Ga0114129_10056024 Ga0114129_100560242 316
332 3300009148 Ga0105243_10026406 Ga0105243_100264066 316
333 3300014745 Ga0157377_10032234 Ga0157377_100322343 316
334 3300025901 Ga0207688_10122542 Ga0207688_101225422 316
335 3300025927 Ga0207687_10123589 Ga0207687_101235892 316
336 3300026075 Ga0207708_10152849 Ga0207708_101528492 316
337 3300028786 Ga0307517_10133063 Ga0307517_101330633 316
338 3300031548 Ga0307408_100069624 Ga0307408_1000696242 316
339 3300031730 Ga0307516_10353047 Ga0307516_103530471 316
340 3300031731 Ga0307405_10023706 Ga0307405_100237063 316
341 3300031731 Ga0307405_10026517 Ga0307405_100265172 316
342 3300031824 Ga0307413_10039450 Ga0307413_100394502 316
343 3300031852 Ga0307410_10010700 Ga0307410_100107003 316
344 3300031995 Ga0307409_100021443 Ga0307409_1000214435 316
345 3300031995 Ga0307409_100033985 Ga0307409_1000339853 316
346 3300032002 Ga0307416_100017969 Ga0307416_1000179692 316
347 3300032002 Ga0307416_100058124 Ga0307416_1000581242 316
348 3300032002 Ga0307416_100094899 Ga0307416_1000948992 316
349 3300032126 Ga0307415_100017115 Ga0307415_1000171152 316
350 3300037312 Ga0395899_0234581 Ga0395899_0234581_255_1208 316
351 3300037466 Ga0395898_0117044 Ga0395898_0117044_1352_2305 316
352 3300037471 Ga0395905_0024577 Ga0395905_0024577_3443_4396 316
353 3300044684 Ga0466966_0003085 Ga0466966_0003085_1796_2749 316
354 3300044684 Ga0466966_0060323 Ga0466966_0060323_587_1540 316
355 3300044693 Ga0466961_0026551 Ga0466961_0026551_276_1229 316
356 3300044693 Ga0466961_0037519 Ga0466961_0037519_2025_2978 316
357 3300044706 Ga0466964_0069070 Ga0466964_0069070_322_1290 316
358 3300045049 Ga0466959_0036084 Ga0466959_0036084_1867_2820 316
359 3300045976 Ga0466967_0410777 Ga0466967_0410777_76_1032 316
360 3300046454 Ga0495592_0018018 Ga0495592_0018018_3647_4600 316
361 3300046459 Ga0495629_0019151 Ga0495629_0019151_2084_3037 316
362 3300046459 Ga0495629_0028004 Ga0495629_0028004_2105_3058 316
363 3300046462 Ga0495651_0048938 Ga0495651_0048938_1100_2053 316
364 3300046463 Ga0495653_0001671 Ga0495653_0001671_14515_15468 316
365 3300046472 Ga0495580_0085059 Ga0495580_0085059_49_1002 316
366 3300046476 Ga0495662_0008122 Ga0495662_0008122_72_1025 316
367 3300046477 Ga0495664_0030446 Ga0495664_0030446_236_1189 316
368 3300046477 Ga0495664_0080641 Ga0495664_0080641_71_1024 316
369 3300046511 Ga0495608_0014491 Ga0495608_0014491_93_1046 316
370 3300046511 Ga0495608_0101175 Ga0495608_0101175_563_1534 316
371 3300046516 Ga0495628_0040560 Ga0495628_0040560_909_1862 316
372 3300046516 Ga0495628_0268102 Ga0495628_0268102_174_1127 316
373 3300046526 Ga0495666_0059263 Ga0495666_0059263_77_1030 316
374 3300046526 Ga0495666_0061023 Ga0495666_0061023_73_1026 316
375 3300046529 Ga0495652_0035994 Ga0495652_0035994_2198_3151 316
376 3300046533 Ga0495640_0011689 Ga0495640_0011689_2444_3397 316
377 3300046543 Ga0495645_0003048 Ga0495645_0003048_2310_3263 316
378 3300046543 Ga0495645_0004535 Ga0495645_0004535_2283_3242 316
379 3300046559 Ga0495667_0050042 Ga0495667_0050042_79_1032 316
380 3300046663 Ga0495635_0008722 Ga0495635_0008722_6044_6997 316
381 3300046675 Ga0495657_0014917 Ga0495657_0014917_3884_4837 316
382 3300046675 Ga0495657_0045523 Ga0495657_0045523_45_998 316
383 3300046678 Ga0495599_0053763 Ga0495599_0053763_948_1901 316
384 3300046679 Ga0495623_0087283 Ga0495623_0087283_816_1775 316
385 3300046680 Ga0495646_0012198 Ga0495646_0012198_4018_4971 316
386 3300046689 Ga0495613_0002329 Ga0495613_0002329_1747_2700 316
387 3300046689 Ga0495613_0050954 Ga0495613_0050954_50_1003 316
388 3300046689 Ga0495613_0116494 Ga0495613_0116494_511_1464 316
389 3300047315 Ga0495581_0020780 Ga0495581_0020780_2827_3780 316
390 3300047317 Ga0495604_0000216 Ga0495604_0000216_46753_47706 316
391 3300047317 Ga0495604_0021804 Ga0495604_0021804_45_998 316
392 3300047317 Ga0495604_0299046 Ga0495604_0299046_86_1039 316
393 3300047319 Ga0495674_0002673 Ga0495674_0002673_11661_12614 316
394 3300047321 Ga0495676_0031407 Ga0495676_0031407_1405_2358 316
395 3300047444 Ga0495675_0034732 Ga0495675_0034732_2238_3191 316
396 3300048088 Ga0495602_0074274 Ga0495602_0074274_1076_2029 316
397 3300049568 Ga0501031_0013765 Ga0501031_0013765_1061_2014 316
398 3300049569 Ga0501032_0002157 Ga0501032_0002157_11293_12246 316
399 3300049569 Ga0501032_0028281 Ga0501032_0028281_638_1591 316
400 3300049570 Ga0501033_0029993 Ga0501033_0029993_2178_3131 316
401 3300049570 Ga0501033_0035959 Ga0501033_0035959_1651_2604 316
402 3300049570 Ga0501033_0050003 Ga0501033_0050003_1980_2933 316
403 3300049571 Ga0501034_0009005 Ga0501034_0009005_3260_4213 316
404 3300049571 Ga0501034_0037215 Ga0501034_0037215_672_1625 316
405 3300049572 Ga0501036_0017828 Ga0501036_0017828_3014_3967 316
406 3300049572 Ga0501036_0030117 Ga0501036_0030117_2079_3032 316
407 3300049572 Ga0501036_0126835 Ga0501036_0126835_223_1176 316
408 3300049573 Ga0501037_0004888 Ga0501037_0004888_6690_7643 316
409 3300049573 Ga0501037_0034377 Ga0501037_0034377_1471_2424 316
410 3300049573 Ga0501037_0141391 Ga0501037_0141391_485_1438 316
411 3300049574 Ga0501038_0022596 Ga0501038_0022596_2079_3032 316
412 3300049574 Ga0501038_0033572 Ga0501038_0033572_3344_4297 316
413 3300049574 Ga0501038_0036163 Ga0501038_0036163_1795_2748 316
414 3300049574 Ga0501038_0178666 Ga0501038_0178666_721_1674 316
415 3300049575 Ga0501039_0092640 Ga0501039_0092640_365_1318 316
416 3300049576 Ga0501040_0006671 Ga0501040_0006671_6004_6957 316
417 3300049577 Ga0501041_0009101 Ga0501041_0009101_3515_4468 316
418 3300049578 Ga0501042_0037421 Ga0501042_0037421_798_1751 316
419 3300049578 Ga0501042_0106903 Ga0501042_0106903_25_978 316
420 3300049579 Ga0501043_0000952 Ga0501043_0000952_14715_15668 316
421 3300049580 Ga0501046_0008376 Ga0501046_0008376_2076_3029 316
422 3300049581 Ga0501047_0000261 Ga0501047_0000261_39268_40221 316
423 3300049581 Ga0501047_0000547 Ga0501047_0000547_7618_8571 316
424 3300049581 Ga0501047_0029622 Ga0501047_0029622_3313_4317 316
425 3300049581 Ga0501047_0036940 Ga0501047_0036940_1475_2428 316
426 3300049581 Ga0501047_0058535 Ga0501047_0058535_2234_3187 316
427 3300049583 Ga0501067_0001659 Ga0501067_0001659_3515_4468 316
428 3300049584 Ga0501068_0001603 Ga0501068_0001603_7835_8788 316
429 3300049586 Ga0501070_0054657 Ga0501070_0054657_1375_2328 316
430 3300049587 Ga0501071_0009745 Ga0501071_0009745_1976_2929 316
431 3300049589 Ga0501073_0038136 Ga0501073_0038136_1456_2409 316
432 3300049592 Ga0501076_0137846 Ga0501076_0137846_216_1169 316
433 3300049741 Ga0501079_0012317 Ga0501079_0012317_3468_4421 316
434 3300049742 Ga0501080_0117664 Ga0501080_0117664_798_1751 316
435 3300049744 Ga0501083_0005717 Ga0501083_0005717_71_1024 316
436 3300049822 Ga0501035_0003878 Ga0501035_0003878_5702_6655 316
437 3300049822 Ga0501035_0013704 Ga0501035_0013704_596_1549 316
438 3300049823 Ga0501044_0017091 Ga0501044_0017091_3163_4116 316
439 3300049823 Ga0501044_0033101 Ga0501044_0033101_699_1652 316
440 3300049823 Ga0501044_0066204 Ga0501044_0066204_938_1891 316
441 3300050507 nmdc:mga05p37_9413_c1 nmdc:mga05p37_9413_c1_1652_2605 316
442 3300050508 nmdc:mga09592_62259_c1 nmdc:mga09592_62259_c1_133_1086 316
443 3300053077 Ga0495601_0111260 Ga0495601_0111260_765_1718 316
444 3300053090 Ga0500646_0000042 Ga0500646_0000042_28471_29424 316
445 3300002067 JGI24735J21928_10008106 JGI24735J21928_100081063 317
446 3300005327 Ga0070658_10149554 Ga0070658_101495542 317
447 3300005328 Ga0070676_10016946 Ga0070676_100169464 317
448 3300005331 Ga0070670_100003853 Ga0070670_1000038536 317
449 3300005334 Ga0068869_100002225 Ga0068869_1000022252 317
450 3300005335 Ga0070666_10078019 Ga0070666_100780193 317
451 3300005336 Ga0070680_100140990 Ga0070680_1001409902 317
452 3300005337 Ga0070682_100099709 Ga0070682_1000997091 317
453 3300005338 Ga0068868_100002416 Ga0068868_10000241610 317
454 3300005339 Ga0070660_100073883 Ga0070660_1000738831 317
455 3300005340 Ga0070689_100195733 Ga0070689_1001957331 317
456 3300005341 Ga0070691_10003548 Ga0070691_100035485 317
457 3300005345 Ga0070692_10025409 Ga0070692_100254093 317
458 3300005354 Ga0070675_100036729 Ga0070675_1000367294 317
459 3300005355 Ga0070671_100015608 Ga0070671_1000156081 317
460 3300005364 Ga0070673_100090496 Ga0070673_1000904962 317
461 3300005434 Ga0070709_10036390 Ga0070709_100363902 317
462 3300005436 Ga0070713_100070019 Ga0070713_1000700193 317
463 3300005437 Ga0070710_10000271 Ga0070710_1000027114 317
464 3300005437 Ga0070710_10029817 Ga0070710_100298172 317
465 3300005441 Ga0070700_100169288 Ga0070700_1001692882 317
466 3300005455 Ga0070663_100002860 Ga0070663_1000028602 317
467 3300005456 Ga0070678_100002873 Ga0070678_1000028732 317
468 3300005458 Ga0070681_10020771 Ga0070681_100207714 317
469 3300005466 Ga0070685_10033859 Ga0070685_100338591 317
470 3300005530 Ga0070679_100022494 Ga0070679_1000224942 317
471 3300005547 Ga0070693_100002484 Ga0070693_1000024849 317
472 3300005548 Ga0070665_100027256 Ga0070665_1000272563 317
473 3300005563 Ga0068855_100167154 Ga0068855_1001671543 317
474 3300005564 Ga0070664_100105592 Ga0070664_1001055922 317
475 3300005614 Ga0068856_100007435 Ga0068856_1000074356 317
476 3300005615 Ga0070702_100001869 Ga0070702_1000018692 317
477 3300005616 Ga0068852_100039516 Ga0068852_1000395164 317
478 3300005618 Ga0068864_100248548 Ga0068864_1002485482 317
479 3300005841 Ga0068863_100016289 Ga0068863_1000162892 317
480 3300005841 Ga0068863_100033462 Ga0068863_1000334624 317
481 3300005842 Ga0068858_100105978 Ga0068858_1001059782 317
482 3300006058 Ga0075432_10018453 Ga0075432_100184532 317
483 3300006358 Ga0068871_100011522 Ga0068871_1000115225 317
484 3300006847 Ga0075431_100063053 Ga0075431_1000630535 317
485 3300006852 Ga0075433_10150727 Ga0075433_101507272 317
486 3300006871 Ga0075434_100012093 Ga0075434_1000120939 317
487 3300006914 Ga0075436_100029586 Ga0075436_1000295862 317
488 3300007076 Ga0075435_100000815 Ga0075435_10000081519 317
489 3300009011 Ga0105251_10050701 Ga0105251_100507012 317
490 3300009093 Ga0105240_10129707 Ga0105240_101297072 317
491 3300009098 Ga0105245_10060811 Ga0105245_100608115 317
492 3300009147 Ga0114129_10166952 Ga0114129_101669521 317
493 3300009148 Ga0105243_10612658 Ga0105243_106126581 317
494 3300009174 Ga0105241_10003029 Ga0105241_100030299 317
495 3300009177 Ga0105248_10082167 Ga0105248_100821674 317
496 3300009545 Ga0105237_10153808 Ga0105237_101538082 317
497 3300009551 Ga0105238_10027344 Ga0105238_100273447 317
498 3300010375 Ga0105239_10228790 Ga0105239_102287901 317
499 3300011119 Ga0105246_10001085 Ga0105246_1000108515 317
500 3300013104 Ga0157370_10140191 Ga0157370_101401912 317
501 3300013105 Ga0157369_10438335 Ga0157369_104383352 317
502 3300013296 Ga0157374_10188364 Ga0157374_101883642 317
503 3300013308 Ga0157375_10036375 Ga0157375_100363751 317
504 3300014325 Ga0163163_10143792 Ga0163163_101437923 317
505 3300014745 Ga0157377_10060511 Ga0157377_100605112 317
506 3300020082 Ga0206353_10182179 Ga0206353_101821792 317
507 3300025735 Ga0207713_1052834 Ga0207713_10528341 317
508 3300025898 Ga0207692_10000110 Ga0207692_1000011017 317
509 3300025898 Ga0207692_10039479 Ga0207692_100394793 317
510 3300025900 Ga0207710_10040903 Ga0207710_100409032 317
511 3300025906 Ga0207699_10109962 Ga0207699_101099622 317
512 3300025908 Ga0207643_10000125 Ga0207643_1000012544 317
513 3300025909 Ga0207705_10028217 Ga0207705_100282174 317
514 3300025911 Ga0207654_10063063 Ga0207654_100630632 317
515 3300025914 Ga0207671_10131395 Ga0207671_101313952 317
516 3300025917 Ga0207660_10017794 Ga0207660_100177944 317
517 3300025919 Ga0207657_10035210 Ga0207657_100352104 317
518 3300025921 Ga0207652_10066100 Ga0207652_100661004 317
519 3300025924 Ga0207694_10203102 Ga0207694_102031021 317
520 3300025925 Ga0207650_10005762 Ga0207650_100057622 317
521 3300025927 Ga0207687_10048994 Ga0207687_100489943 317
522 3300025932 Ga0207690_10135985 Ga0207690_101359852 317
523 3300025941 Ga0207711_10194299 Ga0207711_101942992 317
524 3300025942 Ga0207689_10000198 Ga0207689_1000019835 317
525 3300025944 Ga0207661_10003247 Ga0207661_1000324712 317
526 3300025945 Ga0207679_10121514 Ga0207679_101215142 317
527 3300025949 Ga0207667_10067350 Ga0207667_100673504 317
528 3300025960 Ga0207651_10044129 Ga0207651_100441294 317
529 3300025981 Ga0207640_10151067 Ga0207640_101510672 317
530 3300026023 Ga0207677_10023483 Ga0207677_100234832 317
531 3300026067 Ga0207678_10000141 Ga0207678_1000014118 317
532 3300026075 Ga0207708_10209491 Ga0207708_102094912 317
533 3300026078 Ga0207702_10006992 Ga0207702_100069929 317
534 3300026078 Ga0207702_10012008 Ga0207702_100120088 317
535 3300026088 Ga0207641_10026463 Ga0207641_100264634 317
536 3300026089 Ga0207648_10193459 Ga0207648_101934591 317
537 3300026095 Ga0207676_10001346 Ga0207676_1000134616 317
538 3300026118 Ga0207675_100111926 Ga0207675_1001119263 317
539 3300026121 Ga0207683_10000172 Ga0207683_1000017238 317
540 3300026142 Ga0207698_10025915 Ga0207698_100259152 317
541 3300028381 Ga0268264_10023387 Ga0268264_100233875 317
542 3300030731 Ga0316177_1042586 Ga0316177_10425864 317
543 3300030736 Ga0316180_1004638 Ga0316180_10046382 317
544 3300031838 Ga0307518_10000036 Ga0307518_1000003678 317
545 3300042016 Ga0439463_045454 Ga0439463_045454_93_1049 317
546 3300042438 Ga0439459_0038488 Ga0439459_0038488_22_978 317
547 3300044683 Ga0466965_0034703 Ga0466965_0034703_1084_2055 317
548 3300044693 Ga0466961_0030290 Ga0466961_0030290_2470_3423 317
549 3300048903 Ga0496100_0038504 Ga0496100_0038504_1634_2590 317
550 3300048904 Ga0496101_0043891 Ga0496101_0043891_743_1699 317
551 3300048905 Ga0496102_0063027 Ga0496102_0063027_1153_2109 317
552 3300048907 Ga0496104_0065527 Ga0496104_0065527_857_1813 317
553 3300048908 Ga0496105_0004008 Ga0496105_0004008_9308_10264 317
554 3300048909 Ga0496106_0002994 Ga0496106_0002994_9180_10136 317
555 3300048911 Ga0496108_0026932 Ga0496108_0026932_1870_2826 317
556 3300048912 Ga0496109_0053866 Ga0496109_0053866_796_1752 317
557 3300048913 Ga0496110_0019503 Ga0496110_0019503_850_1806 317
558 3300048913 Ga0496110_0074130 Ga0496110_0074130_1356_2312 317
559 3300048914 Ga0496111_0042508 Ga0496111_0042508_1939_2895 317
560 3300048914 Ga0496111_0149551 Ga0496111_0149551_649_1605 317
561 3300048916 Ga0496113_0038427 Ga0496113_0038427_645_1601 317
562 3300048917 Ga0496114_0161347 Ga0496114_0161347_927_1883 317
563 3300048918 Ga0496115_0165275 Ga0496115_0165275_62_1018 317
564 3300050508 nmdc:mga09592_286195_c1 nmdc:mga09592_286195_c1_48_1004 317
565 3300050511 nmdc:mga08y16_11879_c1 nmdc:mga08y16_11879_c1_450_1406 317
566 3300050512 nmdc:mga0n895_501_c1 nmdc:mga0n895_501_c1_15039_15995 317
567 3300050513 nmdc:mga0rr50_78481_c1 nmdc:mga0rr50_78481_c1_911_1867 317
568 3300050514 nmdc:mga08x19_22229_c1 nmdc:mga08x19_22229_c1_783_1739 317

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08240

ADH_N

Alcohol dehydrogenase GroES-like domain

52

136

0.96

PF00107

ADH_zinc_N

Zinc-binding dehydrogenase

177

311

0.91

PF13602

ADH_zinc_N_2

Zinc-binding dehydrogenase

210

348

0.82

Structural Annotation

Top 5 Hits

ID Description Score Start End
1iyz-assembly1.cif.gz_A-2 crystal structures of the quinone oxidoreductase from thermus thermophilus hb8 and its complex with nadph 0.9276 1 315
4rvu-assembly2.cif.gz_C the native structure of mycobacterial rv1454c complexed with nadph 0.926 1 315
4rvu-assembly2.cif.gz_B the native structure of mycobacterial rv1454c complexed with nadph 0.9251 1 315
1iyz-assembly1.cif.gz_A-2 crystal structures of the quinone oxidoreductase from thermus thermophilus hb8 and its complex with nadph 0.9247 1 315
4rvu-assembly1.cif.gz_D the native structure of mycobacterial rv1454c complexed with nadph 0.923 1 315
ID Description Score Start End Superfamily
af_B0BNC9_26_350_3.90.180.10 Alpha Beta;Alpha-Beta Complex;Quinone Oxidoreductase; Chain A, domain 1;Medium-chain alcohol dehydrogenases, catalytic domain 0.9391 2 314 3.90.180.10
af_I1LVH0_176_320_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9381 114 258 3.40.50.720
af_Q08257_129_296_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9353 112 283 3.40.50.720
af_B0BNC9_147_315_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9336 115 280 3.40.50.720
af_Q3UNZ8_155_284_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.926 125 250 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A1H6CWX0-F1-model_v4 NADPH2:quinone reductase 0.9838 1 317 GO:0016491
AF-A0A6J4PZM8-F1-model_v4 Alcohol dehydrogenase-like C-terminal domain-containing protein 0.9543 134 254 GO:0016491
AF-A0A2S7MY95-F1-model_v4 Alcohol dehydrogenase 0.9542 1 317 GO:0003960
GO:0005829
GO:0035925
GO:0070402
AF-A0A2S7MY95-F1-model_v4 Alcohol dehydrogenase 0.9513 1 317 GO:0003960
GO:0005829
GO:0035925
GO:0070402
AF-A0A399DWR7-F1-model_v4 2-haloacrylate reductase (EC 1.3.1.103) 0.9499 134 315 GO:0102523

Feature Viewer

pLDDT pTM Quality
95.2 0.93 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map