F464518

General Info

Members Datasets Scaffolds Average Seq Length
567 231 1134 259

Family's Representative Sequence

Representative Sequence 3300025922|Ga0207646_10071800|Ga0207646_100718002
Length 308
Sequence LAGIQSTRPERRQPNRGSDGTLLPCRVTAAAPPWASAGPGDGGARTPGAQSPLAWVAFALTLIRPAFAAAQNPPPQPQGDYAPADIAYGARLYDAQCTTCHGANGDAVGGVNLRSGIFRNAITDQDLARVITNGIQGTGMQAFKFDAAELAGIIAYIRNMNSFDRGSAKLGDAGRGETLFTGKGGCTRCHRVGAQGSRVAPDLSDIGATRSAGSLLRSLTDPTSQMMPINRPVRAVLRDGKVVNGRRLNEDTYTVQLIDDQEKLVSLTKSELREYTILTASPMPAFKGTLGPDELADVVAYLLSLKGR

Samples

Sample ID Description Type Environment
1 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
14 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
15 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
16 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
17 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
18 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
19 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
20 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
21 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
22 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
23 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
24 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
25 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
26 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
27 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
28 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
29 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
30 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
31 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
32 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
33 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
34 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
35 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
36 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
37 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
38 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
39 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
40 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
41 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
42 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
43 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
44 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
45 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
46 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
47 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
48 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
49 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
50 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
51 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
52 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
53 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
54 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
55 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
56 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
57 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
58 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
59 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
60 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
61 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
62 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
63 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
64 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
65 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
66 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
67 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
68 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
69 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
70 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
71 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
72 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
73 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
74 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
75 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
76 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
77 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
78 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
79 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
80 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
81 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
82 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
83 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
84 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
85 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
86 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
87 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
88 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
89 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
90 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
91 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
92 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
93 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
94 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
95 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
134 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
137 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
138 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
139 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
140 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
141 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
142 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
143 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
144 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
145 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
146 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
147 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
148 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
149 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
150 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
151 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
152 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
153 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
154 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
155 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
156 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
157 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
158 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
159 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
160 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
161 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
162 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
163 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
164 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
165 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
166 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
167 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
168 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
169 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
170 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
171 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
172 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
173 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
174 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
175 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
176 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
177 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
178 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
179 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
180 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
181 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
182 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
183 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
184 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
185 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
186 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
187 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
188 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
189 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
190 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
191 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
192 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
193 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
194 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
195 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
196 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
197 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
198 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
199 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
200 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
201 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
202 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
203 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
204 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
205 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
206 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
207 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
208 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
209 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
210 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
211 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
212 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
213 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
214 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
215 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
216 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
217 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
218 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
219 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
220 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
221 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
222 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
223 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
224 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
225 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
226 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
227 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
228 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
229 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
230 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
231 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.18
Nodule 0
Rhizoplane 1.76
Rhizosphere 97.88
Stem 0
Stem Tuber 0
Unclassified 14.99

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207646_10071800 3300025922 Bacteria 3092
2 JGI25406J46586_10000213 3300003203 Bacteria 25628
3 JGI25406J46586_10015184 3300003203 Unclassified 3253
4 Ga0065712_10085559 3300005290 Bacteria 2690
5 Ga0065715_10113521 3300005293 Bacteria 2486
6 Ga0065707_10001222 3300005295 Bacteria 9734
7 Ga0070676_10038479 3300005328 Bacteria 2763
8 Ga0070676_10066716 3300005328 Bacteria 2150
9 Ga0070676_10179290 3300005328 Unclassified 1376
10 Ga0070690_100002407 3300005330 Bacteria 10050
11 Ga0070690_100019539 3300005330 Bacteria 4114
12 Ga0070690_100027737 3300005330 Unclassified 3502
13 Ga0070670_100026806 3300005331 Unclassified 4957
14 Ga0070677_10012269 3300005333 Bacteria 2974
15 Ga0068869_100044333 3300005334 Unclassified 3198
16 Ga0070666_10008205 3300005335 Bacteria 6472
17 Ga0070666_10026271 3300005335 Bacteria 3802
18 Ga0070666_10086914 3300005335 Bacteria 2143
19 Ga0070666_10111010 3300005335 Bacteria 1896
20 Ga0068868_100116352 3300005338 Bacteria 2177
21 Ga0068868_100270102 3300005338 Unclassified 1436
22 Ga0070689_100011352 3300005340 Bacteria 6378
23 Ga0070689_100013955 3300005340 Bacteria 5828
24 Ga0070689_100077095 3300005340 Unclassified 2612
25 Ga0070689_100744448 3300005340 Bacteria 859
26 Ga0070691_10014870 3300005341 Bacteria 3573
27 Ga0070687_100048916 3300005343 Bacteria 2176
28 Ga0070668_100169588 3300005347 Bacteria 1776
29 Ga0070669_100010525 3300005353 Bacteria 6569
30 Ga0070669_100034405 3300005353 Bacteria 3668
31 Ga0070669_100147542 3300005353 Bacteria 1818
32 Ga0070669_100177705 3300005353 Bacteria 1663
33 Ga0070669_100435648 3300005353 Unclassified 1078
34 Ga0070675_100000928 3300005354 Bacteria 20847
35 Ga0070675_100015575 3300005354 Bacteria 6014
36 Ga0070675_100021857 3300005354 Bacteria 5111
37 Ga0070675_100029726 3300005354 Bacteria 4409
38 Ga0070675_100063896 3300005354 Bacteria 3043
39 Ga0070675_100073836 3300005354 Bacteria 2832
40 Ga0070675_100093835 3300005354 Unclassified 2517
41 Ga0070675_100296410 3300005354 Bacteria 1424
42 Ga0070671_100006676 3300005355 Bacteria 9228
43 Ga0070671_100018780 3300005355 Bacteria 5619
44 Ga0070671_100027861 3300005355 Bacteria 4651
45 Ga0070671_100275387 3300005355 Bacteria 1430
46 Ga0070674_100004335 3300005356 Bacteria 8087
47 Ga0070674_100037580 3300005356 Unclassified 3257
48 Ga0070674_100116205 3300005356 Bacteria 1974
49 Ga0070674_100377939 3300005356 Bacteria 1152
50 Ga0070673_100036889 3300005364 Bacteria 3721
51 Ga0070673_100049430 3300005364 Bacteria 3284
52 Ga0070673_100092060 3300005364 Bacteria 2479
53 Ga0070673_100097744 3300005364 Bacteria 2411
54 Ga0070673_100235993 3300005364 Bacteria 1588
55 Ga0070688_100037082 3300005365 Bacteria 2969
56 Ga0070659_100193545 3300005366 Unclassified 1672
57 Ga0070667_100043545 3300005367 Bacteria 3768
58 Ga0070667_100051619 3300005367 Bacteria 3468
59 Ga0070703_10087903 3300005406 Bacteria 1072
60 Ga0070701_10003349 3300005438 Bacteria 6329
61 Ga0070701_10029230 3300005438 Bacteria 2716
62 Ga0070701_10032273 3300005438 Bacteria 2607
63 Ga0070705_100014630 3300005440 Bacteria 4042
64 Ga0070705_100020338 3300005440 Unclassified 3511
65 Ga0070705_100133940 3300005440 Unclassified 1620
66 Ga0070700_100043078 3300005441 Bacteria 2775
67 Ga0070700_100257022 3300005441 Bacteria 1256
68 Ga0070694_100100102 3300005444 Bacteria 2049
69 Ga0070694_100169011 3300005444 Bacteria 1609
70 Ga0070694_100394216 3300005444 Bacteria 1082
71 Ga0070708_100355708 3300005445 Bacteria 1380
72 Ga0070708_100432648 3300005445 Unclassified 1241
73 Ga0070678_100066375 3300005456 Bacteria 2682
74 Ga0070678_100073928 3300005456 Unclassified 2560
75 Ga0070678_100702921 3300005456 Unclassified 911
76 Ga0070662_100053997 3300005457 Bacteria 2911
77 Ga0070662_100307115 3300005457 Unclassified 1290
78 Ga0068867_100001682 3300005459 Bacteria 15425
79 Ga0068867_100003832 3300005459 Bacteria 10568
80 Ga0068867_100087080 3300005459 Unclassified 2364
81 Ga0070685_10238633 3300005466 Bacteria 1199
82 Ga0070706_100180286 3300005467 Unclassified 1972
83 Ga0070706_100261578 3300005467 Bacteria 1615
84 Ga0070706_100281127 3300005467 Bacteria 1553
85 Ga0070707_100129730 3300005468 Unclassified 2451
86 Ga0070707_100360716 3300005468 Bacteria 1412
87 Ga0070699_100001131 3300005518 Bacteria 24837
88 Ga0070699_100018143 3300005518 Bacteria 6046
89 Ga0070699_100222846 3300005518 Bacteria 1681
90 Ga0070684_100106298 3300005535 Bacteria 2512
91 Ga0070697_100066354 3300005536 Bacteria 2951
92 Ga0070697_100078630 3300005536 Bacteria 2714
93 Ga0070697_100400679 3300005536 Bacteria 1190
94 Ga0068853_100492213 3300005539 Bacteria 1157
95 Ga0070672_100003783 3300005543 Bacteria 9850
96 Ga0070672_100012052 3300005543 Bacteria 6051
97 Ga0070672_100175733 3300005543 Bacteria 1783
98 Ga0070672_100263379 3300005543 Unclassified 1454
99 Ga0070672_100485134 3300005543 Bacteria 1068
100 Ga0070686_100008654 3300005544 Bacteria 5703
101 Ga0070686_100163434 3300005544 Unclassified 1569
102 Ga0070686_100311432 3300005544 Bacteria 1171
103 Ga0070695_100127863 3300005545 Bacteria 1747
104 Ga0070695_100308859 3300005545 Bacteria 1172
105 Ga0070696_100074709 3300005546 Bacteria 2390
106 Ga0070696_100099591 3300005546 Bacteria 2080
107 Ga0070696_100448886 3300005546 Bacteria 1017
108 Ga0070693_100348245 3300005547 Unclassified 1013
109 Ga0070665_100001968 3300005548 Bacteria 23101
110 Ga0070665_100058920 3300005548 Bacteria 3849
111 Ga0070665_100227428 3300005548 Bacteria 1865
112 Ga0070704_100009477 3300005549 Bacteria 5885
113 Ga0070704_100063190 3300005549 Bacteria 2657
114 Ga0070704_100235676 3300005549 Unclassified 1495
115 Ga0068854_100001377 3300005578 Bacteria 14634
116 Ga0068854_100032562 3300005578 Bacteria 3628
117 Ga0068854_100266103 3300005578 Unclassified 1374
118 Ga0070702_100002450 3300005615 Bacteria 8013
119 Ga0070702_100063218 3300005615 Bacteria 2160
120 Ga0070702_100124859 3300005615 Bacteria 1617
121 Ga0068859_100076502 3300005617 Bacteria 3388
122 Ga0068859_100212581 3300005617 Unclassified 2021
123 Ga0068859_100256560 3300005617 Bacteria 1839
124 Ga0068859_100992900 3300005617 Bacteria 922
125 Ga0068864_100059159 3300005618 Bacteria 3315
126 Ga0068864_100186898 3300005618 Bacteria 1897
127 Ga0068864_100219742 3300005618 Bacteria 1753
128 Ga0068864_100262937 3300005618 Bacteria 1606
129 Ga0068866_10019886 3300005718 Bacteria 3066
130 Ga0068861_100008276 3300005719 Bacteria 7154
131 Ga0068861_100011523 3300005719 Bacteria 6150
132 Ga0068861_100014123 3300005719 Bacteria 5600
133 Ga0068861_100058810 3300005719 Bacteria 2941
134 Ga0068861_100649201 3300005719 Bacteria 974
135 Ga0068851_10005077 3300005834 Bacteria 5971
136 Ga0068851_10039262 3300005834 Bacteria 2377
137 Ga0068870_10028887 3300005840 Bacteria 2789
138 Ga0068870_10246758 3300005840 Bacteria 1105
139 Ga0068870_10304229 3300005840 Bacteria 1007
140 Ga0068863_100000867 3300005841 Bacteria 30266
141 Ga0068863_100441012 3300005841 Bacteria 1277
142 Ga0068863_100461825 3300005841 Unclassified 1247
143 Ga0068858_100013632 3300005842 Bacteria 7672
144 Ga0068858_100122908 3300005842 Bacteria 2429
145 Ga0068858_100175905 3300005842 Bacteria 2019
146 Ga0068858_100301332 3300005842 Bacteria 1529
147 Ga0068858_100521938 3300005842 Unclassified 1148
148 Ga0068860_100044254 3300005843 Bacteria 4243
149 Ga0068860_100207219 3300005843 Bacteria 1902
150 Ga0068860_100359842 3300005843 Bacteria 1433
151 Ga0068860_100388217 3300005843 Unclassified 1379
152 Ga0068860_100841820 3300005843 Bacteria 932
153 Ga0068862_100001070 3300005844 Bacteria 26230
154 Ga0068862_100151342 3300005844 Unclassified 2065
155 Ga0068862_100165554 3300005844 Bacteria 1976
156 Ga0068862_100170403 3300005844 Bacteria 1949
157 Ga0081455_10097859 3300005937 Bacteria 2363
158 Ga0081539_10000010 3300005985 Bacteria 484386
159 Ga0081539_10000065 3300005985 Bacteria 246571
160 Ga0097621_100000475 3300006237 Bacteria 28177
161 Ga0097621_100005930 3300006237 Bacteria 8634
162 Ga0097621_100018545 3300006237 Bacteria 5319
163 Ga0068871_100001753 3300006358 Bacteria 14628
164 Ga0068871_100012166 3300006358 Bacteria 6335
165 Ga0068871_100088804 3300006358 Bacteria 2572
166 Ga0068871_100271425 3300006358 Bacteria 1482
167 Ga0068871_100707117 3300006358 Bacteria 923
168 Ga0075428_100000005 3300006844 Bacteria 326130
169 Ga0075428_100042849 3300006844 Bacteria 4976
170 Ga0075428_100218826 3300006844 Bacteria 2057
171 Ga0075428_100490806 3300006844 Bacteria 1314
172 Ga0075430_100035081 3300006846 Bacteria 4258
173 Ga0075430_100093913 3300006846 Bacteria 2508
174 Ga0075430_100135853 3300006846 Bacteria 2049
175 Ga0075431_100131220 3300006847 Bacteria 2584
176 Ga0075431_100350291 3300006847 Bacteria 1485
177 Ga0075433_10048481 3300006852 Bacteria 3693
178 Ga0075433_10086852 3300006852 Bacteria 2762
179 Ga0075433_10230609 3300006852 Bacteria 1644
180 Ga0075433_10239715 3300006852 Bacteria 1610
181 Ga0075433_10420771 3300006852 Unclassified 1178
182 Ga0075434_100000085 3300006871 Bacteria 50753
183 Ga0075434_100016194 3300006871 Bacteria 7166
184 Ga0075434_100019913 3300006871 Bacteria 6498
185 Ga0075434_100032572 3300006871 Bacteria 5140
186 Ga0075434_100171390 3300006871 Bacteria 2190
187 Ga0075434_100339766 3300006871 Bacteria 1522
188 Ga0075434_100380624 3300006871 Unclassified 1432
189 Ga0075434_100674854 3300006871 Bacteria 1051
190 Ga0075429_100302313 3300006880 Bacteria 1401
191 Ga0068865_100015637 3300006881 Bacteria 4841
192 Ga0068865_100026477 3300006881 Bacteria 3824
193 Ga0068865_100172754 3300006881 Bacteria 1658
194 Ga0068865_100268246 3300006881 Bacteria 1354
195 Ga0075436_100005853 3300006914 Bacteria 8446
196 Ga0075436_100021104 3300006914 Bacteria 4469
197 Ga0075436_100036287 3300006914 Unclassified 3402
198 Ga0075436_100036357 3300006914 Bacteria 3399
199 Ga0075436_100039597 3300006914 Unclassified 3252
200 Ga0075436_100042599 3300006914 Bacteria 3131
201 Ga0097620_100063951 3300006931 Bacteria 3711
202 Ga0097620_100076504 3300006931 Bacteria 3388
203 Ga0097620_100212580 3300006931 Unclassified 2021
204 Ga0097620_100256533 3300006931 Bacteria 1839
205 Ga0097620_100992745 3300006931 Bacteria 922
206 Ga0075435_100000001 3300007076 Bacteria 207579
207 Ga0075435_100040282 3300007076 Bacteria 3730
208 Ga0075435_100045091 3300007076 Bacteria 3533
209 Ga0075435_100061492 3300007076 Bacteria 3047
210 Ga0075435_100071040 3300007076 Bacteria 2842
211 Ga0075435_100094246 3300007076 Bacteria 2474
212 Ga0075435_100104168 3300007076 Unclassified 2354
213 Ga0075435_100122881 3300007076 Unclassified 2167
214 Ga0075435_100150628 3300007076 Bacteria 1955
215 Ga0075435_100406432 3300007076 Bacteria 1171
216 Ga0099794_10168529 3300007265 Unclassified 1116
217 Ga0105240_10222535 3300009093 Bacteria 2198
218 Ga0105240_10603487 3300009093 Bacteria 1208
219 Ga0111539_10000008 3300009094 Bacteria 382609
220 Ga0111539_10004048 3300009094 Bacteria 19245
221 Ga0111539_10019249 3300009094 Bacteria 8431
222 Ga0111539_10051342 3300009094 Bacteria 4912
223 Ga0111539_10071142 3300009094 Bacteria 4105
224 Ga0111539_10395503 3300009094 Bacteria 1610
225 Ga0105245_10092208 3300009098 Bacteria 2789
226 Ga0105247_10084315 3300009101 Bacteria 2008
227 Ga0114129_10002348 3300009147 Bacteria 26266
228 Ga0114129_10007398 3300009147 Bacteria 15628
229 Ga0114129_10011978 3300009147 Bacteria 12336
230 Ga0114129_10019700 3300009147 Bacteria 9603
231 Ga0114129_10052703 3300009147 Bacteria 5710
232 Ga0114129_10132868 3300009147 Bacteria 3417
233 Ga0105243_10021764 3300009148 Bacteria 4869
234 Ga0105243_10040800 3300009148 Bacteria 3627
235 Ga0105243_10127454 3300009148 Unclassified 2155
236 Ga0105243_10310716 3300009148 Bacteria 1432
237 Ga0105243_10689806 3300009148 Bacteria 994
238 Ga0105242_10000986 3300009176 Bacteria 22256
239 Ga0105242_10012935 3300009176 Bacteria 6434
240 Ga0105242_10456614 3300009176 Bacteria 1205
241 Ga0105248_10007883 3300009177 Bacteria 11699
242 Ga0105248_10022182 3300009177 Bacteria 7039
243 Ga0105248_10115466 3300009177 Bacteria 3028
244 Ga0105248_10116465 3300009177 Unclassified 3014
245 Ga0105248_10257685 3300009177 Bacteria 1964
246 Ga0105248_10286025 3300009177 Bacteria 1856
247 Ga0105248_10323759 3300009177 Bacteria 1736
248 Ga0105248_10420341 3300009177 Bacteria 1505
249 Ga0105238_10002032 3300009551 Bacteria 20437
250 Ga0105249_10712546 3300009553 Unclassified 1064
251 Ga0105249_10855527 3300009553 Unclassified 975
252 Ga0105246_10023457 3300011119 Unclassified 3993
253 Ga0157374_10042160 3300013296 Bacteria 4209
254 Ga0157378_10256047 3300013297 Bacteria 1677
255 Ga0157378_10536534 3300013297 Bacteria 1173
256 Ga0157378_10572837 3300013297 Unclassified 1137
257 Ga0163162_10017597 3300013306 Bacteria 6993
258 Ga0163162_10269957 3300013306 Bacteria 1833
259 Ga0163162_10606165 3300013306 Bacteria 1221
260 Ga0163162_10949323 3300013306 Bacteria 971
261 Ga0157375_10028027 3300013308 Bacteria 5273
262 Ga0157375_10077978 3300013308 Bacteria 3345
263 Ga0157375_10427417 3300013308 Bacteria 1491
264 Ga0157375_10551139 3300013308 Bacteria 1315
265 Ga0157375_11004894 3300013308 Bacteria 974
266 Ga0163163_10020292 3300014325 Bacteria 6255
267 Ga0157380_10125208 3300014326 Bacteria 2183
268 Ga0157380_10179839 3300014326 Bacteria 1857
269 Ga0157380_10261357 3300014326 Bacteria 1573
270 Ga0157380_10434437 3300014326 Bacteria 1256
271 Ga0157380_10515722 3300014326 Unclassified 1165
272 Ga0157377_10049442 3300014745 Bacteria 2364
273 Ga0157377_10306215 3300014745 Unclassified 1050
274 Ga0157379_10053522 3300014968 Bacteria 3605
275 Ga0157379_10277280 3300014968 Bacteria 1525
276 Ga0157379_10308079 3300014968 Bacteria 1444
277 Ga0157376_10008351 3300014969 Bacteria 7469
278 Ga0157376_10080276 3300014969 Bacteria 2798
279 Ga0157376_10150414 3300014969 Bacteria 2099
280 Ga0157376_10491350 3300014969 Bacteria 1204
281 Ga0207656_10001898 3300025321 Bacteria 6955
282 Ga0207656_10076848 3300025321 Bacteria 1494
283 Ga0207682_10000468 3300025893 Bacteria 18679
284 Ga0207642_10006960 3300025899 Bacteria 3791
285 Ga0207642_10011739 3300025899 Bacteria 3137
286 Ga0207680_10024860 3300025903 Bacteria 3294
287 Ga0207680_10101708 3300025903 Bacteria 1848
288 Ga0207645_10001597 3300025907 Bacteria 18466
289 Ga0207645_10013540 3300025907 Bacteria 5492
290 Ga0207645_10014603 3300025907 Bacteria 5250
291 Ga0207645_10263596 3300025907 Bacteria 1142
292 Ga0207643_10078198 3300025908 Bacteria 1913
293 Ga0207643_10140511 3300025908 Bacteria 1442
294 Ga0207643_10271738 3300025908 Bacteria 1049
295 Ga0207695_10140791 3300025913 Bacteria 2361
296 Ga0207662_10012962 3300025918 Bacteria 4655
297 Ga0207662_10131375 3300025918 Bacteria 1579
298 Ga0207646_10086101 3300025922 Bacteria 2811
299 Ga0207646_10087011 3300025922 Bacteria 2796
300 Ga0207646_10113341 3300025922 Bacteria 2434
301 Ga0207646_10183657 3300025922 Bacteria 1889
302 Ga0207646_10246550 3300025922 Archaea 1613
303 Ga0207681_10053851 3300025923 Bacteria 2733
304 Ga0207681_10055979 3300025923 Unclassified 2689
305 Ga0207681_10213913 3300025923 Bacteria 1487
306 Ga0207694_10002253 3300025924 Bacteria 15805
307 Ga0207650_10065493 3300025925 Unclassified 2723
308 Ga0207659_10014470 3300025926 Bacteria 5090
309 Ga0207659_10016387 3300025926 Bacteria 4822
310 Ga0207659_10023509 3300025926 Unclassified 4114
311 Ga0207659_10063154 3300025926 Bacteria 2676
312 Ga0207659_10210474 3300025926 Unclassified 1558
313 Ga0207659_10480657 3300025926 Bacteria 1049
314 Ga0207687_10064114 3300025927 Bacteria 2604
315 Ga0207687_10284713 3300025927 Unclassified 1326
316 Ga0207644_10061497 3300025931 Bacteria 2720
317 Ga0207644_10067088 3300025931 Bacteria 2614
318 Ga0207644_10131038 3300025931 Unclassified 1919
319 Ga0207644_10182044 3300025931 Unclassified 1647
320 Ga0207690_10121107 3300025932 Bacteria 1901
321 Ga0207706_10229385 3300025933 Bacteria 1625
322 Ga0207686_10001689 3300025934 Bacteria 12298
323 Ga0207686_10006510 3300025934 Bacteria 6289
324 Ga0207686_10026131 3300025934 Bacteria 3404
325 Ga0207686_10469938 3300025934 Unclassified 971
326 Ga0207709_10009230 3300025935 Bacteria 5433
327 Ga0207709_10010571 3300025935 Bacteria 5084
328 Ga0207670_10024523 3300025936 Bacteria 3771
329 Ga0207670_10085678 3300025936 Unclassified 2215
330 Ga0207670_10401438 3300025936 Unclassified 1096
331 Ga0207669_10039454 3300025937 Unclassified 2729
332 Ga0207669_10290740 3300025937 Unclassified 1237
333 Ga0207669_10572623 3300025937 Unclassified 914
334 Ga0207691_10011531 3300025940 Bacteria 8484
335 Ga0207691_10031406 3300025940 Bacteria 4958
336 Ga0207691_10062686 3300025940 Bacteria 3373
337 Ga0207691_10290352 3300025940 Bacteria 1406
338 Ga0207711_10043696 3300025941 Bacteria 3824
339 Ga0207711_10049104 3300025941 Bacteria 3612
340 Ga0207711_10068125 3300025941 Bacteria 3082
341 Ga0207711_10189450 3300025941 Bacteria 1874
342 Ga0207711_10205047 3300025941 Bacteria 1800
343 Ga0207711_10791833 3300025941 Unclassified 883
344 Ga0207689_10003136 3300025942 Bacteria 15170
345 Ga0207689_10064077 3300025942 Bacteria 3024
346 Ga0207689_10074071 3300025942 Unclassified 2798
347 Ga0207689_10092739 3300025942 Bacteria 2481
348 Ga0207661_10210869 3300025944 Bacteria 1712
349 Ga0207679_10286820 3300025945 Bacteria 1414
350 Ga0207651_10012622 3300025960 Bacteria 4791
351 Ga0207651_10121378 3300025960 Bacteria 1982
352 Ga0207651_10200089 3300025960 Bacteria 1600
353 Ga0207668_10208049 3300025972 Bacteria 1563
354 Ga0207640_10014442 3300025981 Bacteria 4548
355 Ga0207640_10023201 3300025981 Bacteria 3726
356 Ga0207640_10225664 3300025981 Bacteria 1437
357 Ga0207658_10149490 3300025986 Bacteria 1901
358 Ga0207658_10445248 3300025986 Bacteria 1146
359 Ga0207677_10051137 3300026023 Bacteria 2800
360 Ga0207677_10276395 3300026023 Bacteria 1376
361 Ga0207703_10008855 3300026035 Bacteria 7934
362 Ga0207703_10020141 3300026035 Bacteria 5214
363 Ga0207703_10068133 3300026035 Bacteria 2932
364 Ga0207703_10101954 3300026035 Bacteria 2434
365 Ga0207703_10326714 3300026035 Bacteria 1406
366 Ga0207703_10402979 3300026035 Bacteria 1270
367 Ga0207708_10031922 3300026075 Bacteria 4000
368 Ga0207708_10032985 3300026075 Bacteria 3932
369 Ga0207708_10052750 3300026075 Bacteria 3097
370 Ga0207708_10119059 3300026075 Bacteria 2057
371 Ga0207641_10002035 3300026088 Bacteria 19257
372 Ga0207641_10066190 3300026088 Bacteria 3093
373 Ga0207641_10117888 3300026088 Bacteria 2364
374 Ga0207641_10308336 3300026088 Bacteria 1497
375 Ga0207648_10004718 3300026089 Bacteria 13934
376 Ga0207648_10012593 3300026089 Bacteria 7915
377 Ga0207648_10018114 3300026089 Bacteria 6378
378 Ga0207676_10041156 3300026095 Bacteria 3545
379 Ga0207676_10089526 3300026095 Unclassified 2522
380 Ga0207676_10219259 3300026095 Bacteria 1693
381 Ga0207676_10380154 3300026095 Bacteria 1314
382 Ga0207674_10609485 3300026116 Bacteria 1055
383 Ga0207674_10686559 3300026116 Unclassified 988
384 Ga0207675_100009168 3300026118 Bacteria 9283
385 Ga0207675_100022494 3300026118 Bacteria 5870
386 Ga0207675_100024873 3300026118 Bacteria 5571
387 Ga0207675_100028975 3300026118 Bacteria 5159
388 Ga0207675_100080636 3300026118 Bacteria 3051
389 Ga0207675_100175434 3300026118 Bacteria 2050
390 Ga0207675_100240454 3300026118 Unclassified 1749
391 Ga0207683_10008172 3300026121 Bacteria 8954
392 Ga0207683_10010505 3300026121 Bacteria 7899
393 Ga0207683_10122309 3300026121 Bacteria 2337
394 Ga0207428_10000019 3300027907 Bacteria 276945
395 Ga0207428_10015801 3300027907 Bacteria 6514
396 Ga0207428_10050273 3300027907 Bacteria 3336
397 Ga0207428_10100278 3300027907 Bacteria 2238
398 Ga0207428_10119766 3300027907 Bacteria 2019
399 Ga0268266_10051966 3300028379 Bacteria 3518
400 Ga0268266_10119971 3300028379 Bacteria 2339
401 Ga0268265_10030759 3300028380 Bacteria 3870
402 Ga0268265_10048738 3300028380 Unclassified 3182
403 Ga0265318_10001209 3300028577 Bacteria 15697
404 Ga0265332_10075584 3300031238 Unclassified 1432
405 Ga0265325_10031983 3300031241 Unclassified 2813
406 Ga0265329_10000489 3300031242 Bacteria 20589
407 Ga0265340_10019643 3300031247 Bacteria 3479
408 Ga0265339_10014153 3300031249 Bacteria 4814
409 Ga0265331_10000522 3300031250 Bacteria 35513
410 Ga0265316_10033624 3300031344 Bacteria 4173
411 Ga0265313_10019809 3300031595 Unclassified 3732
412 Ga0265342_10002357 3300031712 Bacteria 16383
413 Ga0373930_0004662 3300034816 Bacteria 2244
414 Ga0373950_0001607 3300034818 Bacteria 2978
415 Ga0373958_0004340 3300034819 Bacteria 2095
416 Ga0373959_0003020 3300034820 Bacteria 2678
417 Ga0373938_0003112 3300034957 Bacteria 2694
418 Ga0373926_0039525 3300035083 Bacteria 1682
419 Ga0373929_0002131 3300035085 Bacteria 3682
420 Ga0373934_0005316 3300035086 Bacteria 4765
421 Ga0373949_0002401 3300035090 Bacteria 4831
422 Ga0373923_0012713 3300035111 Bacteria 3121
423 Ga0373932_0002174 3300035112 Bacteria 5069
424 Ga0373939_0000840 3300035114 Bacteria 7609
425 Ga0373939_0035392 3300035114 Bacteria 1471
426 Ga0373941_0001203 3300035115 Bacteria 5410
427 Ga0373945_0087693 3300035116 Bacteria 1201
428 Ga0373954_0012560 3300035118 Bacteria 3767
429 Ga0373954_0059633 3300035118 Bacteria 1799
430 Ga0373957_0042000 3300035120 Bacteria 1724
431 Ga0373957_0089680 3300035120 Unclassified 1221
432 Ga0373960_0002260 3300035121 Bacteria 4332
433 Ga0373943_0311196 3300035170 Unclassified 896
434 Ga0373946_0141447 3300035171 Unclassified 1116
435 Ga0373955_0063050 3300035172 Bacteria 2052
436 Ga0373942_0001622 3300035207 Bacteria 5750
437 Ga0373961_0001759 3300035241 Bacteria 6004
438 Ga0373962_0000256 3300035242 Bacteria 11349
439 Ga0373962_0025766 3300035242 Bacteria 1581
440 Ga0373931_0007020 3300035691 Bacteria 5298
441 Ga0373935_0003466 3300035692 Bacteria 9169
442 Ga0373935_0045892 3300035692 Bacteria 2758
443 Ga0373935_0086901 3300035692 Bacteria 2041
444 Ga0373927_0000770 3300035695 Bacteria 24549
445 Ga0373927_0032145 3300035695 Bacteria 3417
446 Ga0373927_0147002 3300035695 Bacteria 1543
447 Ga0373925_0058974 3300037068 Bacteria 2878
448 Ga0373925_0383181 3300037068 Bacteria 1145
449 Ga0436364_0941405 3300037853 Unclassified 4978
450 Ga0439450_004631 3300042008 Bacteria 2363
451 Ga0439435_0007124 3300042436 Bacteria 2544
452 Ga0451576_0013097 3300045051 Bacteria 9287
453 Ga0495592_0184270 3300046454 Bacteria 1419
454 Ga0495580_0204813 3300046472 Bacteria 1358
455 Ga0495608_0005522 3300046511 Bacteria 9031
456 Ga0495628_0010614 3300046516 Bacteria 7813
457 Ga0495630_0005592 3300046517 Bacteria 8876
458 Ga0495665_0025286 3300046531 Bacteria 3190
459 Ga0495640_0059994 3300046533 Bacteria 2589
460 Ga0495587_0039003 3300046536 Bacteria 2846
461 Ga0495621_0029173 3300046539 Bacteria 1880
462 Ga0495645_0014207 3300046543 Bacteria 5646
463 Ga0495645_0241936 3300046543 Bacteria 1204
464 Ga0495656_0222394 3300046615 Unclassified 944
465 Ga0495634_0063809 3300046642 Unclassified 2444
466 Ga0495635_0034820 3300046663 Bacteria 3493
467 Ga0495599_0199045 3300046678 Bacteria 1231
468 Ga0495658_0048013 3300046683 Bacteria 2406
469 Ga0495658_0056250 3300046683 Bacteria 2243
470 Ga0495613_0004627 3300046689 Bacteria 10329
471 Ga0495613_0091764 3300046689 Bacteria 2200
472 Ga0495613_0239952 3300046689 Bacteria 1268
473 Ga0495604_0175640 3300047317 Bacteria 1502
474 Ga0495674_0114131 3300047319 Bacteria 2287
475 Ga0495675_0008103 3300047444 Bacteria 6502
476 Ga0495675_0202959 3300047444 Bacteria 1206
477 Ga0495684_0001776 3300047471 Bacteria 17286
478 Ga0495684_0338121 3300047471 Bacteria 1072
479 Ga0496102_0455096 3300048905 Bacteria 1201
480 Ga0496108_0184527 3300048911 Bacteria 1807
481 Ga0496108_0388448 3300048911 Bacteria 1219
482 Ga0496109_0114833 3300048912 Bacteria 2505
483 Ga0496109_0252203 3300048912 Bacteria 1662
484 Ga0496109_0365767 3300048912 Unclassified 1362
485 Ga0496110_0368231 3300048913 Bacteria 1309
486 Ga0496112_0131595 3300048915 Bacteria 2473
487 Ga0496114_0200945 3300048917 Bacteria 1746
488 Ga0496114_0207229 3300048917 Unclassified 1719
489 Ga0501037_0177773 3300049573 Bacteria 1511
490 Ga0501039_0138801 3300049575 Bacteria 1909
491 Ga0501040_0114382 3300049576 Bacteria 1889
492 Ga0501042_0028518 3300049578 Bacteria 3934
493 Ga0501042_0056961 3300049578 Bacteria 2789
494 Ga0501042_0118857 3300049578 Bacteria 1903
495 Ga0501046_0344936 3300049580 Bacteria 1082
496 Ga0501048_0037652 3300049582 Bacteria 3474
497 Ga0501071_0052844 3300049587 Unclassified 2930
498 Ga0501071_0149900 3300049587 Bacteria 1739
499 Ga0501072_0184639 3300049588 Bacteria 1664
500 Ga0501075_0009220 3300049591 Bacteria 6899
501 Ga0501075_0018080 3300049591 Bacteria 5097
502 Ga0501075_0196842 3300049591 Unclassified 1537
503 Ga0501075_0209946 3300049591 Bacteria 1485
504 Ga0501076_0053107 3300049592 Bacteria 3211
505 Ga0501076_0122593 3300049592 Unclassified 2105
506 Ga0501081_0115606 3300049743 Bacteria 1907
507 Ga0501045_0022749 3300049824 Bacteria 4489
508 Ga0501045_0149199 3300049824 Bacteria 1739
509 Ga0501045_0291076 3300049824 Bacteria 1215
510 nmdc:mga07m45_384433_c1 3300050496 Bacteria 815
511 nmdc:mga05p37_14243_c1 3300050507 Bacteria 9550
512 nmdc:mga05p37_144698_c1 3300050507 Bacteria 2911
513 nmdc:mga05p37_18799_c1 3300050507 Bacteria 8352
514 nmdc:mga05p37_19457_c1 3300050507 Bacteria 8213
515 nmdc:mga05p37_453410_c1 3300050507 Bacteria 1484
516 nmdc:mga05p37_555784_c1 3300050507 Unclassified 1305
517 nmdc:mga05p37_695947_c1 3300050507 Bacteria 1130
518 nmdc:mga05p37_86835_c1 3300050507 Bacteria 3856
519 nmdc:mga09592_504124_c1 3300050508 Bacteria 1042
520 nmdc:mga0qj67_107485_c1 3300050509 Bacteria 2251
521 nmdc:mga0qj67_66758_c1 3300050509 Bacteria 2865
522 nmdc:mga0qj67_86422_c2 3300050509 Bacteria 2070
523 nmdc:mga06r32_137930_c1 3300050510 Bacteria 2414
524 nmdc:mga08y16_179020_c1 3300050511 Bacteria 2202
525 nmdc:mga08y16_17_c1 3300050511 Bacteria 382598
526 nmdc:mga08y16_233334_c1 3300050511 Bacteria 1903
527 nmdc:mga08y16_38502_c1 3300050511 Bacteria 5021
528 nmdc:mga08y16_618090_c1 3300050511 Bacteria 1091
529 nmdc:mga0n895_142520_c1 3300050512 Bacteria 2425
530 nmdc:mga0n895_14572_c1 3300050512 Bacteria 7145
531 nmdc:mga0n895_185630_c1 3300050512 Unclassified 2110
532 nmdc:mga0n895_240094_c1 3300050512 Bacteria 1839
533 nmdc:mga0n895_49_c1 3300050512 Bacteria 73512
534 nmdc:mga0n895_62004_c1 3300050512 Bacteria 3694
535 nmdc:mga0n895_8388_c1 3300050512 Bacteria 8946
536 nmdc:mga0n895_98840_c1 3300050512 Bacteria 2926
537 nmdc:mga0rr50_11_c1 3300050513 Bacteria 216152
538 nmdc:mga0rr50_133677_c1 3300050513 Bacteria 1989
539 nmdc:mga0rr50_21355_c1 3300050513 Bacteria 4418
540 nmdc:mga0rr50_269824_c1 3300050513 Bacteria 1418
541 nmdc:mga0rr50_31602_c1 3300050513 Bacteria 3763
542 nmdc:mga0rr50_419204_c1 3300050513 Bacteria 1132
543 nmdc:mga0rr50_4194_c1 3300050513 Bacteria 8432
544 nmdc:mga0rr50_51729_c1 3300050513 Bacteria 3050
545 nmdc:mga0rr50_97846_c1 3300050513 Bacteria 2299
546 nmdc:mga08x19_1194_c1 3300050514 Bacteria 16237
547 nmdc:mga08x19_168493_c1 3300050514 Bacteria 1491
548 nmdc:mga08x19_30094_c1 3300050514 Bacteria 3409
549 nmdc:mga08x19_42468_c1 3300050514 Unclassified 2899
550 nmdc:mga08x19_42545_c1 3300050514 Bacteria 2897
551 nmdc:mga08x19_435_c1 3300050514 Bacteria 28614
552 nmdc:mga0a205_129284_c1 3300050515 Bacteria 2426
553 nmdc:mga0a205_17651_c1 3300050515 Bacteria 6698
554 nmdc:mga0a205_456473_c1 3300050515 Unclassified 1137
555 nmdc:mga0a205_569718_c1 3300050515 Bacteria 987
556 nmdc:mga0a205_62856_c1 3300050515 Bacteria 3587
557 nmdc:mga0a205_64119_c1 3300050515 Unclassified 3549
558 Ga0495601_0004666 3300053077 Bacteria 7932
559 Ga0495612_0003287 3300053078 Bacteria 6704
560 Ga0495595_0032994 3300053084 Bacteria 2334
561 Ga0495619_0001563 3300053085 Bacteria 15064
562 Ga0495619_0199518 3300053085 Bacteria 1385
563 Ga0501084_0069665 3300054114 Unclassified 2945
564 Ga0501082_0041535 3300060353 Bacteria 3966
565 Ga0501082_0555223 3300060353 Bacteria 1004
566 Ga0530510_0120741 3300061734 Bacteria 1924
567 Ga0530510_0156055 3300061734 Bacteria 1687
568 Ga0207646_10071800
569 JGI25406J46586_10000213
570 JGI25406J46586_10015184
571 Ga0065712_10085559
572 Ga0065715_10113521
573 Ga0065707_10001222
574 Ga0070676_10038479
575 Ga0070676_10066716
576 Ga0070676_10179290
577 Ga0070690_100002407
578 Ga0070690_100019539
579 Ga0070690_100027737
580 Ga0070670_100026806
581 Ga0070677_10012269
582 Ga0068869_100044333
583 Ga0070666_10008205
584 Ga0070666_10026271
585 Ga0070666_10086914
586 Ga0070666_10111010
587 Ga0068868_100116352
588 Ga0068868_100270102
589 Ga0070689_100011352
590 Ga0070689_100013955
591 Ga0070689_100077095
592 Ga0070689_100744448
593 Ga0070691_10014870
594 Ga0070687_100048916
595 Ga0070668_100169588
596 Ga0070669_100010525
597 Ga0070669_100034405
598 Ga0070669_100147542
599 Ga0070669_100177705
600 Ga0070669_100435648
601 Ga0070675_100000928
602 Ga0070675_100015575
603 Ga0070675_100021857
604 Ga0070675_100029726
605 Ga0070675_100063896
606 Ga0070675_100073836
607 Ga0070675_100093835
608 Ga0070675_100296410
609 Ga0070671_100006676
610 Ga0070671_100018780
611 Ga0070671_100027861
612 Ga0070671_100275387
613 Ga0070674_100004335
614 Ga0070674_100037580
615 Ga0070674_100116205
616 Ga0070674_100377939
617 Ga0070673_100036889
618 Ga0070673_100049430
619 Ga0070673_100092060
620 Ga0070673_100097744
621 Ga0070673_100235993
622 Ga0070688_100037082
623 Ga0070659_100193545
624 Ga0070667_100043545
625 Ga0070667_100051619
626 Ga0070703_10087903
627 Ga0070701_10003349
628 Ga0070701_10029230
629 Ga0070701_10032273
630 Ga0070705_100014630
631 Ga0070705_100020338
632 Ga0070705_100133940
633 Ga0070700_100043078
634 Ga0070700_100257022
635 Ga0070694_100100102
636 Ga0070694_100169011
637 Ga0070694_100394216
638 Ga0070708_100355708
639 Ga0070708_100432648
640 Ga0070678_100066375
641 Ga0070678_100073928
642 Ga0070678_100702921
643 Ga0070662_100053997
644 Ga0070662_100307115
645 Ga0068867_100001682
646 Ga0068867_100003832
647 Ga0068867_100087080
648 Ga0070685_10238633
649 Ga0070706_100180286
650 Ga0070706_100261578
651 Ga0070706_100281127
652 Ga0070707_100129730
653 Ga0070707_100360716
654 Ga0070699_100001131
655 Ga0070699_100018143
656 Ga0070699_100222846
657 Ga0070684_100106298
658 Ga0070697_100066354
659 Ga0070697_100078630
660 Ga0070697_100400679
661 Ga0068853_100492213
662 Ga0070672_100003783
663 Ga0070672_100012052
664 Ga0070672_100175733
665 Ga0070672_100263379
666 Ga0070672_100485134
667 Ga0070686_100008654
668 Ga0070686_100163434
669 Ga0070686_100311432
670 Ga0070695_100127863
671 Ga0070695_100308859
672 Ga0070696_100074709
673 Ga0070696_100099591
674 Ga0070696_100448886
675 Ga0070693_100348245
676 Ga0070665_100001968
677 Ga0070665_100058920
678 Ga0070665_100227428
679 Ga0070704_100009477
680 Ga0070704_100063190
681 Ga0070704_100235676
682 Ga0068854_100001377
683 Ga0068854_100032562
684 Ga0068854_100266103
685 Ga0070702_100002450
686 Ga0070702_100063218
687 Ga0070702_100124859
688 Ga0068859_100076502
689 Ga0068859_100212581
690 Ga0068859_100256560
691 Ga0068859_100992900
692 Ga0068864_100059159
693 Ga0068864_100186898
694 Ga0068864_100219742
695 Ga0068864_100262937
696 Ga0068866_10019886
697 Ga0068861_100008276
698 Ga0068861_100011523
699 Ga0068861_100014123
700 Ga0068861_100058810
701 Ga0068861_100649201
702 Ga0068851_10005077
703 Ga0068851_10039262
704 Ga0068870_10028887
705 Ga0068870_10246758
706 Ga0068870_10304229
707 Ga0068863_100000867
708 Ga0068863_100441012
709 Ga0068863_100461825
710 Ga0068858_100013632
711 Ga0068858_100122908
712 Ga0068858_100175905
713 Ga0068858_100301332
714 Ga0068858_100521938
715 Ga0068860_100044254
716 Ga0068860_100207219
717 Ga0068860_100359842
718 Ga0068860_100388217
719 Ga0068860_100841820
720 Ga0068862_100001070
721 Ga0068862_100151342
722 Ga0068862_100165554
723 Ga0068862_100170403
724 Ga0081455_10097859
725 Ga0081539_10000010
726 Ga0081539_10000065
727 Ga0097621_100000475
728 Ga0097621_100005930
729 Ga0097621_100018545
730 Ga0068871_100001753
731 Ga0068871_100012166
732 Ga0068871_100088804
733 Ga0068871_100271425
734 Ga0068871_100707117
735 Ga0075428_100000005
736 Ga0075428_100042849
737 Ga0075428_100218826
738 Ga0075428_100490806
739 Ga0075430_100035081
740 Ga0075430_100093913
741 Ga0075430_100135853
742 Ga0075431_100131220
743 Ga0075431_100350291
744 Ga0075433_10048481
745 Ga0075433_10086852
746 Ga0075433_10230609
747 Ga0075433_10239715
748 Ga0075433_10420771
749 Ga0075434_100000085
750 Ga0075434_100016194
751 Ga0075434_100019913
752 Ga0075434_100032572
753 Ga0075434_100171390
754 Ga0075434_100339766
755 Ga0075434_100380624
756 Ga0075434_100674854
757 Ga0075429_100302313
758 Ga0068865_100015637
759 Ga0068865_100026477
760 Ga0068865_100172754
761 Ga0068865_100268246
762 Ga0075436_100005853
763 Ga0075436_100021104
764 Ga0075436_100036287
765 Ga0075436_100036357
766 Ga0075436_100039597
767 Ga0075436_100042599
768 Ga0097620_100063951
769 Ga0097620_100076504
770 Ga0097620_100212580
771 Ga0097620_100256533
772 Ga0097620_100992745
773 Ga0075435_100000001
774 Ga0075435_100040282
775 Ga0075435_100045091
776 Ga0075435_100061492
777 Ga0075435_100071040
778 Ga0075435_100094246
779 Ga0075435_100104168
780 Ga0075435_100122881
781 Ga0075435_100150628
782 Ga0075435_100406432
783 Ga0099794_10168529
784 Ga0105240_10222535
785 Ga0105240_10603487
786 Ga0111539_10000008
787 Ga0111539_10004048
788 Ga0111539_10019249
789 Ga0111539_10051342
790 Ga0111539_10071142
791 Ga0111539_10395503
792 Ga0105245_10092208
793 Ga0105247_10084315
794 Ga0114129_10002348
795 Ga0114129_10007398
796 Ga0114129_10011978
797 Ga0114129_10019700
798 Ga0114129_10052703
799 Ga0114129_10132868
800 Ga0105243_10021764
801 Ga0105243_10040800
802 Ga0105243_10127454
803 Ga0105243_10310716
804 Ga0105243_10689806
805 Ga0105242_10000986
806 Ga0105242_10012935
807 Ga0105242_10456614
808 Ga0105248_10007883
809 Ga0105248_10022182
810 Ga0105248_10115466
811 Ga0105248_10116465
812 Ga0105248_10257685
813 Ga0105248_10286025
814 Ga0105248_10323759
815 Ga0105248_10420341
816 Ga0105238_10002032
817 Ga0105249_10712546
818 Ga0105249_10855527
819 Ga0105246_10023457
820 Ga0157374_10042160
821 Ga0157378_10256047
822 Ga0157378_10536534
823 Ga0157378_10572837
824 Ga0163162_10017597
825 Ga0163162_10269957
826 Ga0163162_10606165
827 Ga0163162_10949323
828 Ga0157375_10028027
829 Ga0157375_10077978
830 Ga0157375_10427417
831 Ga0157375_10551139
832 Ga0157375_11004894
833 Ga0163163_10020292
834 Ga0157380_10125208
835 Ga0157380_10179839
836 Ga0157380_10261357
837 Ga0157380_10434437
838 Ga0157380_10515722
839 Ga0157377_10049442
840 Ga0157377_10306215
841 Ga0157379_10053522
842 Ga0157379_10277280
843 Ga0157379_10308079
844 Ga0157376_10008351
845 Ga0157376_10080276
846 Ga0157376_10150414
847 Ga0157376_10491350
848 Ga0207656_10001898
849 Ga0207656_10076848
850 Ga0207682_10000468
851 Ga0207642_10006960
852 Ga0207642_10011739
853 Ga0207680_10024860
854 Ga0207680_10101708
855 Ga0207645_10001597
856 Ga0207645_10013540
857 Ga0207645_10014603
858 Ga0207645_10263596
859 Ga0207643_10078198
860 Ga0207643_10140511
861 Ga0207643_10271738
862 Ga0207695_10140791
863 Ga0207662_10012962
864 Ga0207662_10131375
865 Ga0207646_10086101
866 Ga0207646_10087011
867 Ga0207646_10113341
868 Ga0207646_10183657
869 Ga0207646_10246550
870 Ga0207681_10053851
871 Ga0207681_10055979
872 Ga0207681_10213913
873 Ga0207694_10002253
874 Ga0207650_10065493
875 Ga0207659_10014470
876 Ga0207659_10016387
877 Ga0207659_10023509
878 Ga0207659_10063154
879 Ga0207659_10210474
880 Ga0207659_10480657
881 Ga0207687_10064114
882 Ga0207687_10284713
883 Ga0207644_10061497
884 Ga0207644_10067088
885 Ga0207644_10131038
886 Ga0207644_10182044
887 Ga0207690_10121107
888 Ga0207706_10229385
889 Ga0207686_10001689
890 Ga0207686_10006510
891 Ga0207686_10026131
892 Ga0207686_10469938
893 Ga0207709_10009230
894 Ga0207709_10010571
895 Ga0207670_10024523
896 Ga0207670_10085678
897 Ga0207670_10401438
898 Ga0207669_10039454
899 Ga0207669_10290740
900 Ga0207669_10572623
901 Ga0207691_10011531
902 Ga0207691_10031406
903 Ga0207691_10062686
904 Ga0207691_10290352
905 Ga0207711_10043696
906 Ga0207711_10049104
907 Ga0207711_10068125
908 Ga0207711_10189450
909 Ga0207711_10205047
910 Ga0207711_10791833
911 Ga0207689_10003136
912 Ga0207689_10064077
913 Ga0207689_10074071
914 Ga0207689_10092739
915 Ga0207661_10210869
916 Ga0207679_10286820
917 Ga0207651_10012622
918 Ga0207651_10121378
919 Ga0207651_10200089
920 Ga0207668_10208049
921 Ga0207640_10014442
922 Ga0207640_10023201
923 Ga0207640_10225664
924 Ga0207658_10149490
925 Ga0207658_10445248
926 Ga0207677_10051137
927 Ga0207677_10276395
928 Ga0207703_10008855
929 Ga0207703_10020141
930 Ga0207703_10068133
931 Ga0207703_10101954
932 Ga0207703_10326714
933 Ga0207703_10402979
934 Ga0207708_10031922
935 Ga0207708_10032985
936 Ga0207708_10052750
937 Ga0207708_10119059
938 Ga0207641_10002035
939 Ga0207641_10066190
940 Ga0207641_10117888
941 Ga0207641_10308336
942 Ga0207648_10004718
943 Ga0207648_10012593
944 Ga0207648_10018114
945 Ga0207676_10041156
946 Ga0207676_10089526
947 Ga0207676_10219259
948 Ga0207676_10380154
949 Ga0207674_10609485
950 Ga0207674_10686559
951 Ga0207675_100009168
952 Ga0207675_100022494
953 Ga0207675_100024873
954 Ga0207675_100028975
955 Ga0207675_100080636
956 Ga0207675_100175434
957 Ga0207675_100240454
958 Ga0207683_10008172
959 Ga0207683_10010505
960 Ga0207683_10122309
961 Ga0207428_10000019
962 Ga0207428_10015801
963 Ga0207428_10050273
964 Ga0207428_10100278
965 Ga0207428_10119766
966 Ga0268266_10051966
967 Ga0268266_10119971
968 Ga0268265_10030759
969 Ga0268265_10048738
970 Ga0265318_10001209
971 Ga0265332_10075584
972 Ga0265325_10031983
973 Ga0265329_10000489
974 Ga0265340_10019643
975 Ga0265339_10014153
976 Ga0265331_10000522
977 Ga0265316_10033624
978 Ga0265313_10019809
979 Ga0265342_10002357
980 Ga0373930_0004662
981 Ga0373950_0001607
982 Ga0373958_0004340
983 Ga0373959_0003020
984 Ga0373938_0003112
985 Ga0373926_0039525
986 Ga0373929_0002131
987 Ga0373934_0005316
988 Ga0373949_0002401
989 Ga0373923_0012713
990 Ga0373932_0002174
991 Ga0373939_0000840
992 Ga0373939_0035392
993 Ga0373941_0001203
994 Ga0373945_0087693
995 Ga0373954_0012560
996 Ga0373954_0059633
997 Ga0373957_0042000
998 Ga0373957_0089680
999 Ga0373960_0002260
1000 Ga0373943_0311196
1001 Ga0373946_0141447
1002 Ga0373955_0063050
1003 Ga0373942_0001622
1004 Ga0373961_0001759
1005 Ga0373962_0000256
1006 Ga0373962_0025766
1007 Ga0373931_0007020
1008 Ga0373935_0003466
1009 Ga0373935_0045892
1010 Ga0373935_0086901
1011 Ga0373927_0000770
1012 Ga0373927_0032145
1013 Ga0373927_0147002
1014 Ga0373925_0058974
1015 Ga0373925_0383181
1016 Ga0436364_0941405
1017 Ga0439450_004631
1018 Ga0439435_0007124
1019 Ga0451576_0013097
1020 Ga0495592_0184270
1021 Ga0495580_0204813
1022 Ga0495608_0005522
1023 Ga0495628_0010614
1024 Ga0495630_0005592
1025 Ga0495665_0025286
1026 Ga0495640_0059994
1027 Ga0495587_0039003
1028 Ga0495621_0029173
1029 Ga0495645_0014207
1030 Ga0495645_0241936
1031 Ga0495656_0222394
1032 Ga0495634_0063809
1033 Ga0495635_0034820
1034 Ga0495599_0199045
1035 Ga0495658_0048013
1036 Ga0495658_0056250
1037 Ga0495613_0004627
1038 Ga0495613_0091764
1039 Ga0495613_0239952
1040 Ga0495604_0175640
1041 Ga0495674_0114131
1042 Ga0495675_0008103
1043 Ga0495675_0202959
1044 Ga0495684_0001776
1045 Ga0495684_0338121
1046 Ga0496102_0455096
1047 Ga0496108_0184527
1048 Ga0496108_0388448
1049 Ga0496109_0114833
1050 Ga0496109_0252203
1051 Ga0496109_0365767
1052 Ga0496110_0368231
1053 Ga0496112_0131595
1054 Ga0496114_0200945
1055 Ga0496114_0207229
1056 Ga0501037_0177773
1057 Ga0501039_0138801
1058 Ga0501040_0114382
1059 Ga0501042_0028518
1060 Ga0501042_0056961
1061 Ga0501042_0118857
1062 Ga0501046_0344936
1063 Ga0501048_0037652
1064 Ga0501071_0052844
1065 Ga0501071_0149900
1066 Ga0501072_0184639
1067 Ga0501075_0009220
1068 Ga0501075_0018080
1069 Ga0501075_0196842
1070 Ga0501075_0209946
1071 Ga0501076_0053107
1072 Ga0501076_0122593
1073 Ga0501081_0115606
1074 Ga0501045_0022749
1075 Ga0501045_0149199
1076 Ga0501045_0291076
1077 nmdc:mga07m45_384433_c1
1078 nmdc:mga05p37_14243_c1
1079 nmdc:mga05p37_144698_c1
1080 nmdc:mga05p37_18799_c1
1081 nmdc:mga05p37_19457_c1
1082 nmdc:mga05p37_453410_c1
1083 nmdc:mga05p37_555784_c1
1084 nmdc:mga05p37_695947_c1
1085 nmdc:mga05p37_86835_c1
1086 nmdc:mga09592_504124_c1
1087 nmdc:mga0qj67_107485_c1
1088 nmdc:mga0qj67_66758_c1
1089 nmdc:mga0qj67_86422_c2
1090 nmdc:mga06r32_137930_c1
1091 nmdc:mga08y16_179020_c1
1092 nmdc:mga08y16_17_c1
1093 nmdc:mga08y16_233334_c1
1094 nmdc:mga08y16_38502_c1
1095 nmdc:mga08y16_618090_c1
1096 nmdc:mga0n895_142520_c1
1097 nmdc:mga0n895_14572_c1
1098 nmdc:mga0n895_185630_c1
1099 nmdc:mga0n895_240094_c1
1100 nmdc:mga0n895_49_c1
1101 nmdc:mga0n895_62004_c1
1102 nmdc:mga0n895_8388_c1
1103 nmdc:mga0n895_98840_c1
1104 nmdc:mga0rr50_11_c1
1105 nmdc:mga0rr50_133677_c1
1106 nmdc:mga0rr50_21355_c1
1107 nmdc:mga0rr50_269824_c1
1108 nmdc:mga0rr50_31602_c1
1109 nmdc:mga0rr50_419204_c1
1110 nmdc:mga0rr50_4194_c1
1111 nmdc:mga0rr50_51729_c1
1112 nmdc:mga0rr50_97846_c1
1113 nmdc:mga08x19_1194_c1
1114 nmdc:mga08x19_168493_c1
1115 nmdc:mga08x19_30094_c1
1116 nmdc:mga08x19_42468_c1
1117 nmdc:mga08x19_42545_c1
1118 nmdc:mga08x19_435_c1
1119 nmdc:mga0a205_129284_c1
1120 nmdc:mga0a205_17651_c1
1121 nmdc:mga0a205_456473_c1
1122 nmdc:mga0a205_569718_c1
1123 nmdc:mga0a205_62856_c1
1124 nmdc:mga0a205_64119_c1
1125 Ga0495601_0004666
1126 Ga0495612_0003287
1127 Ga0495595_0032994
1128 Ga0495619_0001563
1129 Ga0495619_0199518
1130 Ga0501084_0069665
1131 Ga0501082_0041535
1132 Ga0501082_0555223
1133 Ga0530510_0120741
1134 Ga0530510_0156055

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13442

Cytochrome_CBB3

Cytochrome C oxidase, cbb3-type, subunit III

84

157

0.84

PF00034

Cytochrom_C

Cytochrome c

86

161

0.76

Structural Annotation

Top 5 Hits

ID Description Score Start End
5dy9-assembly1.cif.gz_F y68t hfq from methanococcus jannaschii in complex with amp 0.9036 193 236
7c90-assembly1.cif.gz_D crystal structure of cytochrome cl from the marine methylotrophic bacterium methylophaga aminisulfidivorans mpt (ma-cytcl) 0.8779 45 120
2d0w-assembly2.cif.gz_B crystal structure of cytochrome cl from hyphomicrobium denitrificans 0.8686 46 119
3qsu-assembly1.cif.gz_A structure of staphylococcus aureus hfq in complex with a7 rna 0.8445 191 237
4x9c-assembly1.cif.gz_C 1.4a crystal structure of hfq from methanococcus jannaschii 0.8421 190 236
ID Description Score Start End Superfamily
4x9dF00 Mainly Beta;Roll;SH3 type barrels.; 0.87 189 236 2.30.30.100
2d0wB00 Mainly Alpha;Orthogonal Bundle;Cytochrome Bc1 Complex; Chain D, domain 2;Cytochrome c-like domain 0.8686 46 119 1.10.760.10
af_Q556K7_74_139_2.30.30.100 Mainly Beta;Roll;SH3 type barrels.; 0.8364 191 242 2.30.30.100
af_A4HX97_33_135_2.30.30.100 Mainly Beta;Roll;SH3 type barrels.; 0.8362 191 218 2.30.30.100
af_O05781_146_201_2.30.30.60 Mainly Beta;Roll;SH3 type barrels.; 0.8284 187 238 2.30.30.60
ID Description Score Start End GO Terms
AF-A0A2V8KFY7-F1-model_v4 Uncharacterized protein 0.9489 161 269 GO:0009055
GO:0020037
AF-A0A357TIY4-F1-model_v4 Cytochrome c domain-containing protein 0.9435 132 266 GO:0009055
GO:0020037
GO:0046872
AF-A0A3D4CYE3-F1-model_v4 Cytochrome c domain-containing protein 0.9428 132 267 GO:0009055
GO:0020037
GO:0046872
AF-A0A317HZZ0-F1-model_v4 deleted 0.9271 131 269
AF-A0A2V8KFY7-F1-model_v4 Uncharacterized protein 0.9246 161 269 GO:0009055
GO:0020037

Map