F464677
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 568 | 320 | 554 | 318 |
Family's Representative Sequence
| Representative Sequence | 3300053077|Ga0495601_0014337|Ga0495601_0014337_2881_3939 |
| Length | 352 |
| Sequence | MRARPPGLDGAGQMAPAGRYAAPMTTMRAIQMTEFGGPEVLELADLPIPEPAAGEVLIRVSRAGVNFADTHTRTNSYVRKATLPLVPGGEVAGTIARAPAEGGGLEEGARVVALTGTGGYAEYATAPAAHAFAIPDGVEDGTALALIVQGTTAWHLYRTAGRVAEGESVVVHSAAGGVGSLAVQLGHALGAGRVIGTASSEKRRELALSLGADAAVDPAPEGLTERLLQANGGEPVDVVLDMAGGATFDASYEALSHFGRIVVCGISSEEPNRVSTGSLLRHSRAVVGFYLFHCLQRPGMFGEALADLFARVARGELQAVVGGTYPLAEAARAHEDLRGRRTTGKLLLDPAA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2585427649 | Amycolatopsis japonica MG417-CF17, DSM 44213 | Isolate | Unclassified |
| 2 | 2751185734 | Saccharothrix sp. NRRL B-16314 | Isolate | Rhizosphere |
| 3 | 2795385472 | Herbihabitans rhizosphaerae DSM 101727 | Isolate | Rhizosphere |
| 4 | 2808606522 | Amycolatopsis sp. BJA-103 | Isolate | Unclassified |
| 5 | 2833709550 | Microbacterium sp. 3290 | Isolate | Rhizosphere |
| 6 | 2837183177 | Egibacter rhizosphaerae EGI 80759 | Isolate | Unclassified |
| 7 | 2862574272 | Streptomyces sp. AcE210 | Isolate | Nodule |
| 8 | 2870721527 | Saccharothrix ecbatanensis DSM 45486 | Isolate | Rhizosphere |
| 9 | 2915768154 | Amycolatopsis pittospori PIP199 | Isolate | Unclassified |
| 10 | 2917736166 | Amycolatopsis dendrobii DR6-1 | Isolate | Unclassified |
| 11 | 2995463766 | Streptacidiphilus fuscans NEAU-YB345 | Isolate | Unclassified |
| 12 | 2997451912 | Streptomyces piniterrae jys28 | Isolate | Rhizosphere |
| 13 | 3006321560 | Actinacidiphila epipremni PRB2-1 | Isolate | Unclassified |
| 14 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 15 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 16 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 19 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 20 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 23 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 25 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 26 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 27 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 29 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 30 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 31 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 33 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 39 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 40 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 41 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 43 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 47 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 48 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 49 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 50 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 51 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 53 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 54 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 55 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 57 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 60 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 62 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 63 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 65 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 66 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 67 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 68 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 69 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 70 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 71 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 72 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 73 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 74 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 75 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 76 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 77 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 78 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 79 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 81 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 82 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 83 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 84 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 85 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 86 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 87 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 88 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 89 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 91 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 113 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 118 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 119 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300027360 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300027462 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300027543 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 180 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 181 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 182 | 3300030731 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 | Metagenome | Rhizosphere |
| 183 | 3300030736 | Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 | Metagenome | Rhizosphere |
| 184 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 185 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 186 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 187 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 188 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 189 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 190 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 191 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 192 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 193 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 194 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 195 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 196 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 197 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 198 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 199 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 200 | 3300031838 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM | Metagenome | Unclassified |
| 201 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 202 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 203 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 204 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 205 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 206 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 207 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 208 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 209 | 3300042016 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 | Metagenome | Rhizosphere |
| 210 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 211 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 212 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 213 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 214 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 215 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 216 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 217 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 218 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 219 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 220 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 221 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 259 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 260 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 261 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 262 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 263 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 264 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 265 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 266 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 267 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 268 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 269 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 270 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 271 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 272 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 273 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 274 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 275 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 276 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 277 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 278 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 279 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 280 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 281 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 282 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 283 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 284 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 285 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 286 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 287 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 288 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 289 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 290 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 291 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 292 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 293 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 294 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 295 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 296 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 297 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 298 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 299 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 300 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 301 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 302 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 303 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 304 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 305 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 306 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 307 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 308 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 309 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 313 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 314 | 3300053126 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere | Metagenome | Endosphere |
| 315 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 316 | 3300053137 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere | Metagenome | Endosphere |
| 317 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 318 | 3300053160 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere | Metagenome | Endosphere |
| 319 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 320 | 8047710418 | Umezawaea endophytica DSM 103496 | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 97.18 |
| Metatranscriptomes | 0.35 |
| Isolates | 2.46 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 1.58 |
| Nodule | 0.18 |
| Rhizoplane | 8.27 |
| Rhizosphere | 87.15 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 2.82 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24735J21928_10008106 | 3300002067 | Bacteria | 3408 |
| 2 | JGI25160J50197_1027544 | 3300003354 | Bacteria | 1544 |
| 3 | Ga0070658_10149554 | 3300005327 | Bacteria | 1954 |
| 4 | Ga0070676_10016946 | 3300005328 | Bacteria | 4028 |
| 5 | Ga0070676_10078983 | 3300005328 | Bacteria | 1991 |
| 6 | Ga0070676_10099842 | 3300005328 | Bacteria | 1791 |
| 7 | Ga0070683_100021152 | 3300005329 | Bacteria | 5801 |
| 8 | Ga0070690_100057431 | 3300005330 | Bacteria | 2498 |
| 9 | Ga0070670_100003423 | 3300005331 | Bacteria | 13166 |
| 10 | Ga0070670_100003853 | 3300005331 | Bacteria | 12508 |
| 11 | Ga0070670_100151587 | 3300005331 | Bacteria | 2006 |
| 12 | Ga0070677_10006162 | 3300005333 | Bacteria | 3980 |
| 13 | Ga0068869_100002225 | 3300005334 | Bacteria | 11665 |
| 14 | Ga0068869_100053236 | 3300005334 | Bacteria | 2941 |
| 15 | Ga0068869_100298279 | 3300005334 | Bacteria | 1300 |
| 16 | Ga0070666_10075883 | 3300005335 | Bacteria | 2292 |
| 17 | Ga0070666_10078019 | 3300005335 | Bacteria | 2261 |
| 18 | Ga0070680_100140990 | 3300005336 | Bacteria | 2021 |
| 19 | Ga0070680_100168411 | 3300005336 | Bacteria | 1843 |
| 20 | Ga0070682_100008989 | 3300005337 | Bacteria | 5646 |
| 21 | Ga0070682_100099709 | 3300005337 | Bacteria | 1915 |
| 22 | Ga0068868_100000506 | 3300005338 | Bacteria | 26045 |
| 23 | Ga0068868_100002416 | 3300005338 | Bacteria | 12929 |
| 24 | Ga0068868_100086667 | 3300005338 | Bacteria | 2517 |
| 25 | Ga0068868_100128776 | 3300005338 | Bacteria | 2070 |
| 26 | Ga0070660_100073883 | 3300005339 | Bacteria | 2666 |
| 27 | Ga0070660_100245163 | 3300005339 | Bacteria | 1460 |
| 28 | Ga0070689_100195733 | 3300005340 | Bacteria | 1648 |
| 29 | Ga0070691_10003548 | 3300005341 | Bacteria | 7035 |
| 30 | Ga0070687_100015465 | 3300005343 | Bacteria | 3452 |
| 31 | Ga0070661_100013545 | 3300005344 | Bacteria | 5725 |
| 32 | Ga0070661_100162632 | 3300005344 | Bacteria | 1691 |
| 33 | Ga0070692_10025409 | 3300005345 | Bacteria | 2918 |
| 34 | Ga0070675_100002379 | 3300005354 | Bacteria | 14006 |
| 35 | Ga0070675_100036729 | 3300005354 | Bacteria | 3988 |
| 36 | Ga0070675_100183178 | 3300005354 | Bacteria | 1812 |
| 37 | Ga0070671_100015608 | 3300005355 | Bacteria | 6137 |
| 38 | Ga0070671_100110448 | 3300005355 | Bacteria | 2309 |
| 39 | Ga0070674_100034607 | 3300005356 | Bacteria | 3375 |
| 40 | Ga0070674_100046514 | 3300005356 | Bacteria | 2969 |
| 41 | Ga0070673_100000290 | 3300005364 | Bacteria | 26028 |
| 42 | Ga0070673_100090496 | 3300005364 | Bacteria | 2500 |
| 43 | Ga0070667_100300496 | 3300005367 | Bacteria | 1445 |
| 44 | Ga0070667_100334616 | 3300005367 | Bacteria | 1368 |
| 45 | Ga0070709_10036390 | 3300005434 | Bacteria | 2998 |
| 46 | Ga0070713_100029854 | 3300005436 | Bacteria | 4323 |
| 47 | Ga0070713_100070019 | 3300005436 | Bacteria | 2960 |
| 48 | Ga0070710_10000271 | 3300005437 | Bacteria | 24519 |
| 49 | Ga0070710_10029817 | 3300005437 | Bacteria | 2930 |
| 50 | Ga0070710_10117396 | 3300005437 | Bacteria | 1606 |
| 51 | Ga0070710_10193769 | 3300005437 | Bacteria | 1279 |
| 52 | Ga0070711_100000326 | 3300005439 | Bacteria | 24637 |
| 53 | Ga0070711_100420716 | 3300005439 | Bacteria | 1089 |
| 54 | Ga0070700_100007928 | 3300005441 | Bacteria | 5763 |
| 55 | Ga0070700_100128890 | 3300005441 | Bacteria | 1704 |
| 56 | Ga0070700_100169288 | 3300005441 | Bacteria | 1511 |
| 57 | Ga0070663_100002860 | 3300005455 | Bacteria | 9823 |
| 58 | Ga0070663_100199127 | 3300005455 | Bacteria | 1562 |
| 59 | Ga0070678_100002873 | 3300005456 | Bacteria | 9539 |
| 60 | Ga0070678_100006404 | 3300005456 | Bacteria | 6906 |
| 61 | Ga0070678_100041381 | 3300005456 | Bacteria | 3266 |
| 62 | Ga0070662_100045540 | 3300005457 | Bacteria | 3148 |
| 63 | Ga0070662_100091596 | 3300005457 | Bacteria | 2284 |
| 64 | Ga0070662_100306071 | 3300005457 | Bacteria | 1292 |
| 65 | Ga0070681_10017899 | 3300005458 | Bacteria | 7082 |
| 66 | Ga0070681_10020771 | 3300005458 | Bacteria | 6578 |
| 67 | Ga0068867_100009938 | 3300005459 | Bacteria | 6703 |
| 68 | Ga0068867_100056416 | 3300005459 | Bacteria | 2906 |
| 69 | Ga0070685_10033859 | 3300005466 | Bacteria | 2874 |
| 70 | Ga0070707_100061114 | 3300005468 | Bacteria | 3613 |
| 71 | Ga0070698_100402490 | 3300005471 | Bacteria | 1302 |
| 72 | Ga0070699_100305811 | 3300005518 | Bacteria | 1427 |
| 73 | Ga0070679_100022494 | 3300005530 | Bacteria | 6161 |
| 74 | Ga0070679_100022860 | 3300005530 | Bacteria | 6115 |
| 75 | Ga0070679_100045732 | 3300005530 | Bacteria | 4362 |
| 76 | Ga0070684_100248828 | 3300005535 | Bacteria | 1624 |
| 77 | Ga0068853_100103336 | 3300005539 | Bacteria | 2522 |
| 78 | Ga0068853_100162990 | 3300005539 | Bacteria | 2013 |
| 79 | Ga0070672_100003493 | 3300005543 | Bacteria | 10182 |
| 80 | Ga0070686_100149891 | 3300005544 | Bacteria | 1632 |
| 81 | Ga0070693_100002484 | 3300005547 | Bacteria | 8496 |
| 82 | Ga0070693_100170341 | 3300005547 | Bacteria | 1394 |
| 83 | Ga0070665_100027256 | 3300005548 | Bacteria | 5754 |
| 84 | Ga0070665_100062791 | 3300005548 | Bacteria | 3724 |
| 85 | Ga0070665_100526605 | 3300005548 | Bacteria | 1194 |
| 86 | Ga0068855_100167154 | 3300005563 | Bacteria | 2493 |
| 87 | Ga0070664_100005082 | 3300005564 | Bacteria | 10551 |
| 88 | Ga0070664_100090735 | 3300005564 | Bacteria | 2644 |
| 89 | Ga0070664_100105592 | 3300005564 | Bacteria | 2453 |
| 90 | Ga0068854_100001523 | 3300005578 | Bacteria | 14057 |
| 91 | Ga0068854_100018014 | 3300005578 | Bacteria | 4735 |
| 92 | Ga0068856_100007435 | 3300005614 | Bacteria | 10690 |
| 93 | Ga0068856_100158159 | 3300005614 | Bacteria | 2276 |
| 94 | Ga0070702_100001869 | 3300005615 | Bacteria | 8805 |
| 95 | Ga0070702_100003637 | 3300005615 | Bacteria | 6936 |
| 96 | Ga0070702_100011469 | 3300005615 | Bacteria | 4409 |
| 97 | Ga0070702_100017476 | 3300005615 | Bacteria | 3700 |
| 98 | Ga0070702_100282862 | 3300005615 | Bacteria | 1139 |
| 99 | Ga0068852_100001955 | 3300005616 | Bacteria | 14037 |
| 100 | Ga0068852_100039516 | 3300005616 | Bacteria | 3972 |
| 101 | Ga0068852_100077349 | 3300005616 | Bacteria | 2941 |
| 102 | Ga0068852_100227546 | 3300005616 | Bacteria | 1776 |
| 103 | Ga0068859_100510001 | 3300005617 | Bacteria | 1298 |
| 104 | Ga0068864_100051888 | 3300005618 | Bacteria | 3534 |
| 105 | Ga0068864_100110090 | 3300005618 | Bacteria | 2452 |
| 106 | Ga0068864_100248548 | 3300005618 | Bacteria | 1650 |
| 107 | Ga0068866_10018149 | 3300005718 | Bacteria | 3177 |
| 108 | Ga0068866_10216622 | 3300005718 | Bacteria | 1153 |
| 109 | Ga0068861_100179309 | 3300005719 | Bacteria | 1762 |
| 110 | Ga0068861_100181051 | 3300005719 | Bacteria | 1754 |
| 111 | Ga0068851_10006943 | 3300005834 | Bacteria | 5190 |
| 112 | Ga0068870_10204620 | 3300005840 | Bacteria | 1199 |
| 113 | Ga0068863_100016289 | 3300005841 | Bacteria | 7133 |
| 114 | Ga0068863_100024215 | 3300005841 | Bacteria | 5790 |
| 115 | Ga0068863_100033462 | 3300005841 | Bacteria | 4897 |
| 116 | Ga0068863_100437582 | 3300005841 | Bacteria | 1282 |
| 117 | Ga0068858_100068154 | 3300005842 | Bacteria | 3297 |
| 118 | Ga0068858_100105978 | 3300005842 | Bacteria | 2624 |
| 119 | Ga0068858_100328979 | 3300005842 | Bacteria | 1461 |
| 120 | Ga0081538_10003652 | 3300005981 | Bacteria | 14456 |
| 121 | Ga0081538_10011533 | 3300005981 | Bacteria | 7153 |
| 122 | Ga0081540_1000863 | 3300005983 | Bacteria | 27456 |
| 123 | Ga0081539_10005001 | 3300005985 | Bacteria | 14004 |
| 124 | Ga0081539_10096977 | 3300005985 | Bacteria | 1511 |
| 125 | Ga0070717_10415975 | 3300006028 | Bacteria | 1209 |
| 126 | Ga0070717_10447360 | 3300006028 | Bacteria | 1164 |
| 127 | Ga0075432_10018453 | 3300006058 | Bacteria | 2380 |
| 128 | Ga0070712_100051663 | 3300006175 | Bacteria | 2864 |
| 129 | Ga0070712_100234177 | 3300006175 | Bacteria | 1460 |
| 130 | Ga0097621_100005925 | 3300006237 | Bacteria | 8639 |
| 131 | Ga0068871_100006079 | 3300006358 | Bacteria | 8496 |
| 132 | Ga0068871_100011522 | 3300006358 | Bacteria | 6486 |
| 133 | Ga0068871_100470214 | 3300006358 | Bacteria | 1129 |
| 134 | Ga0075428_100010486 | 3300006844 | Bacteria | 10297 |
| 135 | Ga0075428_100084841 | 3300006844 | Bacteria | 3455 |
| 136 | Ga0075430_100185583 | 3300006846 | Bacteria | 1729 |
| 137 | Ga0075431_100046941 | 3300006847 | Bacteria | 4453 |
| 138 | Ga0075431_100063053 | 3300006847 | Bacteria | 3824 |
| 139 | Ga0075433_10150727 | 3300006852 | Bacteria | 2069 |
| 140 | Ga0075434_100012093 | 3300006871 | Bacteria | 8173 |
| 141 | Ga0075429_100020347 | 3300006880 | Bacteria | 5756 |
| 142 | Ga0075429_100062582 | 3300006880 | Bacteria | 3242 |
| 143 | Ga0075429_100111907 | 3300006880 | Bacteria | 2386 |
| 144 | Ga0068865_100040225 | 3300006881 | Bacteria | 3175 |
| 145 | Ga0068865_100050351 | 3300006881 | Bacteria | 2877 |
| 146 | Ga0075436_100029586 | 3300006914 | Bacteria | 3766 |
| 147 | Ga0097620_100509959 | 3300006931 | Bacteria | 1298 |
| 148 | Ga0075435_100000815 | 3300007076 | Bacteria | 19432 |
| 149 | Ga0105251_10050701 | 3300009011 | Bacteria | 1982 |
| 150 | Ga0105240_10007499 | 3300009093 | Bacteria | 15829 |
| 151 | Ga0105240_10012503 | 3300009093 | Bacteria | 11713 |
| 152 | Ga0105240_10057686 | 3300009093 | Bacteria | 4849 |
| 153 | Ga0105240_10129707 | 3300009093 | Bacteria | 3026 |
| 154 | Ga0111539_10290268 | 3300009094 | Bacteria | 1903 |
| 155 | Ga0105245_10009265 | 3300009098 | Bacteria | 8587 |
| 156 | Ga0105245_10060811 | 3300009098 | Bacteria | 3403 |
| 157 | Ga0105245_10278219 | 3300009098 | Bacteria | 1635 |
| 158 | Ga0105245_10357817 | 3300009098 | Bacteria | 1448 |
| 159 | Ga0105245_10511661 | 3300009098 | Bacteria | 1218 |
| 160 | Ga0114129_10016322 | 3300009147 | Bacteria | 10571 |
| 161 | Ga0114129_10056024 | 3300009147 | Bacteria | 5524 |
| 162 | Ga0114129_10166952 | 3300009147 | Bacteria | 3003 |
| 163 | Ga0105243_10009731 | 3300009148 | Bacteria | 7322 |
| 164 | Ga0105243_10026406 | 3300009148 | Bacteria | 4444 |
| 165 | Ga0105243_10124834 | 3300009148 | Bacteria | 2176 |
| 166 | Ga0105243_10612658 | 3300009148 | Bacteria | 1050 |
| 167 | Ga0105241_10003029 | 3300009174 | Bacteria | 12554 |
| 168 | Ga0105248_10016037 | 3300009177 | Bacteria | 8246 |
| 169 | Ga0105248_10082167 | 3300009177 | Bacteria | 3622 |
| 170 | Ga0105248_10095342 | 3300009177 | Bacteria | 3350 |
| 171 | Ga0105248_10420450 | 3300009177 | Bacteria | 1505 |
| 172 | Ga0105237_10000431 | 3300009545 | Bacteria | 59607 |
| 173 | Ga0105237_10153808 | 3300009545 | Bacteria | 2296 |
| 174 | Ga0105238_10027344 | 3300009551 | Bacteria | 5811 |
| 175 | Ga0105238_10207821 | 3300009551 | Bacteria | 1933 |
| 176 | Ga0105249_10071695 | 3300009553 | Bacteria | 3201 |
| 177 | Ga0105239_10021851 | 3300010375 | Bacteria | 7054 |
| 178 | Ga0105239_10228790 | 3300010375 | Bacteria | 2086 |
| 179 | Ga0105246_10001085 | 3300011119 | Bacteria | 15741 |
| 180 | Ga0157370_10140191 | 3300013104 | Bacteria | 2253 |
| 181 | Ga0157369_10438335 | 3300013105 | Bacteria | 1353 |
| 182 | Ga0157374_10000911 | 3300013296 | Bacteria | 25717 |
| 183 | Ga0157374_10188364 | 3300013296 | Bacteria | 2018 |
| 184 | Ga0157374_10204772 | 3300013296 | Bacteria | 1933 |
| 185 | Ga0157374_10427324 | 3300013296 | Bacteria | 1324 |
| 186 | Ga0157378_10076496 | 3300013297 | Bacteria | 3016 |
| 187 | Ga0163162_10006814 | 3300013306 | Bacteria | 11084 |
| 188 | Ga0157372_10000022 | 3300013307 | Bacteria | 206038 |
| 189 | Ga0157372_10568161 | 3300013307 | Bacteria | 1322 |
| 190 | Ga0157375_10001769 | 3300013308 | Bacteria | 18549 |
| 191 | Ga0157375_10036375 | 3300013308 | Bacteria | 4710 |
| 192 | Ga0163163_10023671 | 3300014325 | Bacteria | 5832 |
| 193 | Ga0163163_10143792 | 3300014325 | Bacteria | 2428 |
| 194 | Ga0163163_10319002 | 3300014325 | Bacteria | 1607 |
| 195 | Ga0182008_10234623 | 3300014497 | Bacteria | 942 |
| 196 | Ga0157377_10032234 | 3300014745 | Bacteria | 2852 |
| 197 | Ga0157377_10060511 | 3300014745 | Bacteria | 2162 |
| 198 | Ga0157377_10076425 | 3300014745 | Bacteria | 1948 |
| 199 | Ga0157379_10214132 | 3300014968 | Bacteria | 1745 |
| 200 | Ga0157376_10005443 | 3300014969 | Bacteria | 8901 |
| 201 | Ga0157376_10097525 | 3300014969 | Bacteria | 2561 |
| 202 | Ga0163161_10024730 | 3300017792 | Bacteria | 4245 |
| 203 | Ga0206353_10182179 | 3300020082 | Bacteria | 2079 |
| 204 | Ga0207426_1002250 | 3300025302 | Bacteria | 12808 |
| 205 | Ga0207656_10006689 | 3300025321 | Bacteria | 4164 |
| 206 | Ga0207713_1052834 | 3300025735 | Bacteria | 1605 |
| 207 | Ga0207682_10003415 | 3300025893 | Bacteria | 6909 |
| 208 | Ga0207682_10021726 | 3300025893 | Bacteria | 2525 |
| 209 | Ga0207692_10000110 | 3300025898 | Bacteria | 24396 |
| 210 | Ga0207692_10039479 | 3300025898 | Bacteria | 2323 |
| 211 | Ga0207642_10071238 | 3300025899 | Bacteria | 1655 |
| 212 | Ga0207710_10040903 | 3300025900 | Bacteria | 2055 |
| 213 | Ga0207688_10001198 | 3300025901 | Bacteria | 13408 |
| 214 | Ga0207688_10099623 | 3300025901 | Bacteria | 1676 |
| 215 | Ga0207688_10122542 | 3300025901 | Bacteria | 1518 |
| 216 | Ga0207680_10170816 | 3300025903 | Bacteria | 1464 |
| 217 | Ga0207699_10109962 | 3300025906 | Bacteria | 1764 |
| 218 | Ga0207645_10006949 | 3300025907 | Bacteria | 8060 |
| 219 | Ga0207643_10000125 | 3300025908 | Bacteria | 53016 |
| 220 | Ga0207643_10038359 | 3300025908 | Bacteria | 2691 |
| 221 | Ga0207705_10028217 | 3300025909 | Bacteria | 4001 |
| 222 | Ga0207684_10031595 | 3300025910 | Bacteria | 4503 |
| 223 | Ga0207654_10063063 | 3300025911 | Bacteria | 2174 |
| 224 | Ga0207695_10006100 | 3300025913 | Bacteria | 15724 |
| 225 | Ga0207695_10073737 | 3300025913 | Bacteria | 3477 |
| 226 | Ga0207671_10001590 | 3300025914 | Bacteria | 25816 |
| 227 | Ga0207671_10131395 | 3300025914 | Bacteria | 1922 |
| 228 | Ga0207693_10039655 | 3300025915 | Bacteria | 3708 |
| 229 | Ga0207693_10063941 | 3300025915 | Bacteria | 2883 |
| 230 | Ga0207693_10193426 | 3300025915 | Bacteria | 1601 |
| 231 | Ga0207663_10000379 | 3300025916 | Bacteria | 19428 |
| 232 | Ga0207663_10125655 | 3300025916 | Bacteria | 1764 |
| 233 | Ga0207660_10017794 | 3300025917 | Bacteria | 4729 |
| 234 | Ga0207660_10279483 | 3300025917 | Bacteria | 1325 |
| 235 | Ga0207657_10035210 | 3300025919 | Bacteria | 4492 |
| 236 | Ga0207649_10004951 | 3300025920 | Bacteria | 7200 |
| 237 | Ga0207652_10066100 | 3300025921 | Bacteria | 3133 |
| 238 | Ga0207646_10389653 | 3300025922 | Bacteria | 1259 |
| 239 | Ga0207694_10049972 | 3300025924 | Bacteria | 3238 |
| 240 | Ga0207694_10203102 | 3300025924 | Bacteria | 1613 |
| 241 | Ga0207650_10005762 | 3300025925 | Bacteria | 8450 |
| 242 | Ga0207650_10017951 | 3300025925 | Bacteria | 4958 |
| 243 | Ga0207650_10066187 | 3300025925 | Bacteria | 2709 |
| 244 | Ga0207659_10000428 | 3300025926 | Bacteria | 25327 |
| 245 | Ga0207659_10035778 | 3300025926 | Bacteria | 3435 |
| 246 | Ga0207687_10048994 | 3300025927 | Bacteria | 2936 |
| 247 | Ga0207687_10068102 | 3300025927 | Bacteria | 2535 |
| 248 | Ga0207687_10123589 | 3300025927 | Bacteria | 1939 |
| 249 | Ga0207700_10053448 | 3300025928 | Bacteria | 3027 |
| 250 | Ga0207664_10406746 | 3300025929 | Bacteria | 1211 |
| 251 | Ga0207644_10000583 | 3300025931 | Bacteria | 23344 |
| 252 | Ga0207690_10135985 | 3300025932 | Bacteria | 1805 |
| 253 | Ga0207706_10030590 | 3300025933 | Bacteria | 4801 |
| 254 | Ga0207706_10036583 | 3300025933 | Bacteria | 4361 |
| 255 | Ga0207706_10063915 | 3300025933 | Bacteria | 3240 |
| 256 | Ga0207669_10115848 | 3300025937 | Bacteria | 1807 |
| 257 | Ga0207704_10246539 | 3300025938 | Bacteria | 1338 |
| 258 | Ga0207691_10000948 | 3300025940 | Bacteria | 28719 |
| 259 | Ga0207691_10102816 | 3300025940 | Bacteria | 2548 |
| 260 | Ga0207711_10120421 | 3300025941 | Bacteria | 2342 |
| 261 | Ga0207711_10179348 | 3300025941 | Bacteria | 1925 |
| 262 | Ga0207711_10194299 | 3300025941 | Bacteria | 1850 |
| 263 | Ga0207689_10000198 | 3300025942 | Bacteria | 53018 |
| 264 | Ga0207689_10004523 | 3300025942 | Bacteria | 12591 |
| 265 | Ga0207661_10003071 | 3300025944 | Bacteria | 11554 |
| 266 | Ga0207661_10003247 | 3300025944 | Bacteria | 11270 |
| 267 | Ga0207679_10004505 | 3300025945 | Bacteria | 8677 |
| 268 | Ga0207679_10049257 | 3300025945 | Bacteria | 3073 |
| 269 | Ga0207679_10121514 | 3300025945 | Bacteria | 2080 |
| 270 | Ga0207679_10412110 | 3300025945 | Bacteria | 1191 |
| 271 | Ga0207667_10067350 | 3300025949 | Bacteria | 3730 |
| 272 | Ga0207651_10014981 | 3300025960 | Bacteria | 4492 |
| 273 | Ga0207651_10017968 | 3300025960 | Bacteria | 4194 |
| 274 | Ga0207651_10044129 | 3300025960 | Bacteria | 2981 |
| 275 | Ga0207640_10034098 | 3300025981 | Bacteria | 3174 |
| 276 | Ga0207640_10151067 | 3300025981 | Bacteria | 1706 |
| 277 | Ga0207677_10000856 | 3300026023 | Bacteria | 17405 |
| 278 | Ga0207677_10023483 | 3300026023 | Bacteria | 3811 |
| 279 | Ga0207678_10000141 | 3300026067 | Bacteria | 59147 |
| 280 | Ga0207678_10110680 | 3300026067 | Bacteria | 2343 |
| 281 | Ga0207708_10011989 | 3300026075 | Bacteria | 6459 |
| 282 | Ga0207708_10016633 | 3300026075 | Bacteria | 5533 |
| 283 | Ga0207708_10152849 | 3300026075 | Bacteria | 1818 |
| 284 | Ga0207708_10209491 | 3300026075 | Bacteria | 1558 |
| 285 | Ga0207702_10006992 | 3300026078 | Bacteria | 9657 |
| 286 | Ga0207702_10012008 | 3300026078 | Bacteria | 7200 |
| 287 | Ga0207702_10081251 | 3300026078 | Bacteria | 2814 |
| 288 | Ga0207641_10017988 | 3300026088 | Bacteria | 5791 |
| 289 | Ga0207641_10026463 | 3300026088 | Bacteria | 4787 |
| 290 | Ga0207648_10008599 | 3300026089 | Bacteria | 9873 |
| 291 | Ga0207648_10009609 | 3300026089 | Bacteria | 9252 |
| 292 | Ga0207648_10193459 | 3300026089 | Bacteria | 1803 |
| 293 | Ga0207676_10001346 | 3300026095 | Bacteria | 18259 |
| 294 | Ga0207676_10009032 | 3300026095 | Bacteria | 7096 |
| 295 | Ga0207676_10076926 | 3300026095 | Bacteria | 2698 |
| 296 | Ga0207674_10540757 | 3300026116 | Bacteria | 1125 |
| 297 | Ga0207675_100111926 | 3300026118 | Bacteria | 2576 |
| 298 | Ga0207683_10000172 | 3300026121 | Bacteria | 55979 |
| 299 | Ga0207683_10000313 | 3300026121 | Bacteria | 44050 |
| 300 | Ga0207683_10010950 | 3300026121 | Bacteria | 7735 |
| 301 | Ga0207698_10015047 | 3300026142 | Bacteria | 5168 |
| 302 | Ga0207698_10025915 | 3300026142 | Bacteria | 4140 |
| 303 | Ga0209969_1001278 | 3300027360 | Bacteria | 3468 |
| 304 | Ga0210000_1005439 | 3300027462 | Bacteria | 1846 |
| 305 | Ga0209999_1000296 | 3300027543 | Bacteria | 7351 |
| 306 | Ga0209971_1009581 | 3300027682 | Bacteria | 2294 |
| 307 | Ga0209974_10002906 | 3300027876 | Bacteria | 6213 |
| 308 | Ga0209974_10072904 | 3300027876 | Bacteria | 1173 |
| 309 | Ga0268266_10058570 | 3300028379 | Bacteria | 3317 |
| 310 | Ga0268264_10023387 | 3300028381 | Bacteria | 5042 |
| 311 | Ga0265319_1054827 | 3300028563 | Bacteria | 1306 |
| 312 | Ga0265318_10004816 | 3300028577 | Bacteria | 6459 |
| 313 | Ga0307517_10010040 | 3300028786 | Bacteria | 13310 |
| 314 | Ga0307517_10133063 | 3300028786 | Bacteria | 1781 |
| 315 | Ga0316177_1042586 | 3300030731 | Bacteria | 5203 |
| 316 | Ga0316180_1004638 | 3300030736 | Bacteria | 2188 |
| 317 | Ga0265760_10001145 | 3300031090 | Bacteria | 7711 |
| 318 | Ga0265330_10002094 | 3300031235 | Bacteria | 11025 |
| 319 | Ga0265332_10000673 | 3300031238 | Bacteria | 22062 |
| 320 | Ga0265320_10003250 | 3300031240 | Bacteria | 10986 |
| 321 | Ga0265329_10006060 | 3300031242 | Bacteria | 4829 |
| 322 | Ga0265339_10063293 | 3300031249 | Bacteria | 1987 |
| 323 | Ga0265331_10002978 | 3300031250 | Bacteria | 11147 |
| 324 | Ga0265327_10051674 | 3300031251 | Bacteria | 2144 |
| 325 | Ga0265316_10008265 | 3300031344 | Bacteria | 9675 |
| 326 | Ga0307509_10148950 | 3300031507 | Bacteria | 2260 |
| 327 | Ga0307408_100069624 | 3300031548 | Bacteria | 2595 |
| 328 | Ga0265314_10003101 | 3300031711 | Bacteria | 16353 |
| 329 | Ga0265342_10002141 | 3300031712 | Bacteria | 17424 |
| 330 | Ga0307516_10353047 | 3300031730 | Bacteria | 1136 |
| 331 | Ga0307405_10023706 | 3300031731 | Bacteria | 3493 |
| 332 | Ga0307405_10026517 | 3300031731 | Bacteria | 3344 |
| 333 | Ga0307413_10039450 | 3300031824 | Bacteria | 2746 |
| 334 | Ga0307518_10000036 | 3300031838 | Bacteria | 91114 |
| 335 | Ga0307410_10010700 | 3300031852 | Bacteria | 5213 |
| 336 | Ga0307409_100021443 | 3300031995 | Bacteria | 4429 |
| 337 | Ga0307409_100033985 | 3300031995 | Bacteria | 3718 |
| 338 | Ga0307416_100017969 | 3300032002 | Bacteria | 4966 |
| 339 | Ga0307416_100058124 | 3300032002 | Bacteria | 3133 |
| 340 | Ga0307416_100094899 | 3300032002 | Bacteria | 2574 |
| 341 | Ga0307416_100556510 | 3300032002 | Bacteria | 1221 |
| 342 | Ga0307415_100017115 | 3300032126 | Bacteria | 4339 |
| 343 | Ga0373947_0056069 | 3300035725 | Bacteria | 2381 |
| 344 | Ga0395899_0234581 | 3300037312 | Bacteria | 1265 |
| 345 | Ga0395898_0117044 | 3300037466 | Bacteria | 2553 |
| 346 | Ga0395898_0219930 | 3300037466 | Bacteria | 1812 |
| 347 | Ga0395905_0024577 | 3300037471 | Bacteria | 5685 |
| 348 | Ga0439463_045454 | 3300042016 | Bacteria | 1118 |
| 349 | Ga0439459_0038488 | 3300042438 | Bacteria | 1006 |
| 350 | Ga0451577_0328234 | 3300042876 | Bacteria | 1388 |
| 351 | Ga0466969_0023038 | 3300044656 | Bacteria | 3211 |
| 352 | Ga0466965_0034703 | 3300044683 | Bacteria | 2468 |
| 353 | Ga0466966_0003085 | 3300044684 | Bacteria | 10980 |
| 354 | Ga0466966_0039600 | 3300044684 | Bacteria | 3035 |
| 355 | Ga0466966_0060323 | 3300044684 | Bacteria | 2395 |
| 356 | Ga0466961_0000190 | 3300044693 | Bacteria | 40985 |
| 357 | Ga0466961_0026551 | 3300044693 | Bacteria | 3722 |
| 358 | Ga0466961_0030290 | 3300044693 | Bacteria | 3478 |
| 359 | Ga0466961_0032781 | 3300044693 | Bacteria | 3338 |
| 360 | Ga0466961_0037519 | 3300044693 | Bacteria | 3108 |
| 361 | Ga0466964_0069070 | 3300044706 | Bacteria | 1489 |
| 362 | Ga0466968_0151450 | 3300044735 | Bacteria | 1066 |
| 363 | Ga0466959_0036084 | 3300045049 | Bacteria | 3653 |
| 364 | Ga0466959_0043746 | 3300045049 | Bacteria | 3300 |
| 365 | Ga0466958_0008873 | 3300045836 | Bacteria | 5585 |
| 366 | Ga0466958_0061336 | 3300045836 | Bacteria | 2291 |
| 367 | Ga0466958_0065926 | 3300045836 | Bacteria | 2210 |
| 368 | Ga0466967_0410777 | 3300045976 | Bacteria | 1318 |
| 369 | Ga0495592_0018018 | 3300046454 | Bacteria | 5364 |
| 370 | Ga0495629_0019151 | 3300046459 | Bacteria | 4893 |
| 371 | Ga0495629_0028004 | 3300046459 | Bacteria | 4002 |
| 372 | Ga0495651_0048938 | 3300046462 | Bacteria | 3264 |
| 373 | Ga0495653_0001671 | 3300046463 | Bacteria | 17440 |
| 374 | Ga0495653_0014011 | 3300046463 | Bacteria | 6538 |
| 375 | Ga0495580_0080079 | 3300046472 | Bacteria | 2278 |
| 376 | Ga0495580_0085059 | 3300046472 | Bacteria | 2203 |
| 377 | Ga0495605_0075585 | 3300046474 | Bacteria | 1584 |
| 378 | Ga0495662_0008122 | 3300046476 | Bacteria | 5169 |
| 379 | Ga0495664_0000073 | 3300046477 | Bacteria | 49243 |
| 380 | Ga0495664_0030446 | 3300046477 | Bacteria | 3161 |
| 381 | Ga0495664_0080641 | 3300046477 | Bacteria | 1950 |
| 382 | Ga0495608_0014491 | 3300046511 | Bacteria | 5467 |
| 383 | Ga0495608_0101175 | 3300046511 | Bacteria | 1858 |
| 384 | Ga0495618_0000046 | 3300046514 | Bacteria | 93942 |
| 385 | Ga0495628_0040560 | 3300046516 | Bacteria | 3720 |
| 386 | Ga0495628_0268102 | 3300046516 | Bacteria | 1271 |
| 387 | Ga0495630_0001117 | 3300046517 | Bacteria | 18462 |
| 388 | Ga0495632_0030314 | 3300046519 | Bacteria | 2809 |
| 389 | Ga0495643_0003006 | 3300046522 | Bacteria | 12686 |
| 390 | Ga0495666_0059263 | 3300046526 | Bacteria | 1831 |
| 391 | Ga0495666_0061023 | 3300046526 | Bacteria | 1801 |
| 392 | Ga0495642_0090659 | 3300046528 | Bacteria | 1294 |
| 393 | Ga0495652_0014520 | 3300046529 | Bacteria | 7068 |
| 394 | Ga0495652_0035994 | 3300046529 | Bacteria | 4306 |
| 395 | Ga0495640_0011689 | 3300046533 | Bacteria | 6739 |
| 396 | Ga0495645_0000022 | 3300046543 | Bacteria | 137019 |
| 397 | Ga0495645_0003048 | 3300046543 | Bacteria | 11343 |
| 398 | Ga0495645_0004535 | 3300046543 | Bacteria | 9476 |
| 399 | Ga0495667_0050042 | 3300046559 | Bacteria | 2758 |
| 400 | Ga0495635_0008722 | 3300046663 | Bacteria | 7079 |
| 401 | Ga0495657_0000041 | 3300046675 | Bacteria | 115251 |
| 402 | Ga0495657_0014917 | 3300046675 | Bacteria | 5698 |
| 403 | Ga0495657_0045523 | 3300046675 | Bacteria | 2977 |
| 404 | Ga0495599_0053763 | 3300046678 | Bacteria | 2522 |
| 405 | Ga0495623_0087283 | 3300046679 | Bacteria | 1922 |
| 406 | Ga0495646_0012198 | 3300046680 | Bacteria | 5464 |
| 407 | Ga0495646_0168533 | 3300046680 | Bacteria | 1208 |
| 408 | Ga0495647_0085092 | 3300046681 | Bacteria | 1288 |
| 409 | Ga0495669_0062539 | 3300046684 | Bacteria | 1687 |
| 410 | Ga0495613_0002329 | 3300046689 | Bacteria | 14377 |
| 411 | Ga0495613_0050954 | 3300046689 | Bacteria | 3052 |
| 412 | Ga0495613_0116494 | 3300046689 | Bacteria | 1922 |
| 413 | Ga0495670_0006343 | 3300046691 | Bacteria | 5810 |
| 414 | Ga0495581_0020780 | 3300047315 | Bacteria | 3808 |
| 415 | Ga0495581_0130179 | 3300047315 | Bacteria | 1466 |
| 416 | Ga0495604_0000216 | 3300047317 | Bacteria | 52795 |
| 417 | Ga0495604_0003567 | 3300047317 | Bacteria | 12404 |
| 418 | Ga0495604_0021804 | 3300047317 | Bacteria | 5113 |
| 419 | Ga0495604_0299046 | 3300047317 | Bacteria | 1081 |
| 420 | Ga0495674_0002673 | 3300047319 | Bacteria | 17352 |
| 421 | Ga0495676_0031407 | 3300047321 | Bacteria | 4492 |
| 422 | Ga0495676_0044071 | 3300047321 | Bacteria | 3645 |
| 423 | Ga0495675_0034732 | 3300047444 | Bacteria | 3219 |
| 424 | Ga0495681_0006206 | 3300047470 | Bacteria | 7883 |
| 425 | Ga0495684_0002822 | 3300047471 | Bacteria | 13698 |
| 426 | Ga0495602_0074274 | 3300048088 | Bacteria | 2890 |
| 427 | Ga0496100_0015459 | 3300048903 | Bacteria | 4458 |
| 428 | Ga0496100_0038504 | 3300048903 | Bacteria | 3031 |
| 429 | Ga0496101_0043891 | 3300048904 | Bacteria | 3197 |
| 430 | Ga0496102_0000040 | 3300048905 | Bacteria | 196737 |
| 431 | Ga0496102_0063027 | 3300048905 | Bacteria | 3394 |
| 432 | Ga0496102_0072593 | 3300048905 | Bacteria | 3163 |
| 433 | Ga0496103_0000294 | 3300048906 | Bacteria | 46122 |
| 434 | Ga0496104_0000006 | 3300048907 | Bacteria | 536446 |
| 435 | Ga0496104_0017947 | 3300048907 | Bacteria | 6451 |
| 436 | Ga0496104_0065527 | 3300048907 | Bacteria | 3447 |
| 437 | Ga0496104_0080101 | 3300048907 | Bacteria | 3113 |
| 438 | Ga0496105_0004008 | 3300048908 | Bacteria | 11018 |
| 439 | Ga0496105_0007657 | 3300048908 | Bacteria | 8370 |
| 440 | Ga0496105_0109076 | 3300048908 | Bacteria | 2285 |
| 441 | Ga0496106_0002994 | 3300048909 | Bacteria | 12576 |
| 442 | Ga0496106_0281674 | 3300048909 | Bacteria | 1332 |
| 443 | Ga0496108_0005808 | 3300048911 | Bacteria | 10003 |
| 444 | Ga0496108_0026932 | 3300048911 | Bacteria | 4744 |
| 445 | Ga0496108_0075204 | 3300048911 | Bacteria | 2853 |
| 446 | Ga0496108_0213234 | 3300048911 | Bacteria | 1676 |
| 447 | Ga0496108_0292630 | 3300048911 | Bacteria | 1418 |
| 448 | Ga0496109_0015228 | 3300048912 | Bacteria | 6695 |
| 449 | Ga0496109_0052239 | 3300048912 | Bacteria | 3724 |
| 450 | Ga0496109_0053866 | 3300048912 | Bacteria | 3670 |
| 451 | Ga0496109_0223390 | 3300048912 | Bacteria | 1771 |
| 452 | Ga0496109_0406832 | 3300048912 | Bacteria | 1286 |
| 453 | Ga0496110_0000044 | 3300048913 | Bacteria | 61218 |
| 454 | Ga0496110_0019503 | 3300048913 | Bacteria | 5708 |
| 455 | Ga0496110_0026526 | 3300048913 | Bacteria | 4959 |
| 456 | Ga0496110_0029727 | 3300048913 | Bacteria | 4706 |
| 457 | Ga0496110_0045394 | 3300048913 | Bacteria | 3841 |
| 458 | Ga0496110_0074130 | 3300048913 | Bacteria | 3022 |
| 459 | Ga0496111_0000304 | 3300048914 | Bacteria | 24108 |
| 460 | Ga0496111_0042508 | 3300048914 | Bacteria | 3263 |
| 461 | Ga0496111_0081176 | 3300048914 | Bacteria | 2367 |
| 462 | Ga0496111_0149551 | 3300048914 | Bacteria | 1732 |
| 463 | Ga0496112_0113577 | 3300048915 | Bacteria | 2679 |
| 464 | Ga0496113_0034637 | 3300048916 | Bacteria | 3685 |
| 465 | Ga0496113_0038427 | 3300048916 | Bacteria | 3519 |
| 466 | Ga0496113_0095713 | 3300048916 | Bacteria | 2295 |
| 467 | Ga0496113_0121837 | 3300048916 | Bacteria | 2039 |
| 468 | Ga0496114_0161347 | 3300048917 | Bacteria | 1950 |
| 469 | Ga0496114_0177593 | 3300048917 | Bacteria | 1858 |
| 470 | Ga0496115_0000059 | 3300048918 | Bacteria | 102022 |
| 471 | Ga0496115_0000087 | 3300048918 | Bacteria | 86513 |
| 472 | Ga0496115_0151824 | 3300048918 | Bacteria | 1913 |
| 473 | Ga0496115_0165275 | 3300048918 | Bacteria | 1830 |
| 474 | Ga0496122_0157026 | 3300048925 | Bacteria | 1394 |
| 475 | Ga0496124_0018661 | 3300048927 | Bacteria | 6488 |
| 476 | Ga0496124_0034827 | 3300048927 | Bacteria | 4412 |
| 477 | Ga0501031_0013765 | 3300049568 | Bacteria | 5273 |
| 478 | Ga0501032_0002157 | 3300049569 | Bacteria | 15505 |
| 479 | Ga0501032_0028281 | 3300049569 | Bacteria | 3852 |
| 480 | Ga0501033_0017480 | 3300049570 | Bacteria | 5418 |
| 481 | Ga0501033_0029993 | 3300049570 | Bacteria | 4087 |
| 482 | Ga0501033_0035959 | 3300049570 | Bacteria | 3713 |
| 483 | Ga0501033_0050003 | 3300049570 | Bacteria | 3102 |
| 484 | Ga0501034_0009005 | 3300049571 | Bacteria | 10484 |
| 485 | Ga0501034_0037215 | 3300049571 | Bacteria | 4927 |
| 486 | Ga0501036_0017828 | 3300049572 | Bacteria | 5942 |
| 487 | Ga0501036_0030117 | 3300049572 | Bacteria | 4585 |
| 488 | Ga0501036_0126835 | 3300049572 | Bacteria | 2155 |
| 489 | Ga0501037_0004888 | 3300049573 | Bacteria | 9746 |
| 490 | Ga0501037_0034377 | 3300049573 | Bacteria | 3740 |
| 491 | Ga0501037_0116875 | 3300049573 | Bacteria | 1919 |
| 492 | Ga0501037_0141391 | 3300049573 | Bacteria | 1722 |
| 493 | Ga0501038_0022596 | 3300049574 | Bacteria | 5633 |
| 494 | Ga0501038_0033572 | 3300049574 | Bacteria | 4519 |
| 495 | Ga0501038_0036163 | 3300049574 | Bacteria | 4334 |
| 496 | Ga0501038_0178666 | 3300049574 | Bacteria | 1714 |
| 497 | Ga0501039_0092640 | 3300049575 | Bacteria | 2355 |
| 498 | Ga0501040_0006671 | 3300049576 | Bacteria | 7492 |
| 499 | Ga0501041_0009101 | 3300049577 | Bacteria | 5843 |
| 500 | Ga0501042_0012321 | 3300049578 | Bacteria | 5789 |
| 501 | Ga0501042_0037421 | 3300049578 | Bacteria | 3443 |
| 502 | Ga0501042_0106903 | 3300049578 | Bacteria | 2014 |
| 503 | Ga0501043_0000952 | 3300049579 | Bacteria | 25679 |
| 504 | Ga0501046_0008376 | 3300049580 | Bacteria | 9013 |
| 505 | Ga0501047_0000261 | 3300049581 | Bacteria | 61793 |
| 506 | Ga0501047_0000547 | 3300049581 | Bacteria | 40575 |
| 507 | Ga0501047_0029622 | 3300049581 | Bacteria | 5278 |
| 508 | Ga0501047_0036940 | 3300049581 | Bacteria | 4721 |
| 509 | Ga0501047_0058535 | 3300049581 | Bacteria | 3722 |
| 510 | Ga0501048_0137723 | 3300049582 | Bacteria | 1725 |
| 511 | Ga0501067_0001659 | 3300049583 | Bacteria | 12224 |
| 512 | Ga0501068_0001603 | 3300049584 | Bacteria | 12047 |
| 513 | Ga0501068_0164821 | 3300049584 | Bacteria | 1397 |
| 514 | Ga0501070_0054657 | 3300049586 | Bacteria | 3311 |
| 515 | Ga0501070_0153481 | 3300049586 | Bacteria | 1899 |
| 516 | Ga0501071_0009745 | 3300049587 | Bacteria | 6409 |
| 517 | Ga0501071_0110115 | 3300049587 | Bacteria | 2035 |
| 518 | Ga0501072_0028700 | 3300049588 | Bacteria | 4343 |
| 519 | Ga0501073_0038136 | 3300049589 | Bacteria | 3410 |
| 520 | Ga0501076_0137846 | 3300049592 | Bacteria | 1981 |
| 521 | Ga0501079_0012317 | 3300049741 | Bacteria | 6524 |
| 522 | Ga0501080_0117664 | 3300049742 | Bacteria | 2463 |
| 523 | Ga0501080_0201499 | 3300049742 | Bacteria | 1827 |
| 524 | Ga0501083_0005717 | 3300049744 | Bacteria | 8800 |
| 525 | Ga0501035_0003878 | 3300049822 | Bacteria | 14268 |
| 526 | Ga0501035_0013704 | 3300049822 | Bacteria | 7480 |
| 527 | Ga0501044_0017091 | 3300049823 | Bacteria | 7784 |
| 528 | Ga0501044_0033101 | 3300049823 | Bacteria | 5432 |
| 529 | Ga0501044_0066204 | 3300049823 | Bacteria | 3684 |
| 530 | Ga0501044_0263956 | 3300049823 | Bacteria | 1659 |
| 531 | nmdc:mga05p37_8283_c1 | 3300050507 | Bacteria | 12292 |
| 532 | nmdc:mga05p37_9413_c1 | 3300050507 | Bacteria | 3114 |
| 533 | nmdc:mga09592_116029_c1 | 3300050508 | Bacteria | 2298 |
| 534 | nmdc:mga09592_286195_c1 | 3300050508 | Bacteria | 1429 |
| 535 | nmdc:mga09592_62259_c1 | 3300050508 | Bacteria | 3156 |
| 536 | nmdc:mga06r32_12954_c1 | 3300050510 | Bacteria | 7540 |
| 537 | nmdc:mga08y16_11879_c1 | 3300050511 | Bacteria | 9147 |
| 538 | nmdc:mga08y16_16853_c1 | 3300050511 | Bacteria | 7691 |
| 539 | nmdc:mga0n895_501_c1 | 3300050512 | Bacteria | 26516 |
| 540 | nmdc:mga0rr50_78481_c1 | 3300050513 | Bacteria | 2541 |
| 541 | nmdc:mga08x19_22229_c1 | 3300050514 | Bacteria | 3926 |
| 542 | Ga0495601_0014337 | 3300053077 | Bacteria | 4774 |
| 543 | Ga0495601_0016278 | 3300053077 | Bacteria | 4505 |
| 544 | Ga0495601_0111260 | 3300053077 | Bacteria | 1774 |
| 545 | Ga0495612_0000103 | 3300053078 | Bacteria | 36230 |
| 546 | Ga0495655_0009659 | 3300053083 | Bacteria | 1878 |
| 547 | Ga0500646_0000042 | 3300053090 | Bacteria | 35008 |
| 548 | Ga0500569_003941 | 3300053109 | Bacteria | 3081 |
| 549 | Ga0500621_071573 | 3300053126 | Bacteria | 1397 |
| 550 | Ga0500652_014799 | 3300053131 | Bacteria | 2799 |
| 551 | Ga0500561_0002038 | 3300053137 | Bacteria | 3359 |
| 552 | Ga0500616_0026798 | 3300053153 | Bacteria | 3186 |
| 553 | Ga0500633_0001764 | 3300053160 | Bacteria | 4226 |
| 554 | Ga0501084_0303566 | 3300054114 | Bacteria | 1348 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300046528 | Ga0495642_0090659 | Ga0495642_0090659_43_855 | 257 |
| 2 | 3300050510 | nmdc:mga06r32_12954_c1 | nmdc:mga06r32_12954_c1_6691_7503 | 257 |
| 3 | 3300049588 | Ga0501072_0028700 | Ga0501072_0028700_3518_4333 | 270 |
| 4 | 3300014497 | Ga0182008_10234623 | Ga0182008_102346231 | 289 |
| 5 | 3300046474 | Ga0495605_0075585 | Ga0495605_0075585_151_1074 | 292 |
| 6 | 3300009551 | Ga0105238_10207821 | Ga0105238_102078212 | 294 |
| 7 | 3300025924 | Ga0207694_10049972 | Ga0207694_100499722 | 294 |
| 8 | 3300048916 | Ga0496113_0034637 | Ga0496113_0034637_2302_3249 | 294 |
| 9 | 3300003354 | JGI25160J50197_1027544 | JGI25160J50197_10275442 | 295 |
| 10 | 3300025302 | Ga0207426_1002250 | Ga0207426_10022505 | 295 |
| 11 | 3300028786 | Ga0307517_10010040 | Ga0307517_100100405 | 295 |
| 12 | 3300031507 | Ga0307509_10148950 | Ga0307509_101489501 | 295 |
| 13 | 3300042876 | Ga0451577_0328234 | Ga0451577_0328234_428_1354 | 295 |
| 14 | 3300046519 | Ga0495632_0030314 | Ga0495632_0030314_1133_2101 | 295 |
| 15 | 3300046522 | Ga0495643_0003006 | Ga0495643_0003006_7905_8873 | 295 |
| 16 | 3300046691 | Ga0495670_0006343 | Ga0495670_0006343_1630_2598 | 295 |
| 17 | 3300047315 | Ga0495581_0130179 | Ga0495581_0130179_309_1277 | 295 |
| 18 | 3300047470 | Ga0495681_0006206 | Ga0495681_0006206_6214_7182 | 295 |
| 19 | 3300053083 | Ga0495655_0009659 | Ga0495655_0009659_857_1825 | 295 |
| 20 | 3300053109 | Ga0500569_003941 | Ga0500569_003941_1199_2167 | 295 |
| 21 | 3300053126 | Ga0500621_071573 | Ga0500621_071573_65_1033 | 295 |
| 22 | 3300053131 | Ga0500652_014799 | Ga0500652_014799_1267_2235 | 295 |
| 23 | 3300053137 | Ga0500561_0002038 | Ga0500561_0002038_1553_2521 | 295 |
| 24 | 3300053153 | Ga0500616_0026798 | Ga0500616_0026798_41_1009 | 295 |
| 25 | 3300053160 | Ga0500633_0001764 | Ga0500633_0001764_560_1528 | 295 |
| 26 | 3300013307 | Ga0157372_10000022 | Ga0157372_10000022183 | 296 |
| 27 | 3300006175 | Ga0070712_100051663 | Ga0070712_1000516632 | 298 |
| 28 | 3300025915 | Ga0207693_10063941 | Ga0207693_100639412 | 298 |
| 29 | 3300046472 | Ga0495580_0080079 | Ga0495580_0080079_1181_2134 | 298 |
| 30 | 3300047321 | Ga0495676_0044071 | Ga0495676_0044071_2200_3153 | 298 |
| 31 | 3300050508 | nmdc:mga09592_116029_c1 | nmdc:mga09592_116029_c1_686_1657 | 300 |
| 32 | 3300047471 | Ga0495684_0002822 | Ga0495684_0002822_11435_12355 | 301 |
| 33 | 3300046680 | Ga0495646_0168533 | Ga0495646_0168533_99_1088 | 303 |
| 34 | 3300006844 | Ga0075428_100084841 | Ga0075428_1000848412 | 304 |
| 35 | 3300006846 | Ga0075430_100185583 | Ga0075430_1001855831 | 304 |
| 36 | 3300006847 | Ga0075431_100046941 | Ga0075431_1000469412 | 304 |
| 37 | 3300006880 | Ga0075429_100020347 | Ga0075429_1000203475 | 304 |
| 38 | 3300009094 | Ga0111539_10290268 | Ga0111539_102902682 | 304 |
| 39 | 3300009098 | Ga0105245_10511661 | Ga0105245_105116611 | 304 |
| 40 | 3300009147 | Ga0114129_10016322 | Ga0114129_100163228 | 304 |
| 41 | 3300009148 | Ga0105243_10009731 | Ga0105243_100097315 | 304 |
| 42 | 3300009177 | Ga0105248_10420450 | Ga0105248_104204502 | 304 |
| 43 | 3300009553 | Ga0105249_10071695 | Ga0105249_100716952 | 304 |
| 44 | 3300013296 | Ga0157374_10204772 | Ga0157374_102047721 | 304 |
| 45 | 3300013297 | Ga0157378_10076496 | Ga0157378_100764962 | 304 |
| 46 | 3300014745 | Ga0157377_10076425 | Ga0157377_100764252 | 304 |
| 47 | 3300014968 | Ga0157379_10214132 | Ga0157379_102141322 | 304 |
| 48 | 3300014969 | Ga0157376_10097525 | Ga0157376_100975251 | 304 |
| 49 | 3300046681 | Ga0495647_0085092 | Ga0495647_0085092_255_1208 | 304 |
| 50 | 3300046684 | Ga0495669_0062539 | Ga0495669_0062539_648_1601 | 304 |
| 51 | 3300048911 | Ga0496108_0292630 | Ga0496108_0292630_55_1008 | 304 |
| 52 | 3300048912 | Ga0496109_0406832 | Ga0496109_0406832_294_1247 | 304 |
| 53 | 3300050507 | nmdc:mga05p37_8283_c1 | nmdc:mga05p37_8283_c1_2310_3263 | 304 |
| 54 | 3300050511 | nmdc:mga08y16_16853_c1 | nmdc:mga08y16_16853_c1_1320_2273 | 304 |
| 55 | 3300046517 | Ga0495630_0001117 | Ga0495630_0001117_2133_3122 | 306 |
| 56 | 3300046675 | Ga0495657_0000041 | Ga0495657_0000041_111972_112961 | 306 |
| 57 | 3300006028 | Ga0070717_10415975 | Ga0070717_104159751 | 307 |
| 58 | 3300035725 | Ga0373947_0056069 | Ga0373947_0056069_179_1183 | 307 |
| 59 | iso_pu_bacteria | 2862574272 | 2862583986 | 307 |
| 60 | 3300005328 | Ga0070676_10078983 | Ga0070676_100789832 | 308 |
| 61 | 3300005328 | Ga0070676_10099842 | Ga0070676_100998422 | 308 |
| 62 | 3300005329 | Ga0070683_100021152 | Ga0070683_1000211524 | 308 |
| 63 | 3300005330 | Ga0070690_100057431 | Ga0070690_1000574313 | 308 |
| 64 | 3300005331 | Ga0070670_100003423 | Ga0070670_10000342311 | 308 |
| 65 | 3300005331 | Ga0070670_100151587 | Ga0070670_1001515872 | 308 |
| 66 | 3300005333 | Ga0070677_10006162 | Ga0070677_100061622 | 308 |
| 67 | 3300005334 | Ga0068869_100298279 | Ga0068869_1002982791 | 308 |
| 68 | 3300005335 | Ga0070666_10075883 | Ga0070666_100758834 | 308 |
| 69 | 3300005336 | Ga0070680_100168411 | Ga0070680_1001684112 | 308 |
| 70 | 3300005338 | Ga0068868_100000506 | Ga0068868_1000005064 | 308 |
| 71 | 3300005343 | Ga0070687_100015465 | Ga0070687_1000154652 | 308 |
| 72 | 3300005344 | Ga0070661_100013545 | Ga0070661_1000135454 | 308 |
| 73 | 3300005354 | Ga0070675_100002379 | Ga0070675_1000023795 | 308 |
| 74 | 3300005355 | Ga0070671_100110448 | Ga0070671_1001104482 | 308 |
| 75 | 3300005356 | Ga0070674_100034607 | Ga0070674_1000346071 | 308 |
| 76 | 3300005356 | Ga0070674_100046514 | Ga0070674_1000465142 | 308 |
| 77 | 3300005364 | Ga0070673_100000290 | Ga0070673_1000002904 | 308 |
| 78 | 3300005367 | Ga0070667_100300496 | Ga0070667_1003004962 | 308 |
| 79 | 3300005367 | Ga0070667_100334616 | Ga0070667_1003346162 | 308 |
| 80 | 3300005441 | Ga0070700_100128890 | Ga0070700_1001288902 | 308 |
| 81 | 3300005455 | Ga0070663_100199127 | Ga0070663_1001991271 | 308 |
| 82 | 3300005456 | Ga0070678_100006404 | Ga0070678_1000064045 | 308 |
| 83 | 3300005457 | Ga0070662_100045540 | Ga0070662_1000455404 | 308 |
| 84 | 3300005457 | Ga0070662_100091596 | Ga0070662_1000915962 | 308 |
| 85 | 3300005458 | Ga0070681_10017899 | Ga0070681_100178993 | 308 |
| 86 | 3300005459 | Ga0068867_100009938 | Ga0068867_1000099382 | 308 |
| 87 | 3300005459 | Ga0068867_100056416 | Ga0068867_1000564163 | 308 |
| 88 | 3300005471 | Ga0070698_100402490 | Ga0070698_1004024901 | 308 |
| 89 | 3300005518 | Ga0070699_100305811 | Ga0070699_1003058112 | 308 |
| 90 | 3300005530 | Ga0070679_100045732 | Ga0070679_1000457322 | 308 |
| 91 | 3300005539 | Ga0068853_100103336 | Ga0068853_1001033362 | 308 |
| 92 | 3300005543 | Ga0070672_100003493 | Ga0070672_1000034935 | 308 |
| 93 | 3300005544 | Ga0070686_100149891 | Ga0070686_1001498911 | 308 |
| 94 | 3300005547 | Ga0070693_100170341 | Ga0070693_1001703411 | 308 |
| 95 | 3300005548 | Ga0070665_100062791 | Ga0070665_1000627914 | 308 |
| 96 | 3300005548 | Ga0070665_100526605 | Ga0070665_1005266051 | 308 |
| 97 | 3300005564 | Ga0070664_100005082 | Ga0070664_1000050823 | 308 |
| 98 | 3300005578 | Ga0068854_100001523 | Ga0068854_1000015237 | 308 |
| 99 | 3300005615 | Ga0070702_100003637 | Ga0070702_1000036372 | 308 |
| 100 | 3300005615 | Ga0070702_100017476 | Ga0070702_1000174762 | 308 |
| 101 | 3300005616 | Ga0068852_100001955 | Ga0068852_1000019552 | 308 |
| 102 | 3300005618 | Ga0068864_100051888 | Ga0068864_1000518883 | 308 |
| 103 | 3300005718 | Ga0068866_10216622 | Ga0068866_102166221 | 308 |
| 104 | 3300005719 | Ga0068861_100181051 | Ga0068861_1001810512 | 308 |
| 105 | 3300005834 | Ga0068851_10006943 | Ga0068851_100069435 | 308 |
| 106 | 3300005840 | Ga0068870_10204620 | Ga0068870_102046202 | 308 |
| 107 | 3300005841 | Ga0068863_100024215 | Ga0068863_1000242154 | 308 |
| 108 | 3300005842 | Ga0068858_100328979 | Ga0068858_1003289792 | 308 |
| 109 | 3300006028 | Ga0070717_10447360 | Ga0070717_104473601 | 308 |
| 110 | 3300006237 | Ga0097621_100005925 | Ga0097621_1000059253 | 308 |
| 111 | 3300006358 | Ga0068871_100006079 | Ga0068871_1000060795 | 308 |
| 112 | 3300006358 | Ga0068871_100470214 | Ga0068871_1004702141 | 308 |
| 113 | 3300006844 | Ga0075428_100010486 | Ga0075428_1000104869 | 308 |
| 114 | 3300006880 | Ga0075429_100062582 | Ga0075429_1000625822 | 308 |
| 115 | 3300006881 | Ga0068865_100040225 | Ga0068865_1000402253 | 308 |
| 116 | 3300009177 | Ga0105248_10016037 | Ga0105248_100160377 | 308 |
| 117 | 3300013296 | Ga0157374_10000911 | Ga0157374_1000091127 | 308 |
| 118 | 3300013306 | Ga0163162_10006814 | Ga0163162_1000681413 | 308 |
| 119 | 3300013308 | Ga0157375_10001769 | Ga0157375_100017694 | 308 |
| 120 | 3300014969 | Ga0157376_10005443 | Ga0157376_100054432 | 308 |
| 121 | 3300017792 | Ga0163161_10024730 | Ga0163161_100247303 | 308 |
| 122 | 3300025321 | Ga0207656_10006689 | Ga0207656_100066892 | 308 |
| 123 | 3300025893 | Ga0207682_10003415 | Ga0207682_100034152 | 308 |
| 124 | 3300025893 | Ga0207682_10021726 | Ga0207682_100217262 | 308 |
| 125 | 3300025899 | Ga0207642_10071238 | Ga0207642_100712382 | 308 |
| 126 | 3300025901 | Ga0207688_10099623 | Ga0207688_100996232 | 308 |
| 127 | 3300025903 | Ga0207680_10170816 | Ga0207680_101708161 | 308 |
| 128 | 3300025907 | Ga0207645_10006949 | Ga0207645_100069494 | 308 |
| 129 | 3300025908 | Ga0207643_10038359 | Ga0207643_100383592 | 308 |
| 130 | 3300025910 | Ga0207684_10031595 | Ga0207684_100315954 | 308 |
| 131 | 3300025917 | Ga0207660_10279483 | Ga0207660_102794832 | 308 |
| 132 | 3300025920 | Ga0207649_10004951 | Ga0207649_100049518 | 308 |
| 133 | 3300025925 | Ga0207650_10017951 | Ga0207650_100179514 | 308 |
| 134 | 3300025925 | Ga0207650_10066187 | Ga0207650_100661873 | 308 |
| 135 | 3300025926 | Ga0207659_10000428 | Ga0207659_1000042829 | 308 |
| 136 | 3300025926 | Ga0207659_10035778 | Ga0207659_100357783 | 308 |
| 137 | 3300025931 | Ga0207644_10000583 | Ga0207644_100005836 | 308 |
| 138 | 3300025933 | Ga0207706_10036583 | Ga0207706_100365834 | 308 |
| 139 | 3300025933 | Ga0207706_10063915 | Ga0207706_100639154 | 308 |
| 140 | 3300025937 | Ga0207669_10115848 | Ga0207669_101158482 | 308 |
| 141 | 3300025938 | Ga0207704_10246539 | Ga0207704_102465391 | 308 |
| 142 | 3300025940 | Ga0207691_10000948 | Ga0207691_100009489 | 308 |
| 143 | 3300025940 | Ga0207691_10102816 | Ga0207691_101028162 | 308 |
| 144 | 3300025941 | Ga0207711_10120421 | Ga0207711_101204212 | 308 |
| 145 | 3300025941 | Ga0207711_10179348 | Ga0207711_101793482 | 308 |
| 146 | 3300025942 | Ga0207689_10004523 | Ga0207689_100045233 | 308 |
| 147 | 3300025944 | Ga0207661_10003071 | Ga0207661_100030719 | 308 |
| 148 | 3300025945 | Ga0207679_10004505 | Ga0207679_1000450510 | 308 |
| 149 | 3300025945 | Ga0207679_10412110 | Ga0207679_104121101 | 308 |
| 150 | 3300025960 | Ga0207651_10014981 | Ga0207651_100149814 | 308 |
| 151 | 3300025960 | Ga0207651_10017968 | Ga0207651_100179682 | 308 |
| 152 | 3300025981 | Ga0207640_10034098 | Ga0207640_100340984 | 308 |
| 153 | 3300026023 | Ga0207677_10000856 | Ga0207677_1000085618 | 308 |
| 154 | 3300026067 | Ga0207678_10110680 | Ga0207678_101106803 | 308 |
| 155 | 3300026075 | Ga0207708_10011989 | Ga0207708_100119893 | 308 |
| 156 | 3300026088 | Ga0207641_10017988 | Ga0207641_100179884 | 308 |
| 157 | 3300026089 | Ga0207648_10008599 | Ga0207648_100085994 | 308 |
| 158 | 3300026089 | Ga0207648_10009609 | Ga0207648_100096097 | 308 |
| 159 | 3300026095 | Ga0207676_10009032 | Ga0207676_100090322 | 308 |
| 160 | 3300026116 | Ga0207674_10540757 | Ga0207674_105407571 | 308 |
| 161 | 3300026121 | Ga0207683_10000313 | Ga0207683_100003136 | 308 |
| 162 | 3300026142 | Ga0207698_10015047 | Ga0207698_100150472 | 308 |
| 163 | 3300027360 | Ga0209969_1001278 | Ga0209969_10012782 | 308 |
| 164 | 3300027462 | Ga0210000_1005439 | Ga0210000_10054392 | 308 |
| 165 | 3300027543 | Ga0209999_1000296 | Ga0209999_10002962 | 308 |
| 166 | 3300027682 | Ga0209971_1009581 | Ga0209971_10095812 | 308 |
| 167 | 3300027876 | Ga0209974_10002906 | Ga0209974_100029064 | 308 |
| 168 | 3300027876 | Ga0209974_10072904 | Ga0209974_100729041 | 308 |
| 169 | 3300028379 | Ga0268266_10058570 | Ga0268266_100585704 | 308 |
| 170 | 3300028577 | Ga0265318_10004816 | Ga0265318_100048163 | 308 |
| 171 | 3300031235 | Ga0265330_10002094 | Ga0265330_100020947 | 308 |
| 172 | 3300031238 | Ga0265332_10000673 | Ga0265332_1000067310 | 308 |
| 173 | 3300031240 | Ga0265320_10003250 | Ga0265320_100032505 | 308 |
| 174 | 3300031242 | Ga0265329_10006060 | Ga0265329_100060604 | 308 |
| 175 | 3300031249 | Ga0265339_10063293 | Ga0265339_100632933 | 308 |
| 176 | 3300031250 | Ga0265331_10002978 | Ga0265331_100029788 | 308 |
| 177 | 3300031251 | Ga0265327_10051674 | Ga0265327_100516742 | 308 |
| 178 | 3300031344 | Ga0265316_10008265 | Ga0265316_100082653 | 308 |
| 179 | 3300031711 | Ga0265314_10003101 | Ga0265314_100031011 | 308 |
| 180 | 3300031712 | Ga0265342_10002141 | Ga0265342_1000214119 | 308 |
| 181 | 3300048903 | Ga0496100_0015459 | Ga0496100_0015459_1877_2854 | 308 |
| 182 | 3300048909 | Ga0496106_0281674 | Ga0496106_0281674_235_1212 | 308 |
| 183 | 3300048911 | Ga0496108_0005808 | Ga0496108_0005808_6202_7179 | 308 |
| 184 | 3300048913 | Ga0496110_0026526 | Ga0496110_0026526_723_1700 | 308 |
| 185 | 3300048917 | Ga0496114_0177593 | Ga0496114_0177593_228_1205 | 308 |
| 186 | 3300009093 | Ga0105240_10012503 | Ga0105240_100125037 | 309 |
| 187 | 3300013307 | Ga0157372_10568161 | Ga0157372_105681612 | 309 |
| 188 | 3300031090 | Ga0265760_10001145 | Ga0265760_100011455 | 309 |
| 189 | 3300005436 | Ga0070713_100029854 | Ga0070713_1000298543 | 310 |
| 190 | 3300005530 | Ga0070679_100022860 | Ga0070679_1000228609 | 310 |
| 191 | 3300025916 | Ga0207663_10125655 | Ga0207663_101256552 | 310 |
| 192 | 3300025928 | Ga0207700_10053448 | Ga0207700_100534482 | 310 |
| 193 | 3300025929 | Ga0207664_10406746 | Ga0207664_104067462 | 310 |
| 194 | 3300044693 | Ga0466961_0032781 | Ga0466961_0032781_968_1921 | 310 |
| 195 | 3300045836 | Ga0466958_0065926 | Ga0466958_0065926_119_1072 | 310 |
| 196 | 3300048907 | Ga0496104_0017947 | Ga0496104_0017947_165_1118 | 310 |
| 197 | 3300048908 | Ga0496105_0007657 | Ga0496105_0007657_7078_8031 | 310 |
| 198 | 3300048911 | Ga0496108_0213234 | Ga0496108_0213234_340_1293 | 310 |
| 199 | 3300048912 | Ga0496109_0223390 | Ga0496109_0223390_643_1596 | 310 |
| 200 | 3300048913 | Ga0496110_0045394 | Ga0496110_0045394_869_1822 | 310 |
| 201 | 3300048914 | Ga0496111_0081176 | Ga0496111_0081176_75_1028 | 310 |
| 202 | 3300048916 | Ga0496113_0095713 | Ga0496113_0095713_251_1204 | 310 |
| 203 | 3300048918 | Ga0496115_0151824 | Ga0496115_0151824_207_1160 | 310 |
| 204 | 3300048927 | Ga0496124_0018661 | Ga0496124_0018661_15_1016 | 310 |
| 205 | iso_pu_bacteria | 2997451912 | 2997457330 | 310 |
| 206 | 3300014325 | Ga0163163_10023671 | Ga0163163_100236712 | 311 |
| 207 | 3300053078 | Ga0495612_0000103 | Ga0495612_0000103_31360_32352 | 311 |
| 208 | 3300005983 | Ga0081540_1000863 | Ga0081540_100086324 | 312 |
| 209 | 3300044656 | Ga0466969_0023038 | Ga0466969_0023038_1351_2304 | 312 |
| 210 | 3300044684 | Ga0466966_0039600 | Ga0466966_0039600_948_1901 | 312 |
| 211 | 3300044693 | Ga0466961_0000190 | Ga0466961_0000190_15105_16058 | 312 |
| 212 | 3300045049 | Ga0466959_0043746 | Ga0466959_0043746_380_1333 | 312 |
| 213 | 3300045836 | Ga0466958_0008873 | Ga0466958_0008873_4177_5130 | 312 |
| 214 | iso_pu_bacteria | 2751185734 | 2753076049 | 312 |
| 215 | iso_pu_bacteria | 2795385472 | 2795794280 | 312 |
| 216 | iso_pu_bacteria | 2833709550 | 2833711309 | 312 |
| 217 | iso_pu_bacteria | 2837183177 | 2837185764 | 312 |
| 218 | iso_pu_bacteria | 2870721527 | 2870730211 | 312 |
| 219 | iso_pu_bacteria | 2995463766 | 2995470999 | 312 |
| 220 | iso_pu_bacteria | 3006321560 | 3006327679 | 312 |
| 221 | 3300005985 | Ga0081539_10005001 | Ga0081539_100050017 | 313 |
| 222 | 3300037466 | Ga0395898_0219930 | Ga0395898_0219930_40_1008 | 313 |
| 223 | iso_pu_bacteria | 2585427649 | 2586058134 | 313 |
| 224 | iso_pu_bacteria | 2808606522 | 2809593019 | 313 |
| 225 | iso_pu_bacteria | 2915768154 | 2915768288 | 313 |
| 226 | iso_pu_bacteria | 2917736166 | 2917739793 | 313 |
| 227 | iso_pu_bacteria | 8047710418 | 8047718273 | 313 |
| 228 | 3300005334 | Ga0068869_100053236 | Ga0068869_1000532363 | 315 |
| 229 | 3300005337 | Ga0070682_100008989 | Ga0070682_1000089896 | 315 |
| 230 | 3300005338 | Ga0068868_100086667 | Ga0068868_1000866672 | 315 |
| 231 | 3300005339 | Ga0070660_100245163 | Ga0070660_1002451631 | 315 |
| 232 | 3300005344 | Ga0070661_100162632 | Ga0070661_1001626322 | 315 |
| 233 | 3300005354 | Ga0070675_100183178 | Ga0070675_1001831782 | 315 |
| 234 | 3300005437 | Ga0070710_10117396 | Ga0070710_101173962 | 315 |
| 235 | 3300005437 | Ga0070710_10193769 | Ga0070710_101937692 | 315 |
| 236 | 3300005439 | Ga0070711_100000326 | Ga0070711_1000003263 | 315 |
| 237 | 3300005439 | Ga0070711_100420716 | Ga0070711_1004207161 | 315 |
| 238 | 3300005441 | Ga0070700_100007928 | Ga0070700_1000079282 | 315 |
| 239 | 3300005456 | Ga0070678_100041381 | Ga0070678_1000413813 | 315 |
| 240 | 3300005457 | Ga0070662_100306071 | Ga0070662_1003060712 | 315 |
| 241 | 3300005468 | Ga0070707_100061114 | Ga0070707_1000611144 | 315 |
| 242 | 3300005535 | Ga0070684_100248828 | Ga0070684_1002488282 | 315 |
| 243 | 3300005539 | Ga0068853_100162990 | Ga0068853_1001629901 | 315 |
| 244 | 3300005564 | Ga0070664_100090735 | Ga0070664_1000907352 | 315 |
| 245 | 3300005614 | Ga0068856_100158159 | Ga0068856_1001581592 | 315 |
| 246 | 3300005615 | Ga0070702_100282862 | Ga0070702_1002828621 | 315 |
| 247 | 3300005616 | Ga0068852_100077349 | Ga0068852_1000773493 | 315 |
| 248 | 3300005618 | Ga0068864_100110090 | Ga0068864_1001100902 | 315 |
| 249 | 3300005719 | Ga0068861_100179309 | Ga0068861_1001793092 | 315 |
| 250 | 3300005841 | Ga0068863_100437582 | Ga0068863_1004375821 | 315 |
| 251 | 3300006175 | Ga0070712_100234177 | Ga0070712_1002341772 | 315 |
| 252 | 3300006881 | Ga0068865_100050351 | Ga0068865_1000503512 | 315 |
| 253 | 3300009093 | Ga0105240_10007499 | Ga0105240_1000749917 | 315 |
| 254 | 3300009093 | Ga0105240_10057686 | Ga0105240_100576862 | 315 |
| 255 | 3300009098 | Ga0105245_10009265 | Ga0105245_1000926510 | 315 |
| 256 | 3300009098 | Ga0105245_10357817 | Ga0105245_103578172 | 315 |
| 257 | 3300009148 | Ga0105243_10124834 | Ga0105243_101248342 | 315 |
| 258 | 3300009177 | Ga0105248_10095342 | Ga0105248_100953424 | 315 |
| 259 | 3300009545 | Ga0105237_10000431 | Ga0105237_1000043127 | 315 |
| 260 | 3300010375 | Ga0105239_10021851 | Ga0105239_100218515 | 315 |
| 261 | 3300013296 | Ga0157374_10427324 | Ga0157374_104273241 | 315 |
| 262 | 3300014325 | Ga0163163_10319002 | Ga0163163_103190022 | 315 |
| 263 | 3300025901 | Ga0207688_10001198 | Ga0207688_100011989 | 315 |
| 264 | 3300025913 | Ga0207695_10006100 | Ga0207695_100061001 | 315 |
| 265 | 3300025913 | Ga0207695_10073737 | Ga0207695_100737374 | 315 |
| 266 | 3300025914 | Ga0207671_10001590 | Ga0207671_1000159012 | 315 |
| 267 | 3300025915 | Ga0207693_10039655 | Ga0207693_100396552 | 315 |
| 268 | 3300025915 | Ga0207693_10193426 | Ga0207693_101934262 | 315 |
| 269 | 3300025916 | Ga0207663_10000379 | Ga0207663_100003793 | 315 |
| 270 | 3300025922 | Ga0207646_10389653 | Ga0207646_103896532 | 315 |
| 271 | 3300025927 | Ga0207687_10068102 | Ga0207687_100681021 | 315 |
| 272 | 3300025933 | Ga0207706_10030590 | Ga0207706_100305902 | 315 |
| 273 | 3300025945 | Ga0207679_10049257 | Ga0207679_100492573 | 315 |
| 274 | 3300026075 | Ga0207708_10016633 | Ga0207708_100166332 | 315 |
| 275 | 3300026078 | Ga0207702_10081251 | Ga0207702_100812513 | 315 |
| 276 | 3300026095 | Ga0207676_10076926 | Ga0207676_100769262 | 315 |
| 277 | 3300026121 | Ga0207683_10010950 | Ga0207683_100109503 | 315 |
| 278 | 3300028563 | Ga0265319_1054827 | Ga0265319_10548271 | 315 |
| 279 | 3300032002 | Ga0307416_100556510 | Ga0307416_1005565101 | 315 |
| 280 | 3300044735 | Ga0466968_0151450 | Ga0466968_0151450_53_1006 | 315 |
| 281 | 3300045836 | Ga0466958_0061336 | Ga0466958_0061336_718_1671 | 315 |
| 282 | 3300046463 | Ga0495653_0014011 | Ga0495653_0014011_2224_3201 | 315 |
| 283 | 3300046477 | Ga0495664_0000073 | Ga0495664_0000073_36802_37797 | 315 |
| 284 | 3300046514 | Ga0495618_0000046 | Ga0495618_0000046_8299_9285 | 315 |
| 285 | 3300046529 | Ga0495652_0014520 | Ga0495652_0014520_5918_6895 | 315 |
| 286 | 3300046543 | Ga0495645_0000022 | Ga0495645_0000022_62025_63011 | 315 |
| 287 | 3300047317 | Ga0495604_0003567 | Ga0495604_0003567_9501_10505 | 315 |
| 288 | 3300048905 | Ga0496102_0000040 | Ga0496102_0000040_13581_14558 | 315 |
| 289 | 3300048905 | Ga0496102_0072593 | Ga0496102_0072593_1602_2555 | 315 |
| 290 | 3300048906 | Ga0496103_0000294 | Ga0496103_0000294_13597_14574 | 315 |
| 291 | 3300048907 | Ga0496104_0000006 | Ga0496104_0000006_390395_391408 | 315 |
| 292 | 3300048907 | Ga0496104_0080101 | Ga0496104_0080101_92_1045 | 315 |
| 293 | 3300048908 | Ga0496105_0109076 | Ga0496105_0109076_1014_1967 | 315 |
| 294 | 3300048911 | Ga0496108_0075204 | Ga0496108_0075204_779_1732 | 315 |
| 295 | 3300048912 | Ga0496109_0015228 | Ga0496109_0015228_156_1103 | 315 |
| 296 | 3300048912 | Ga0496109_0052239 | Ga0496109_0052239_1346_2299 | 315 |
| 297 | 3300048913 | Ga0496110_0000044 | Ga0496110_0000044_28572_29585 | 315 |
| 298 | 3300048913 | Ga0496110_0029727 | Ga0496110_0029727_2053_3006 | 315 |
| 299 | 3300048914 | Ga0496111_0000304 | Ga0496111_0000304_18004_19017 | 315 |
| 300 | 3300048915 | Ga0496112_0113577 | Ga0496112_0113577_1386_2339 | 315 |
| 301 | 3300048916 | Ga0496113_0121837 | Ga0496113_0121837_252_1205 | 315 |
| 302 | 3300048918 | Ga0496115_0000059 | Ga0496115_0000059_23395_24348 | 315 |
| 303 | 3300048918 | Ga0496115_0000087 | Ga0496115_0000087_81779_82732 | 315 |
| 304 | 3300048925 | Ga0496122_0157026 | Ga0496122_0157026_133_1086 | 315 |
| 305 | 3300048927 | Ga0496124_0034827 | Ga0496124_0034827_1969_2922 | 315 |
| 306 | 3300049570 | Ga0501033_0017480 | Ga0501033_0017480_1043_1996 | 315 |
| 307 | 3300049573 | Ga0501037_0116875 | Ga0501037_0116875_368_1321 | 315 |
| 308 | 3300049578 | Ga0501042_0012321 | Ga0501042_0012321_271_1224 | 315 |
| 309 | 3300049582 | Ga0501048_0137723 | Ga0501048_0137723_362_1315 | 315 |
| 310 | 3300049584 | Ga0501068_0164821 | Ga0501068_0164821_240_1193 | 315 |
| 311 | 3300049586 | Ga0501070_0153481 | Ga0501070_0153481_616_1569 | 315 |
| 312 | 3300049587 | Ga0501071_0110115 | Ga0501071_0110115_256_1209 | 315 |
| 313 | 3300049742 | Ga0501080_0201499 | Ga0501080_0201499_313_1266 | 315 |
| 314 | 3300049823 | Ga0501044_0263956 | Ga0501044_0263956_394_1347 | 315 |
| 315 | 3300053077 | Ga0495601_0014337 | Ga0495601_0014337_2881_3939 | 315 |
| 316 | 3300053077 | Ga0495601_0016278 | Ga0495601_0016278_1306_2283 | 315 |
| 317 | 3300054114 | Ga0501084_0303566 | Ga0501084_0303566_158_1111 | 315 |
| 318 | 3300005338 | Ga0068868_100128776 | Ga0068868_1001287762 | 316 |
| 319 | 3300005578 | Ga0068854_100018014 | Ga0068854_1000180146 | 316 |
| 320 | 3300005615 | Ga0070702_100011469 | Ga0070702_1000114696 | 316 |
| 321 | 3300005616 | Ga0068852_100227546 | Ga0068852_1002275463 | 316 |
| 322 | 3300005617 | Ga0068859_100510001 | Ga0068859_1005100012 | 316 |
| 323 | 3300005718 | Ga0068866_10018149 | Ga0068866_100181492 | 316 |
| 324 | 3300005842 | Ga0068858_100068154 | Ga0068858_1000681543 | 316 |
| 325 | 3300005981 | Ga0081538_10003652 | Ga0081538_1000365210 | 316 |
| 326 | 3300005981 | Ga0081538_10011533 | Ga0081538_100115338 | 316 |
| 327 | 3300005985 | Ga0081539_10096977 | Ga0081539_100969772 | 316 |
| 328 | 3300006880 | Ga0075429_100111907 | Ga0075429_1001119073 | 316 |
| 329 | 3300006931 | Ga0097620_100509959 | Ga0097620_1005099592 | 316 |
| 330 | 3300009098 | Ga0105245_10278219 | Ga0105245_102782192 | 316 |
| 331 | 3300009147 | Ga0114129_10056024 | Ga0114129_100560242 | 316 |
| 332 | 3300009148 | Ga0105243_10026406 | Ga0105243_100264066 | 316 |
| 333 | 3300014745 | Ga0157377_10032234 | Ga0157377_100322343 | 316 |
| 334 | 3300025901 | Ga0207688_10122542 | Ga0207688_101225422 | 316 |
| 335 | 3300025927 | Ga0207687_10123589 | Ga0207687_101235892 | 316 |
| 336 | 3300026075 | Ga0207708_10152849 | Ga0207708_101528492 | 316 |
| 337 | 3300028786 | Ga0307517_10133063 | Ga0307517_101330633 | 316 |
| 338 | 3300031548 | Ga0307408_100069624 | Ga0307408_1000696242 | 316 |
| 339 | 3300031730 | Ga0307516_10353047 | Ga0307516_103530471 | 316 |
| 340 | 3300031731 | Ga0307405_10023706 | Ga0307405_100237063 | 316 |
| 341 | 3300031731 | Ga0307405_10026517 | Ga0307405_100265172 | 316 |
| 342 | 3300031824 | Ga0307413_10039450 | Ga0307413_100394502 | 316 |
| 343 | 3300031852 | Ga0307410_10010700 | Ga0307410_100107003 | 316 |
| 344 | 3300031995 | Ga0307409_100021443 | Ga0307409_1000214435 | 316 |
| 345 | 3300031995 | Ga0307409_100033985 | Ga0307409_1000339853 | 316 |
| 346 | 3300032002 | Ga0307416_100017969 | Ga0307416_1000179692 | 316 |
| 347 | 3300032002 | Ga0307416_100058124 | Ga0307416_1000581242 | 316 |
| 348 | 3300032002 | Ga0307416_100094899 | Ga0307416_1000948992 | 316 |
| 349 | 3300032126 | Ga0307415_100017115 | Ga0307415_1000171152 | 316 |
| 350 | 3300037312 | Ga0395899_0234581 | Ga0395899_0234581_255_1208 | 316 |
| 351 | 3300037466 | Ga0395898_0117044 | Ga0395898_0117044_1352_2305 | 316 |
| 352 | 3300037471 | Ga0395905_0024577 | Ga0395905_0024577_3443_4396 | 316 |
| 353 | 3300044684 | Ga0466966_0003085 | Ga0466966_0003085_1796_2749 | 316 |
| 354 | 3300044684 | Ga0466966_0060323 | Ga0466966_0060323_587_1540 | 316 |
| 355 | 3300044693 | Ga0466961_0026551 | Ga0466961_0026551_276_1229 | 316 |
| 356 | 3300044693 | Ga0466961_0037519 | Ga0466961_0037519_2025_2978 | 316 |
| 357 | 3300044706 | Ga0466964_0069070 | Ga0466964_0069070_322_1290 | 316 |
| 358 | 3300045049 | Ga0466959_0036084 | Ga0466959_0036084_1867_2820 | 316 |
| 359 | 3300045976 | Ga0466967_0410777 | Ga0466967_0410777_76_1032 | 316 |
| 360 | 3300046454 | Ga0495592_0018018 | Ga0495592_0018018_3647_4600 | 316 |
| 361 | 3300046459 | Ga0495629_0019151 | Ga0495629_0019151_2084_3037 | 316 |
| 362 | 3300046459 | Ga0495629_0028004 | Ga0495629_0028004_2105_3058 | 316 |
| 363 | 3300046462 | Ga0495651_0048938 | Ga0495651_0048938_1100_2053 | 316 |
| 364 | 3300046463 | Ga0495653_0001671 | Ga0495653_0001671_14515_15468 | 316 |
| 365 | 3300046472 | Ga0495580_0085059 | Ga0495580_0085059_49_1002 | 316 |
| 366 | 3300046476 | Ga0495662_0008122 | Ga0495662_0008122_72_1025 | 316 |
| 367 | 3300046477 | Ga0495664_0030446 | Ga0495664_0030446_236_1189 | 316 |
| 368 | 3300046477 | Ga0495664_0080641 | Ga0495664_0080641_71_1024 | 316 |
| 369 | 3300046511 | Ga0495608_0014491 | Ga0495608_0014491_93_1046 | 316 |
| 370 | 3300046511 | Ga0495608_0101175 | Ga0495608_0101175_563_1534 | 316 |
| 371 | 3300046516 | Ga0495628_0040560 | Ga0495628_0040560_909_1862 | 316 |
| 372 | 3300046516 | Ga0495628_0268102 | Ga0495628_0268102_174_1127 | 316 |
| 373 | 3300046526 | Ga0495666_0059263 | Ga0495666_0059263_77_1030 | 316 |
| 374 | 3300046526 | Ga0495666_0061023 | Ga0495666_0061023_73_1026 | 316 |
| 375 | 3300046529 | Ga0495652_0035994 | Ga0495652_0035994_2198_3151 | 316 |
| 376 | 3300046533 | Ga0495640_0011689 | Ga0495640_0011689_2444_3397 | 316 |
| 377 | 3300046543 | Ga0495645_0003048 | Ga0495645_0003048_2310_3263 | 316 |
| 378 | 3300046543 | Ga0495645_0004535 | Ga0495645_0004535_2283_3242 | 316 |
| 379 | 3300046559 | Ga0495667_0050042 | Ga0495667_0050042_79_1032 | 316 |
| 380 | 3300046663 | Ga0495635_0008722 | Ga0495635_0008722_6044_6997 | 316 |
| 381 | 3300046675 | Ga0495657_0014917 | Ga0495657_0014917_3884_4837 | 316 |
| 382 | 3300046675 | Ga0495657_0045523 | Ga0495657_0045523_45_998 | 316 |
| 383 | 3300046678 | Ga0495599_0053763 | Ga0495599_0053763_948_1901 | 316 |
| 384 | 3300046679 | Ga0495623_0087283 | Ga0495623_0087283_816_1775 | 316 |
| 385 | 3300046680 | Ga0495646_0012198 | Ga0495646_0012198_4018_4971 | 316 |
| 386 | 3300046689 | Ga0495613_0002329 | Ga0495613_0002329_1747_2700 | 316 |
| 387 | 3300046689 | Ga0495613_0050954 | Ga0495613_0050954_50_1003 | 316 |
| 388 | 3300046689 | Ga0495613_0116494 | Ga0495613_0116494_511_1464 | 316 |
| 389 | 3300047315 | Ga0495581_0020780 | Ga0495581_0020780_2827_3780 | 316 |
| 390 | 3300047317 | Ga0495604_0000216 | Ga0495604_0000216_46753_47706 | 316 |
| 391 | 3300047317 | Ga0495604_0021804 | Ga0495604_0021804_45_998 | 316 |
| 392 | 3300047317 | Ga0495604_0299046 | Ga0495604_0299046_86_1039 | 316 |
| 393 | 3300047319 | Ga0495674_0002673 | Ga0495674_0002673_11661_12614 | 316 |
| 394 | 3300047321 | Ga0495676_0031407 | Ga0495676_0031407_1405_2358 | 316 |
| 395 | 3300047444 | Ga0495675_0034732 | Ga0495675_0034732_2238_3191 | 316 |
| 396 | 3300048088 | Ga0495602_0074274 | Ga0495602_0074274_1076_2029 | 316 |
| 397 | 3300049568 | Ga0501031_0013765 | Ga0501031_0013765_1061_2014 | 316 |
| 398 | 3300049569 | Ga0501032_0002157 | Ga0501032_0002157_11293_12246 | 316 |
| 399 | 3300049569 | Ga0501032_0028281 | Ga0501032_0028281_638_1591 | 316 |
| 400 | 3300049570 | Ga0501033_0029993 | Ga0501033_0029993_2178_3131 | 316 |
| 401 | 3300049570 | Ga0501033_0035959 | Ga0501033_0035959_1651_2604 | 316 |
| 402 | 3300049570 | Ga0501033_0050003 | Ga0501033_0050003_1980_2933 | 316 |
| 403 | 3300049571 | Ga0501034_0009005 | Ga0501034_0009005_3260_4213 | 316 |
| 404 | 3300049571 | Ga0501034_0037215 | Ga0501034_0037215_672_1625 | 316 |
| 405 | 3300049572 | Ga0501036_0017828 | Ga0501036_0017828_3014_3967 | 316 |
| 406 | 3300049572 | Ga0501036_0030117 | Ga0501036_0030117_2079_3032 | 316 |
| 407 | 3300049572 | Ga0501036_0126835 | Ga0501036_0126835_223_1176 | 316 |
| 408 | 3300049573 | Ga0501037_0004888 | Ga0501037_0004888_6690_7643 | 316 |
| 409 | 3300049573 | Ga0501037_0034377 | Ga0501037_0034377_1471_2424 | 316 |
| 410 | 3300049573 | Ga0501037_0141391 | Ga0501037_0141391_485_1438 | 316 |
| 411 | 3300049574 | Ga0501038_0022596 | Ga0501038_0022596_2079_3032 | 316 |
| 412 | 3300049574 | Ga0501038_0033572 | Ga0501038_0033572_3344_4297 | 316 |
| 413 | 3300049574 | Ga0501038_0036163 | Ga0501038_0036163_1795_2748 | 316 |
| 414 | 3300049574 | Ga0501038_0178666 | Ga0501038_0178666_721_1674 | 316 |
| 415 | 3300049575 | Ga0501039_0092640 | Ga0501039_0092640_365_1318 | 316 |
| 416 | 3300049576 | Ga0501040_0006671 | Ga0501040_0006671_6004_6957 | 316 |
| 417 | 3300049577 | Ga0501041_0009101 | Ga0501041_0009101_3515_4468 | 316 |
| 418 | 3300049578 | Ga0501042_0037421 | Ga0501042_0037421_798_1751 | 316 |
| 419 | 3300049578 | Ga0501042_0106903 | Ga0501042_0106903_25_978 | 316 |
| 420 | 3300049579 | Ga0501043_0000952 | Ga0501043_0000952_14715_15668 | 316 |
| 421 | 3300049580 | Ga0501046_0008376 | Ga0501046_0008376_2076_3029 | 316 |
| 422 | 3300049581 | Ga0501047_0000261 | Ga0501047_0000261_39268_40221 | 316 |
| 423 | 3300049581 | Ga0501047_0000547 | Ga0501047_0000547_7618_8571 | 316 |
| 424 | 3300049581 | Ga0501047_0029622 | Ga0501047_0029622_3313_4317 | 316 |
| 425 | 3300049581 | Ga0501047_0036940 | Ga0501047_0036940_1475_2428 | 316 |
| 426 | 3300049581 | Ga0501047_0058535 | Ga0501047_0058535_2234_3187 | 316 |
| 427 | 3300049583 | Ga0501067_0001659 | Ga0501067_0001659_3515_4468 | 316 |
| 428 | 3300049584 | Ga0501068_0001603 | Ga0501068_0001603_7835_8788 | 316 |
| 429 | 3300049586 | Ga0501070_0054657 | Ga0501070_0054657_1375_2328 | 316 |
| 430 | 3300049587 | Ga0501071_0009745 | Ga0501071_0009745_1976_2929 | 316 |
| 431 | 3300049589 | Ga0501073_0038136 | Ga0501073_0038136_1456_2409 | 316 |
| 432 | 3300049592 | Ga0501076_0137846 | Ga0501076_0137846_216_1169 | 316 |
| 433 | 3300049741 | Ga0501079_0012317 | Ga0501079_0012317_3468_4421 | 316 |
| 434 | 3300049742 | Ga0501080_0117664 | Ga0501080_0117664_798_1751 | 316 |
| 435 | 3300049744 | Ga0501083_0005717 | Ga0501083_0005717_71_1024 | 316 |
| 436 | 3300049822 | Ga0501035_0003878 | Ga0501035_0003878_5702_6655 | 316 |
| 437 | 3300049822 | Ga0501035_0013704 | Ga0501035_0013704_596_1549 | 316 |
| 438 | 3300049823 | Ga0501044_0017091 | Ga0501044_0017091_3163_4116 | 316 |
| 439 | 3300049823 | Ga0501044_0033101 | Ga0501044_0033101_699_1652 | 316 |
| 440 | 3300049823 | Ga0501044_0066204 | Ga0501044_0066204_938_1891 | 316 |
| 441 | 3300050507 | nmdc:mga05p37_9413_c1 | nmdc:mga05p37_9413_c1_1652_2605 | 316 |
| 442 | 3300050508 | nmdc:mga09592_62259_c1 | nmdc:mga09592_62259_c1_133_1086 | 316 |
| 443 | 3300053077 | Ga0495601_0111260 | Ga0495601_0111260_765_1718 | 316 |
| 444 | 3300053090 | Ga0500646_0000042 | Ga0500646_0000042_28471_29424 | 316 |
| 445 | 3300002067 | JGI24735J21928_10008106 | JGI24735J21928_100081063 | 317 |
| 446 | 3300005327 | Ga0070658_10149554 | Ga0070658_101495542 | 317 |
| 447 | 3300005328 | Ga0070676_10016946 | Ga0070676_100169464 | 317 |
| 448 | 3300005331 | Ga0070670_100003853 | Ga0070670_1000038536 | 317 |
| 449 | 3300005334 | Ga0068869_100002225 | Ga0068869_1000022252 | 317 |
| 450 | 3300005335 | Ga0070666_10078019 | Ga0070666_100780193 | 317 |
| 451 | 3300005336 | Ga0070680_100140990 | Ga0070680_1001409902 | 317 |
| 452 | 3300005337 | Ga0070682_100099709 | Ga0070682_1000997091 | 317 |
| 453 | 3300005338 | Ga0068868_100002416 | Ga0068868_10000241610 | 317 |
| 454 | 3300005339 | Ga0070660_100073883 | Ga0070660_1000738831 | 317 |
| 455 | 3300005340 | Ga0070689_100195733 | Ga0070689_1001957331 | 317 |
| 456 | 3300005341 | Ga0070691_10003548 | Ga0070691_100035485 | 317 |
| 457 | 3300005345 | Ga0070692_10025409 | Ga0070692_100254093 | 317 |
| 458 | 3300005354 | Ga0070675_100036729 | Ga0070675_1000367294 | 317 |
| 459 | 3300005355 | Ga0070671_100015608 | Ga0070671_1000156081 | 317 |
| 460 | 3300005364 | Ga0070673_100090496 | Ga0070673_1000904962 | 317 |
| 461 | 3300005434 | Ga0070709_10036390 | Ga0070709_100363902 | 317 |
| 462 | 3300005436 | Ga0070713_100070019 | Ga0070713_1000700193 | 317 |
| 463 | 3300005437 | Ga0070710_10000271 | Ga0070710_1000027114 | 317 |
| 464 | 3300005437 | Ga0070710_10029817 | Ga0070710_100298172 | 317 |
| 465 | 3300005441 | Ga0070700_100169288 | Ga0070700_1001692882 | 317 |
| 466 | 3300005455 | Ga0070663_100002860 | Ga0070663_1000028602 | 317 |
| 467 | 3300005456 | Ga0070678_100002873 | Ga0070678_1000028732 | 317 |
| 468 | 3300005458 | Ga0070681_10020771 | Ga0070681_100207714 | 317 |
| 469 | 3300005466 | Ga0070685_10033859 | Ga0070685_100338591 | 317 |
| 470 | 3300005530 | Ga0070679_100022494 | Ga0070679_1000224942 | 317 |
| 471 | 3300005547 | Ga0070693_100002484 | Ga0070693_1000024849 | 317 |
| 472 | 3300005548 | Ga0070665_100027256 | Ga0070665_1000272563 | 317 |
| 473 | 3300005563 | Ga0068855_100167154 | Ga0068855_1001671543 | 317 |
| 474 | 3300005564 | Ga0070664_100105592 | Ga0070664_1001055922 | 317 |
| 475 | 3300005614 | Ga0068856_100007435 | Ga0068856_1000074356 | 317 |
| 476 | 3300005615 | Ga0070702_100001869 | Ga0070702_1000018692 | 317 |
| 477 | 3300005616 | Ga0068852_100039516 | Ga0068852_1000395164 | 317 |
| 478 | 3300005618 | Ga0068864_100248548 | Ga0068864_1002485482 | 317 |
| 479 | 3300005841 | Ga0068863_100016289 | Ga0068863_1000162892 | 317 |
| 480 | 3300005841 | Ga0068863_100033462 | Ga0068863_1000334624 | 317 |
| 481 | 3300005842 | Ga0068858_100105978 | Ga0068858_1001059782 | 317 |
| 482 | 3300006058 | Ga0075432_10018453 | Ga0075432_100184532 | 317 |
| 483 | 3300006358 | Ga0068871_100011522 | Ga0068871_1000115225 | 317 |
| 484 | 3300006847 | Ga0075431_100063053 | Ga0075431_1000630535 | 317 |
| 485 | 3300006852 | Ga0075433_10150727 | Ga0075433_101507272 | 317 |
| 486 | 3300006871 | Ga0075434_100012093 | Ga0075434_1000120939 | 317 |
| 487 | 3300006914 | Ga0075436_100029586 | Ga0075436_1000295862 | 317 |
| 488 | 3300007076 | Ga0075435_100000815 | Ga0075435_10000081519 | 317 |
| 489 | 3300009011 | Ga0105251_10050701 | Ga0105251_100507012 | 317 |
| 490 | 3300009093 | Ga0105240_10129707 | Ga0105240_101297072 | 317 |
| 491 | 3300009098 | Ga0105245_10060811 | Ga0105245_100608115 | 317 |
| 492 | 3300009147 | Ga0114129_10166952 | Ga0114129_101669521 | 317 |
| 493 | 3300009148 | Ga0105243_10612658 | Ga0105243_106126581 | 317 |
| 494 | 3300009174 | Ga0105241_10003029 | Ga0105241_100030299 | 317 |
| 495 | 3300009177 | Ga0105248_10082167 | Ga0105248_100821674 | 317 |
| 496 | 3300009545 | Ga0105237_10153808 | Ga0105237_101538082 | 317 |
| 497 | 3300009551 | Ga0105238_10027344 | Ga0105238_100273447 | 317 |
| 498 | 3300010375 | Ga0105239_10228790 | Ga0105239_102287901 | 317 |
| 499 | 3300011119 | Ga0105246_10001085 | Ga0105246_1000108515 | 317 |
| 500 | 3300013104 | Ga0157370_10140191 | Ga0157370_101401912 | 317 |
| 501 | 3300013105 | Ga0157369_10438335 | Ga0157369_104383352 | 317 |
| 502 | 3300013296 | Ga0157374_10188364 | Ga0157374_101883642 | 317 |
| 503 | 3300013308 | Ga0157375_10036375 | Ga0157375_100363751 | 317 |
| 504 | 3300014325 | Ga0163163_10143792 | Ga0163163_101437923 | 317 |
| 505 | 3300014745 | Ga0157377_10060511 | Ga0157377_100605112 | 317 |
| 506 | 3300020082 | Ga0206353_10182179 | Ga0206353_101821792 | 317 |
| 507 | 3300025735 | Ga0207713_1052834 | Ga0207713_10528341 | 317 |
| 508 | 3300025898 | Ga0207692_10000110 | Ga0207692_1000011017 | 317 |
| 509 | 3300025898 | Ga0207692_10039479 | Ga0207692_100394793 | 317 |
| 510 | 3300025900 | Ga0207710_10040903 | Ga0207710_100409032 | 317 |
| 511 | 3300025906 | Ga0207699_10109962 | Ga0207699_101099622 | 317 |
| 512 | 3300025908 | Ga0207643_10000125 | Ga0207643_1000012544 | 317 |
| 513 | 3300025909 | Ga0207705_10028217 | Ga0207705_100282174 | 317 |
| 514 | 3300025911 | Ga0207654_10063063 | Ga0207654_100630632 | 317 |
| 515 | 3300025914 | Ga0207671_10131395 | Ga0207671_101313952 | 317 |
| 516 | 3300025917 | Ga0207660_10017794 | Ga0207660_100177944 | 317 |
| 517 | 3300025919 | Ga0207657_10035210 | Ga0207657_100352104 | 317 |
| 518 | 3300025921 | Ga0207652_10066100 | Ga0207652_100661004 | 317 |
| 519 | 3300025924 | Ga0207694_10203102 | Ga0207694_102031021 | 317 |
| 520 | 3300025925 | Ga0207650_10005762 | Ga0207650_100057622 | 317 |
| 521 | 3300025927 | Ga0207687_10048994 | Ga0207687_100489943 | 317 |
| 522 | 3300025932 | Ga0207690_10135985 | Ga0207690_101359852 | 317 |
| 523 | 3300025941 | Ga0207711_10194299 | Ga0207711_101942992 | 317 |
| 524 | 3300025942 | Ga0207689_10000198 | Ga0207689_1000019835 | 317 |
| 525 | 3300025944 | Ga0207661_10003247 | Ga0207661_1000324712 | 317 |
| 526 | 3300025945 | Ga0207679_10121514 | Ga0207679_101215142 | 317 |
| 527 | 3300025949 | Ga0207667_10067350 | Ga0207667_100673504 | 317 |
| 528 | 3300025960 | Ga0207651_10044129 | Ga0207651_100441294 | 317 |
| 529 | 3300025981 | Ga0207640_10151067 | Ga0207640_101510672 | 317 |
| 530 | 3300026023 | Ga0207677_10023483 | Ga0207677_100234832 | 317 |
| 531 | 3300026067 | Ga0207678_10000141 | Ga0207678_1000014118 | 317 |
| 532 | 3300026075 | Ga0207708_10209491 | Ga0207708_102094912 | 317 |
| 533 | 3300026078 | Ga0207702_10006992 | Ga0207702_100069929 | 317 |
| 534 | 3300026078 | Ga0207702_10012008 | Ga0207702_100120088 | 317 |
| 535 | 3300026088 | Ga0207641_10026463 | Ga0207641_100264634 | 317 |
| 536 | 3300026089 | Ga0207648_10193459 | Ga0207648_101934591 | 317 |
| 537 | 3300026095 | Ga0207676_10001346 | Ga0207676_1000134616 | 317 |
| 538 | 3300026118 | Ga0207675_100111926 | Ga0207675_1001119263 | 317 |
| 539 | 3300026121 | Ga0207683_10000172 | Ga0207683_1000017238 | 317 |
| 540 | 3300026142 | Ga0207698_10025915 | Ga0207698_100259152 | 317 |
| 541 | 3300028381 | Ga0268264_10023387 | Ga0268264_100233875 | 317 |
| 542 | 3300030731 | Ga0316177_1042586 | Ga0316177_10425864 | 317 |
| 543 | 3300030736 | Ga0316180_1004638 | Ga0316180_10046382 | 317 |
| 544 | 3300031838 | Ga0307518_10000036 | Ga0307518_1000003678 | 317 |
| 545 | 3300042016 | Ga0439463_045454 | Ga0439463_045454_93_1049 | 317 |
| 546 | 3300042438 | Ga0439459_0038488 | Ga0439459_0038488_22_978 | 317 |
| 547 | 3300044683 | Ga0466965_0034703 | Ga0466965_0034703_1084_2055 | 317 |
| 548 | 3300044693 | Ga0466961_0030290 | Ga0466961_0030290_2470_3423 | 317 |
| 549 | 3300048903 | Ga0496100_0038504 | Ga0496100_0038504_1634_2590 | 317 |
| 550 | 3300048904 | Ga0496101_0043891 | Ga0496101_0043891_743_1699 | 317 |
| 551 | 3300048905 | Ga0496102_0063027 | Ga0496102_0063027_1153_2109 | 317 |
| 552 | 3300048907 | Ga0496104_0065527 | Ga0496104_0065527_857_1813 | 317 |
| 553 | 3300048908 | Ga0496105_0004008 | Ga0496105_0004008_9308_10264 | 317 |
| 554 | 3300048909 | Ga0496106_0002994 | Ga0496106_0002994_9180_10136 | 317 |
| 555 | 3300048911 | Ga0496108_0026932 | Ga0496108_0026932_1870_2826 | 317 |
| 556 | 3300048912 | Ga0496109_0053866 | Ga0496109_0053866_796_1752 | 317 |
| 557 | 3300048913 | Ga0496110_0019503 | Ga0496110_0019503_850_1806 | 317 |
| 558 | 3300048913 | Ga0496110_0074130 | Ga0496110_0074130_1356_2312 | 317 |
| 559 | 3300048914 | Ga0496111_0042508 | Ga0496111_0042508_1939_2895 | 317 |
| 560 | 3300048914 | Ga0496111_0149551 | Ga0496111_0149551_649_1605 | 317 |
| 561 | 3300048916 | Ga0496113_0038427 | Ga0496113_0038427_645_1601 | 317 |
| 562 | 3300048917 | Ga0496114_0161347 | Ga0496114_0161347_927_1883 | 317 |
| 563 | 3300048918 | Ga0496115_0165275 | Ga0496115_0165275_62_1018 | 317 |
| 564 | 3300050508 | nmdc:mga09592_286195_c1 | nmdc:mga09592_286195_c1_48_1004 | 317 |
| 565 | 3300050511 | nmdc:mga08y16_11879_c1 | nmdc:mga08y16_11879_c1_450_1406 | 317 |
| 566 | 3300050512 | nmdc:mga0n895_501_c1 | nmdc:mga0n895_501_c1_15039_15995 | 317 |
| 567 | 3300050513 | nmdc:mga0rr50_78481_c1 | nmdc:mga0rr50_78481_c1_911_1867 | 317 |
| 568 | 3300050514 | nmdc:mga08x19_22229_c1 | nmdc:mga08x19_22229_c1_783_1739 | 317 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1iyz-assembly1.cif.gz_A-2 | crystal structures of the quinone oxidoreductase from thermus thermophilus hb8 and its complex with nadph | 0.9276 | 1 | 315 |
| 4rvu-assembly2.cif.gz_C | the native structure of mycobacterial rv1454c complexed with nadph | 0.926 | 1 | 315 |
| 4rvu-assembly2.cif.gz_B | the native structure of mycobacterial rv1454c complexed with nadph | 0.9251 | 1 | 315 |
| 1iyz-assembly1.cif.gz_A-2 | crystal structures of the quinone oxidoreductase from thermus thermophilus hb8 and its complex with nadph | 0.9247 | 1 | 315 |
| 4rvu-assembly1.cif.gz_D | the native structure of mycobacterial rv1454c complexed with nadph | 0.923 | 1 | 315 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_B0BNC9_26_350_3.90.180.10 | Alpha Beta;Alpha-Beta Complex;Quinone Oxidoreductase; Chain A, domain 1;Medium-chain alcohol dehydrogenases, catalytic domain | 0.9391 | 2 | 314 | 3.90.180.10 |
| af_I1LVH0_176_320_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9381 | 114 | 258 | 3.40.50.720 |
| af_Q08257_129_296_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9353 | 112 | 283 | 3.40.50.720 |
| af_B0BNC9_147_315_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9336 | 115 | 280 | 3.40.50.720 |
| af_Q3UNZ8_155_284_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.926 | 125 | 250 | 3.40.50.720 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A1H6CWX0-F1-model_v4 | NADPH2:quinone reductase | 0.9838 | 1 | 317 |
GO:0016491
|
| AF-A0A6J4PZM8-F1-model_v4 | Alcohol dehydrogenase-like C-terminal domain-containing protein | 0.9543 | 134 | 254 |
GO:0016491
|
| AF-A0A2S7MY95-F1-model_v4 | Alcohol dehydrogenase | 0.9542 | 1 | 317 |
GO:0003960
GO:0005829 GO:0035925 GO:0070402 |
| AF-A0A2S7MY95-F1-model_v4 | Alcohol dehydrogenase | 0.9513 | 1 | 317 |
GO:0003960
GO:0005829 GO:0035925 GO:0070402 |
| AF-A0A399DWR7-F1-model_v4 | 2-haloacrylate reductase (EC 1.3.1.103) | 0.9499 | 134 | 315 |
GO:0102523
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar