F464372

General Info

Members Datasets Scaffolds Average Seq Length
566 277 459 528

Family's Representative Sequence

Representative Sequence 3300009011|Ga0105251_10021442|Ga0105251_100214422
Length 493
Sequence MTLSLTVRRQSLLAGLLALLLFCAGVYGQAPIGFDSRFVLFAQEMLRHGPTVFPTTYGQPYADYTSLSTVFIWLLSLPFGAVNSLTAWLPSAIAGALIVTLMYRLLAPFSLRWAWSSIALLLLTATFVSEVRAVSQDLMLAAVAFSVFYLGYAHDQQGAGRRWPLVFCLLLLGFGIRGPIGLVVPTGILCSYYLLTGQWRRLLLFGGLAWVAKASGGQAFLDDVIRMQFMGRMDGSEGASSALYYFTSSLGNYALAYPLAILALLGAWLGRAHLRGPALSLVGYCAAAALLVMLGLSIPLAKKARYLLPMLPMVAIIAAYPFHVTQGRLFTWLRGLIQGLWLLTPGLMAALQLWALSRLVQSRWRAEVTAGCAVMALWLVYVTVFEPVERRLYDTRSFTQAVIEQVSQQPAPLVLHRLGQDAKAIKFMVNLDQDLQPQFTETPAQLQAMQRPAWLMMDRHDFQALQGTRLQAMQPQLSGRFDNNDYVLVYLGR

Samples

Sample ID Description Type Environment
1 2124908027 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v1 Metagenome Rhizosphere
2 2511231004 Pseudomonas sp. GM102 Isolate Nodule
3 2511231006 Pseudomonas sp. GM17 Isolate Nodule
4 2511231007 Pseudomonas sp. GM18 Isolate Nodule
5 2511231010 Pseudomonas sp. GM25 Isolate Nodule
6 2511231011 Pseudomonas sp. GM30 Isolate Nodule
7 2511231014 Pseudomonas sp. GM48 Isolate Nodule
8 2511231015 Pseudomonas sp. GM49 Isolate Nodule
9 2511231016 Pseudomonas sp. GM50 Isolate Nodule
10 2511231017 Pseudomonas sp. GM55 Isolate Nodule
11 2511231020 Pseudomonas sp. GM74 Isolate Nodule
12 2511231031 Pseudomonas sp. GM16 Isolate Nodule
13 2554235341 Pseudomonas protegens CHA0 Isolate Rhizosphere
14 2597489888 Pseudomonas fluorescens SS101 Isolate Rhizosphere
15 2599185160 Pseudomonas sp. NFPP25 Isolate Rhizoplane
16 2599185161 Pseudomonas sp. NFPP09 Isolate Rhizoplane
17 2599185162 Pseudomonas sp. NFPP10 Isolate Rhizoplane
18 2599185163 Pseudomonas sp. NFPP12 Isolate Rhizoplane
19 2599185164 Pseudomonas sp. NFPP13 Isolate Rhizoplane
20 2599185165 Pseudomonas sp. NFPP18 Isolate Rhizoplane
21 2599185166 Pseudomonas sp. NFPP08 Isolate Rhizoplane
22 2599185167 Pseudomonas sp. NFPP28 Isolate Rhizoplane
23 2599185168 Pseudomonas sp. NFPP05 Isolate Rhizoplane
24 2599185179 Pseudomonas sp. NFR09 Isolate Rhizoplane
25 2599185181 Pseudomonas sp. NFPP17 Isolate Rhizoplane
26 2599185182 Pseudomonas sp. NFPP19 Isolate Rhizoplane
27 2599185186 Pseudomonas sp. NFPP15 Isolate Rhizoplane
28 2599185189 Pseudomonas sp. NFPP02 Isolate Rhizoplane
29 2599185190 Pseudomonas sp. NFPP04 Isolate Rhizoplane
30 2599185191 Pseudomonas sp. NFPP24 Isolate Rhizoplane
31 2599185288 Pseudomonas sp. NFACC25 Isolate Rhizoplane
32 2599185290 Pseudomonas sp. NFPP11 Isolate Rhizoplane
33 2599185303 Pseudomonas sp. NFACC42-2 Isolate Rhizoplane
34 2599185356 Pseudomonas sp. NFPP14 Isolate Rhizoplane
35 2600255296 Pseudomonas sp. NFR02 Isolate Rhizoplane
36 2600255313 Pseudomonas sp. NFPP16 Isolate Rhizoplane
37 2600255318 Pseudomonas putida NFIX47 Isolate Rhizoplane
38 2603880185 Pseudomonas sp. NFIX46 Isolate Rhizoplane
39 2603880199 Pseudomonas sp. NFIX49 Isolate Rhizoplane
40 2619619299 Pseudomonas veronii R4 Genome sequencing Isolate Unclassified
41 2623620443 Pseudomonas sp. DR 5-09 Isolate Unclassified
42 2623620446 Pseudomonas sp. GR 6-02 Isolate Unclassified
43 2643221571 Pseudomonas sp. Root569 Isolate Unclassified
44 2643221713 Pseudomonas sp. Root9 Isolate Unclassified
45 2667528171 Pseudomonas sp. NFPP22 Isolate Rhizoplane
46 2675903420 Pseudomonas fluorescens Ps006 Isolate Unclassified
47 2713897149 Pseudomonas fluorescens SF4c Isolate Rhizosphere
48 2721755607 Pseudomonas fluorescens Pt14 Isolate Rhizosphere
49 2738541265 Pseudomonas sp. GV077 Isolate Unclassified
50 2738541282 Pseudomonas sp. GV058 Isolate Unclassified
51 2738541294 Pseudomonas sp. GV087 Isolate Unclassified
52 2738541303 Pseudomonas sp. GV105 Isolate Unclassified
53 2738541309 Pseudomonas sp. GV047 Isolate Unclassified
54 2738543004 Pseudomonas sp. GV085 Isolate Unclassified
55 2738543015 Pseudomonas sp. GV041 Isolate Unclassified
56 2738543025 Pseudomonas sp. GV091 Isolate Unclassified
57 2765235841 Pseudomonas putida AA7 Isolate Unclassified
58 2773857670 Pseudomonas sp. 478 Isolate Unclassified
59 2773857673 Pseudomonas sp. 443 Isolate Unclassified
60 2784132063 Pseudomonas sp. 424 Isolate Unclassified
61 2784132072 Pseudomonas sp. 460 Isolate Unclassified
62 2808606377 Pseudomonas sp. SJZ083 Isolate Rhizosphere
63 2808606381 Pseudomonas sp. SJZ077 Isolate Rhizosphere
64 2808606385 Pseudomonas sp. SJZ103 Isolate Rhizosphere
65 2808606388 Pseudomonas sp. SJZ094 Isolate Rhizosphere
66 2816332298 Pseudomonas veronii R02 Isolate Rhizosphere
67 2818991456 Pseudomonas koreensis 3286 Isolate Rhizosphere
68 2818991464 Pseudomonas protegens 3295 Isolate Rhizosphere
69 2834028612 Pseudomonas fluorescens 513 Isolate Unclassified
70 2842826826 Pseudomonas sp. R-72172 Isolate Unclassified
71 2842837860 Pseudomonas sp. R-72102 Isolate Unclassified
72 2844665904 Pseudomonas protegens H1F10C Isolate Unclassified
73 2852612431 Pseudomonas sp. SJZ073 Isolate Rhizosphere
74 2852657418 Pseudomonas sp. JAI115 Isolate Rhizosphere
75 2852667396 Pseudomonas sp. JAI120 Isolate Rhizosphere
76 2860339153 Pseudomonas sp. JAI111 Isolate Rhizosphere
77 2878029506 Pseudomonas fluorescens DR397 Isolate Rhizosphere
78 2880230671 Pseudomonas fluorescens LBUM677 Isolate Unclassified
79 2904518522 Pseudomonas fluorescens 4488 Isolate Rhizosphere
80 2904550169 Stutzerimonas stutzeri 1099 Isolate Rhizosphere
81 2908446538 Pseudomonas sp. R76 Isolate Rhizosphere
82 2917070673 Pseudomonas protegens CHA0 Isolate Rhizosphere
83 2919063839 Pseudomonas pharyngis 1098 Isolate Rhizosphere
84 2919456309 Pseudomonas sp. 3296 Isolate Rhizosphere
85 2919697872 Pseudomonas frederiksbergensis 4169 Isolate Unclassified
86 2929189879 Pseudomonas sp. R-71842 Hybrid assembly Isolate Unclassified
87 2931390751 Pseudomonas sp. DR208 Isolate Rhizosphere
88 2935353572 Pseudomonas protegens TECH19 Isolate Unclassified
89 2945928738 Pseudomonas cedrina W1I11 Isolate Rhizosphere
90 2945961074 Pseudomonas sp. W2I6 Isolate Rhizosphere
91 2946006987 Pseudomonas sp. W3I7 Isolate Rhizosphere
92 2969304461 Pseudomonas sp. R84 Isolate Rhizosphere
93 2984286254 Pseudomonas chlororaphis aurantiaca JD37 Isolate Rhizosphere
94 3007619802 Pseudomonas sp. PB120 Isolate Unclassified
95 3007718800 Pseudomonas fluorescens BW11P2 Isolate Rhizosphere
96 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
97 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
98 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
99 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
100 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
101 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
102 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
103 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
104 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
105 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
106 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
107 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
108 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
109 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
110 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
111 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
112 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
113 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
114 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
115 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
116 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
117 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
118 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
119 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
120 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
121 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
122 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
123 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
124 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
125 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
126 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
127 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
128 3300012498 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 Metagenome Rhizosphere
129 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
130 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
131 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
132 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
133 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
134 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
135 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
136 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
137 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
138 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
139 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
140 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
141 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
142 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
143 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
144 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
145 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
146 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
147 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
148 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
149 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
150 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
151 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
152 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
153 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
154 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
155 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
156 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
157 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
158 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
172 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
173 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
174 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
175 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
176 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
177 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
178 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
179 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
180 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
181 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
182 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
183 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
184 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
185 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
186 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
187 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
188 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
189 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
190 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
191 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
192 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
193 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
194 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
195 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
196 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
197 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
198 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
199 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
200 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
201 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
202 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
203 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
204 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
205 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
206 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
207 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
208 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
209 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
210 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
211 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
212 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
213 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
214 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
215 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
216 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
217 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
218 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
219 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
220 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
221 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
222 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
223 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
224 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
225 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
226 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
227 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
228 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
229 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
230 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
231 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
232 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
233 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
234 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
235 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
236 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
237 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
238 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
239 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
240 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
241 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
242 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
243 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
244 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
245 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
246 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
247 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
248 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
249 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
250 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
251 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
252 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
253 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
254 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
255 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
256 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
257 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
258 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
259 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
260 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
261 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
262 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
263 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
264 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
265 637000220 Pseudomonas protegens Pf-5 Isolate Rhizoplane
266 8019769354 Pseudomonas sp. MSSRFD41 Isolate Rhizosphere
267 8019775933 Pseudomonas sp. PvR083 Isolate Rhizosphere
268 8054285046 Pseudomonas petroselini MAFF 311096 Isolate Nodule
269 8054347763 Pseudomonas carnis NWU Be30 Isolate Unclassified
270 8054503363 Pseudomonas sivasensis BsEB-1 Isolate Unclassified
271 8054929484 Pseudomonas vlassakiae RW4S1 Isolate Rhizosphere
272 8055817908 Pseudomonas pergaminensis 1008 Isolate Rhizosphere
273 8056131705 Pseudomonas asgharzadehiana SWRI132 Isolate Rhizosphere
274 8056161164 Pseudomonas azadiae SWRI103 Isolate Rhizosphere
275 8056172158 Pseudomonas ekonensis COR58 Isolate Rhizosphere
276 8056569372 Pseudomonas serboccidentalis IT-P374 Isolate Rhizosphere
277 8057798959 Pseudomonas piscis BW16M1 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 81.1
Metatranscriptomes 0
Isolates 18.9

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.83
Nodule 2.12
Rhizoplane 5.65
Rhizosphere 67.14
Stem 0
Stem Tuber 0
Unclassified 16.25

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 MRS2a_Contig_19 2124908027 Bacteria 54562
2 MRS2a_Contig_6878 2124908027 Bacteria 2434
3 JGI25162J39368_1000004 3300002737 Bacteria 441040
4 JGI25162J39368_1000065 3300002737 Bacteria 131083
5 JGI25163J39215_1000179 3300002771 Bacteria 24461
6 JGI25163J39215_1001093 3300002771 Bacteria 5591
7 JGI25164J39214_1000031 3300002772 Bacteria 144582
8 JGI25164J39214_1000038 3300002772 Bacteria 131082
9 JGI25165J46597_1000011 3300003214 Bacteria 441040
10 JGI25165J46597_1000126 3300003214 Bacteria 131083
11 Ga0055539_1000011 3300003752 Bacteria 399747
12 Ga0055533_1000014 3300003756 Bacteria 399747
13 Ga0055532_1000009 3300003758 Bacteria 399537
14 Ga0055525_1000016 3300003759 Bacteria 399724
15 Ga0055535_1008273 3300003761 Bacteria 1895
16 Ga0055536_1000025 3300003781 Bacteria 183172
17 Ga0055536_1000053 3300003781 Bacteria 110030
18 Ga0055530_10000007 3300003791 Bacteria 183172
19 Ga0055540_1000006 3300003792 Bacteria 372018
20 Ga0055540_1000125 3300003792 Bacteria 79312
21 Ga0055531_10000285 3300003794 Bacteria 51130
22 Ga0055531_10001653 3300003794 Bacteria 16091
23 Ga0055541_1000008 3300003841 Bacteria 399724
24 Ga0065714_10000048 3300005288 Bacteria 23148
25 Ga0065714_10003988 3300005288 Bacteria 6429
26 Ga0065714_10066486 3300005288 Bacteria 6765
27 Ga0065714_10082907 3300005288 Bacteria 2280
28 Ga0065704_10017516 3300005289 Bacteria 1935
29 Ga0070670_100000079 3300005331 Bacteria 92916
30 Ga0070670_100041986 3300005331 Bacteria 3931
31 Ga0070661_100000024 3300005344 Bacteria 121810
32 Ga0070669_100046216 3300005353 Bacteria 3175
33 Ga0070662_100014437 3300005457 Bacteria 5279
34 Ga0068853_100013644 3300005539 Bacteria 6639
35 Ga0070664_100000024 3300005564 Bacteria 94521
36 Ga0068851_10000552 3300005834 Bacteria 16293
37 Ga0075364_10027324 3300006051 Bacteria 3644
38 Ga0075432_10006128 3300006058 Bacteria 4089
39 Ga0075362_10042319 3300006177 Bacteria 2013
40 Ga0105251_10014381 3300009011 Bacteria 4377
41 Ga0105251_10017294 3300009011 Bacteria 3869
42 Ga0105251_10021442 3300009011 Bacteria 3372
43 Ga0105244_10000907 3300009036 Bacteria 25017
44 Ga0105244_10005358 3300009036 Bacteria 8539
45 Ga0105244_10026725 3300009036 Bacteria 3120
46 Ga0105250_10000015 3300009092 Bacteria 262683
47 Ga0105250_10000679 3300009092 Bacteria 21367
48 Ga0105250_10014262 3300009092 Bacteria 3268
49 Ga0105250_10019315 3300009092 Bacteria 2755
50 Ga0105243_10000020 3300009148 Bacteria 214279
51 Ga0105243_10018786 3300009148 Bacteria 5237
52 Ga0105237_10000042 3300009545 Bacteria 181280
53 Ga0105246_10000641 3300011119 Bacteria 19535
54 Ga0157345_1000060 3300012498 Bacteria 23153
55 Ga0157373_10000998 3300013100 Bacteria 21885
56 Ga0157373_10001425 3300013100 Bacteria 18233
57 Ga0157373_10004083 3300013100 Bacteria 10998
58 Ga0157373_10005100 3300013100 Bacteria 9873
59 Ga0157373_10018779 3300013100 Bacteria 5031
60 Ga0157371_10000573 3300013102 Bacteria 43632
61 Ga0157371_10000635 3300013102 Bacteria 41753
62 Ga0157370_10032680 3300013104 Bacteria 5079
63 Ga0157370_10089265 3300013104 Bacteria 2896
64 Ga0157370_10090460 3300013104 Bacteria 2874
65 Ga0157369_10005158 3300013105 Bacteria 15288
66 Ga0157369_10019056 3300013105 Bacteria 7683
67 Ga0157369_10028514 3300013105 Bacteria 6179
68 Ga0163162_10000169 3300013306 Bacteria 60285
69 Ga0163162_10091282 3300013306 Bacteria 3128
70 Ga0157372_10004428 3300013307 Bacteria 14984
71 Ga0157375_10001060 3300013308 Bacteria 23747
72 Ga0157375_10004219 3300013308 Bacteria 12467
73 Ga0182008_10001212 3300014497 Bacteria 17765
74 Ga0182008_10001297 3300014497 Bacteria 17062
75 Ga0182008_10006321 3300014497 Bacteria 6635
76 Ga0182008_10033628 3300014497 Bacteria 2572
77 Ga0182006_1000387 3300015261 Bacteria 36363
78 Ga0182006_1004833 3300015261 Bacteria 6546
79 Ga0182006_1008799 3300015261 Bacteria 4564
80 Ga0182007_10000108 3300015262 Bacteria 57807
81 Ga0182007_10003756 3300015262 Bacteria 7084
82 Ga0182005_1000470 3300015265 Bacteria 20931
83 Ga0182005_1009368 3300015265 Bacteria 2848
84 Ga0163161_10001073 3300017792 Bacteria 20694
85 Ga0163161_10001353 3300017792 Bacteria 18230
86 Ga0163161_10011131 3300017792 Bacteria 6233
87 Ga0163161_10013542 3300017792 Bacteria 5678
88 Ga0163161_10100474 3300017792 Bacteria 2152
89 Ga0163161_10149631 3300017792 Bacteria 1773
90 Ga0209760_100032 3300025207 Bacteria 138015
91 Ga0209760_100036 3300025207 Bacteria 130845
92 Ga0209784_100023 3300025224 Bacteria 399841
93 Ga0209566_100019 3300025225 Bacteria 414836
94 Ga0209674_100034 3300025226 Bacteria 414903
95 Ga0209147_100027 3300025229 Bacteria 414610
96 Ga0209563_100037 3300025230 Bacteria 414903
97 Ga0209563_100298 3300025230 Bacteria 20216
98 Ga0207427_100003 3300025231 Bacteria 1035004
99 Ga0207427_100004 3300025231 Bacteria 939600
100 Ga0209437_100002 3300025233 Bacteria 1574801
101 Ga0209437_100025 3300025233 Bacteria 561333
102 Ga0209258_100166 3300025242 Bacteria 148022
103 Ga0209646_1000318 3300025246 Bacteria 37146
104 Ga0209677_100021 3300025253 Bacteria 414954
105 Ga0209233_1000004 3300025261 Bacteria 1574798
106 Ga0209233_1000145 3300025261 Bacteria 188955
107 Ga0209675_1004196 3300025291 Bacteria 6522
108 Ga0209676_1000002 3300025292 Bacteria 1732948
109 Ga0209676_1000003 3300025292 Bacteria 1454178
110 Ga0209676_1009390 3300025292 Bacteria 4223
111 Ga0209050_1000004 3300025298 Bacteria 1600040
112 Ga0209050_1000006 3300025298 Bacteria 1359702
113 Ga0209051_1000001 3300025303 Bacteria 1732974
114 Ga0209051_1000006 3300025303 Bacteria 1015785
115 Ga0209257_1000029 3300025304 Bacteria 695617
116 Ga0207656_10000769 3300025321 Bacteria 10514
117 Ga0207696_1000002 3300025711 Bacteria 1098043
118 Ga0207696_1000017 3300025711 Bacteria 491130
119 Ga0207696_1002160 3300025711 Bacteria 9859
120 Ga0207696_1012285 3300025711 Bacteria 3033
121 Ga0207655_1000074 3300025728 Bacteria 232056
122 Ga0207655_1000098 3300025728 Bacteria 190699
123 Ga0207655_1000410 3300025728 Bacteria 59117
124 Ga0207655_1002796 3300025728 Bacteria 13554
125 Ga0207655_1004728 3300025728 Bacteria 9515
126 Ga0207713_1000284 3300025735 Bacteria 58743
127 Ga0207713_1001602 3300025735 Bacteria 17673
128 Ga0207713_1006155 3300025735 Bacteria 7368
129 Ga0207671_10000474 3300025914 Bacteria 54456
130 Ga0207649_10000010 3300025920 Bacteria 284354
131 Ga0207681_10003542 3300025923 Bacteria 9722
132 Ga0207650_10000690 3300025925 Bacteria 26485
133 Ga0207706_10002181 3300025933 Bacteria 19100
134 Ga0207686_10011018 3300025934 Bacteria 4936
135 Ga0207709_10000004 3300025935 Bacteria 825156
136 Ga0207709_10004919 3300025935 Bacteria 7646
137 Ga0207679_10000022 3300025945 Bacteria 219036
138 Ga0207639_10028424 3300026041 Bacteria 4083
139 Ga0207428_10017939 3300027907 Bacteria 6063
140 Ga0307509_10153943 3300031507 Bacteria 2209
141 Ga0307405_10000080 3300031731 Bacteria 40630
142 Ga0307510_10003671 3300033180 Bacteria 17922
143 Ga0237819_01218 3300038705 Bacteria 7150
144 Ga0450894_002004 3300042131 Bacteria 2805
145 Ga0450893_0001169 3300042532 Bacteria 3957
146 Ga0495617_040974 3300046452 Bacteria 1548
147 Ga0495627_000031 3300046453 Bacteria 226981
148 Ga0495627_001436 3300046453 Bacteria 13990
149 Ga0495627_003204 3300046453 Bacteria 7362
150 Ga0495592_0033025 3300046454 Bacteria 3904
151 Ga0495603_0045443 3300046455 Bacteria 2619
152 Ga0495603_0073564 3300046455 Bacteria 2008
153 Ga0495590_0000177 3300046457 Bacteria 37380
154 Ga0495590_0006098 3300046457 Bacteria 4726
155 Ga0495590_0011110 3300046457 Bacteria 3374
156 Ga0495590_0021801 3300046457 Bacteria 2268
157 Ga0495591_000465 3300046458 Bacteria 32374
158 Ga0495591_001420 3300046458 Bacteria 14941
159 Ga0495591_008150 3300046458 Bacteria 4325
160 Ga0495591_010354 3300046458 Bacteria 3622
161 Ga0495591_011419 3300046458 Bacteria 3365
162 Ga0495591_013829 3300046458 Bacteria 2931
163 Ga0495638_0027594 3300046460 Bacteria 3673
164 Ga0495638_0045916 3300046460 Bacteria 2746
165 Ga0495653_0000652 3300046463 Bacteria 26457
166 Ga0495653_0002131 3300046463 Bacteria 15606
167 Ga0495653_0004505 3300046463 Bacteria 11249
168 Ga0495653_0044480 3300046463 Bacteria 3445
169 Ga0495650_0003897 3300046471 Bacteria 10547
170 Ga0495650_0004343 3300046471 Bacteria 9772
171 Ga0495650_0007351 3300046471 Bacteria 6636
172 Ga0495650_0009484 3300046471 Bacteria 5527
173 Ga0495605_0000007 3300046474 Bacteria 358289
174 Ga0495605_0009605 3300046474 Bacteria 5433
175 Ga0495605_0012878 3300046474 Bacteria 4629
176 Ga0495605_0033159 3300046474 Bacteria 2623
177 Ga0495605_0035556 3300046474 Bacteria 2517
178 Ga0495639_0000053 3300046475 Bacteria 50537
179 Ga0495639_0017907 3300046475 Bacteria 3079
180 Ga0495584_0003352 3300046491 Bacteria 8847
181 Ga0495585_0010781 3300046492 Bacteria 5430
182 Ga0495585_0012153 3300046492 Bacteria 5077
183 Ga0495585_0012829 3300046492 Bacteria 4927
184 Ga0495585_0023387 3300046492 Bacteria 3546
185 Ga0495594_0005932 3300046499 Bacteria 6279
186 Ga0495594_0026324 3300046499 Bacteria 3128
187 Ga0495607_0000041 3300046501 Bacteria 132443
188 Ga0495607_0004345 3300046501 Bacteria 10459
189 Ga0495607_0006048 3300046501 Bacteria 8568
190 Ga0495607_0007191 3300046501 Bacteria 7732
191 Ga0495607_0007368 3300046501 Bacteria 7618
192 Ga0495607_0047798 3300046501 Bacteria 2504
193 Ga0495583_0000007 3300046506 Bacteria 434661
194 Ga0495583_0000865 3300046506 Bacteria 36805
195 Ga0495583_0009853 3300046506 Bacteria 5653
196 Ga0495583_0021031 3300046506 Bacteria 3362
197 Ga0495606_0008267 3300046507 Bacteria 9081
198 Ga0495606_0011945 3300046507 Bacteria 7018
199 Ga0495606_0013688 3300046507 Bacteria 6390
200 Ga0495606_0017591 3300046507 Bacteria 5396
201 Ga0495606_0018634 3300046507 Bacteria 5196
202 Ga0495606_0035935 3300046507 Bacteria 3381
203 Ga0495606_0068317 3300046507 Bacteria 2248
204 Ga0495606_0084441 3300046507 Bacteria 1966
205 Ga0495610_0000455 3300046512 Bacteria 42440
206 Ga0495610_0005087 3300046512 Bacteria 9475
207 Ga0495610_0007848 3300046512 Bacteria 7020
208 Ga0495610_0016320 3300046512 Bacteria 4282
209 Ga0495616_0000535 3300046513 Bacteria 28683
210 Ga0495616_0001570 3300046513 Bacteria 15739
211 Ga0495616_0008441 3300046513 Bacteria 6101
212 Ga0495616_0016806 3300046513 Bacteria 4043
213 Ga0495620_0000014 3300046515 Bacteria 157890
214 Ga0495620_0001722 3300046515 Bacteria 12919
215 Ga0495620_0005771 3300046515 Bacteria 6877
216 Ga0495620_0009689 3300046515 Bacteria 5113
217 Ga0495620_0011670 3300046515 Bacteria 4572
218 Ga0495620_0021661 3300046515 Bacteria 3117
219 Ga0495631_0000175 3300046518 Bacteria 43711
220 Ga0495631_0000526 3300046518 Bacteria 25725
221 Ga0495631_0005882 3300046518 Bacteria 6391
222 Ga0495632_0005275 3300046519 Bacteria 8585
223 Ga0495632_0006774 3300046519 Bacteria 7316
224 Ga0495632_0014815 3300046519 Bacteria 4397
225 Ga0495632_0022997 3300046519 Bacteria 3334
226 Ga0495632_0038757 3300046519 Bacteria 2411
227 Ga0495637_0000606 3300046520 Bacteria 25539
228 Ga0495637_0005923 3300046520 Bacteria 6178
229 Ga0495637_0008614 3300046520 Bacteria 5004
230 Ga0495637_0031082 3300046520 Bacteria 2364
231 Ga0495637_0040047 3300046520 Bacteria 2019
232 Ga0495643_0007055 3300046522 Bacteria 7295
233 Ga0495648_0002500 3300046524 Bacteria 16867
234 Ga0495648_0002645 3300046524 Bacteria 16251
235 Ga0495648_0006335 3300046524 Bacteria 9679
236 Ga0495648_0035018 3300046524 Bacteria 3259
237 Ga0495666_0000908 3300046526 Bacteria 13883
238 Ga0495666_0014730 3300046526 Bacteria 3890
239 Ga0495666_0038491 3300046526 Bacteria 2325
240 Ga0495642_0000006 3300046528 Bacteria 172412
241 Ga0495642_0001263 3300046528 Bacteria 11491
242 Ga0495654_0000113 3300046530 Bacteria 91858
243 Ga0495654_0000600 3300046530 Bacteria 28665
244 Ga0495654_0010655 3300046530 Bacteria 4993
245 Ga0495654_0013825 3300046530 Bacteria 4308
246 Ga0495654_0024549 3300046530 Bacteria 3112
247 Ga0495654_0025610 3300046530 Bacteria 3038
248 Ga0495654_0052890 3300046530 Bacteria 1975
249 Ga0495587_0003803 3300046536 Bacteria 10014
250 Ga0495587_0022533 3300046536 Bacteria 3878
251 Ga0495609_0000004 3300046538 Bacteria 697346
252 Ga0495609_0001070 3300046538 Bacteria 19166
253 Ga0495609_0001936 3300046538 Bacteria 13176
254 Ga0495609_0002104 3300046538 Bacteria 12506
255 Ga0495609_0010540 3300046538 Bacteria 4432
256 Ga0495609_0041417 3300046538 Bacteria 2070
257 Ga0495597_0000800 3300046542 Bacteria 24862
258 Ga0495597_0004858 3300046542 Bacteria 7242
259 Ga0495597_0019818 3300046542 Bacteria 3141
260 Ga0495645_0013497 3300046543 Bacteria 5777
261 Ga0495622_0000414 3300046557 Bacteria 28333
262 Ga0495622_0002204 3300046557 Bacteria 9500
263 Ga0495622_0004607 3300046557 Bacteria 6385
264 Ga0495622_0005482 3300046557 Bacteria 5884
265 Ga0495622_0009125 3300046557 Bacteria 4591
266 Ga0495622_0028463 3300046557 Bacteria 2610
267 Ga0495622_0028748 3300046557 Bacteria 2597
268 Ga0495633_0000051 3300046558 Bacteria 154944
269 Ga0495633_0003219 3300046558 Bacteria 11022
270 Ga0495633_0009087 3300046558 Bacteria 5523
271 Ga0495634_0000815 3300046642 Bacteria 30341
272 Ga0495634_0016683 3300046642 Bacteria 5247
273 Ga0495611_0000019 3300046648 Bacteria 126076
274 Ga0495611_0001208 3300046648 Bacteria 13357
275 Ga0495611_0013578 3300046648 Bacteria 3470
276 Ga0495611_0015109 3300046648 Bacteria 3299
277 Ga0495625_0004063 3300046660 Bacteria 13985
278 Ga0495625_0037273 3300046660 Bacteria 3568
279 Ga0495625_0061295 3300046660 Bacteria 2662
280 Ga0495635_0021217 3300046663 Bacteria 4527
281 Ga0495659_0000119 3300046664 Bacteria 34751
282 Ga0495659_0011088 3300046664 Bacteria 2903
283 Ga0495661_0000051 3300046665 Bacteria 140353
284 Ga0495661_0000106 3300046665 Bacteria 100351
285 Ga0495661_0000269 3300046665 Bacteria 59794
286 Ga0495661_0005371 3300046665 Bacteria 9110
287 Ga0495661_0021312 3300046665 Bacteria 4226
288 Ga0495661_0025310 3300046665 Bacteria 3834
289 Ga0495661_0053080 3300046665 Bacteria 2440
290 Ga0495588_0002024 3300046674 Bacteria 8670
291 Ga0495588_0010121 3300046674 Bacteria 4375
292 Ga0495623_0002773 3300046679 Bacteria 11575
293 Ga0495623_0043682 3300046679 Bacteria 2850
294 Ga0495646_0003495 3300046680 Bacteria 9782
295 Ga0495646_0012535 3300046680 Bacteria 5388
296 Ga0495669_0001087 3300046684 Bacteria 11253
297 Ga0495669_0006622 3300046684 Bacteria 4847
298 Ga0495613_0011601 3300046689 Bacteria 6548
299 Ga0495613_0030414 3300046689 Bacteria 4011
300 Ga0495613_0055646 3300046689 Bacteria 2906
301 Ga0495624_0000237 3300046690 Bacteria 43145
302 Ga0495670_0000455 3300046691 Bacteria 19525
303 Ga0495670_0009962 3300046691 Bacteria 4671
304 Ga0495670_0011994 3300046691 Bacteria 4265
305 Ga0495671_0003398 3300046692 Bacteria 9791
306 Ga0495671_0032538 3300046692 Bacteria 2662
307 Ga0495671_0032766 3300046692 Bacteria 2651
308 Ga0495671_0084764 3300046692 Bacteria 1553
309 Ga0495649_0000748 3300046694 Bacteria 26199
310 Ga0495649_0002964 3300046694 Bacteria 11692
311 Ga0495649_0005325 3300046694 Bacteria 8208
312 Ga0495649_0008177 3300046694 Bacteria 6307
313 Ga0495649_0013818 3300046694 Bacteria 4646
314 Ga0495649_0047309 3300046694 Bacteria 2339
315 Ga0495589_0000352 3300046794 Bacteria 35927
316 Ga0495589_0006145 3300046794 Bacteria 6344
317 Ga0495589_0013758 3300046794 Bacteria 4173
318 Ga0495589_0025278 3300046794 Bacteria 3014
319 Ga0495589_0038113 3300046794 Bacteria 2407
320 Ga0495600_0004310 3300046809 Bacteria 8515
321 Ga0495660_0007793 3300046810 Bacteria 6287
322 Ga0495660_0007922 3300046810 Bacteria 6239
323 Ga0495660_0008057 3300046810 Bacteria 6191
324 Ga0495660_0010141 3300046810 Bacteria 5476
325 Ga0495660_0034391 3300046810 Bacteria 2836
326 Ga0495660_0035725 3300046810 Bacteria 2775
327 Ga0495581_0019171 3300047315 Bacteria 3970
328 Ga0495674_0009374 3300047319 Bacteria 9306
329 Ga0495672_0000787 3300047320 Bacteria 34376
330 Ga0495672_0002413 3300047320 Bacteria 17233
331 Ga0495672_0003332 3300047320 Bacteria 13842
332 Ga0495672_0011707 3300047320 Bacteria 6169
333 Ga0495672_0016106 3300047320 Bacteria 5051
334 Ga0495672_0018130 3300047320 Bacteria 4685
335 Ga0495672_0018826 3300047320 Bacteria 4573
336 Ga0495672_0021016 3300047320 Bacteria 4263
337 Ga0495672_0028393 3300047320 Bacteria 3541
338 Ga0495676_0000368 3300047321 Bacteria 37132
339 Ga0495676_0001439 3300047321 Bacteria 20535
340 Ga0495676_0017594 3300047321 Bacteria 6315
341 Ga0495680_0055415 3300047322 Bacteria 3075
342 Ga0495680_0095154 3300047322 Bacteria 2227
343 Ga0495680_0110240 3300047322 Bacteria 2040
344 Ga0495683_0000004 3300047323 Bacteria 321136
345 Ga0495683_0000318 3300047323 Bacteria 40455
346 Ga0495683_0000356 3300047323 Bacteria 37720
347 Ga0495683_0006570 3300047323 Bacteria 6343
348 Ga0495683_0011260 3300047323 Bacteria 4711
349 Ga0495683_0023149 3300047323 Bacteria 3193
350 Ga0495683_0027136 3300047323 Bacteria 2929
351 Ga0495683_0041126 3300047323 Bacteria 2333
352 Ga0495687_000977 3300047443 Bacteria 28996
353 Ga0495687_007915 3300047443 Bacteria 6176
354 Ga0495679_000137 3300047446 Bacteria 65769
355 Ga0495679_000171 3300047446 Bacteria 58736
356 Ga0495679_004040 3300047446 Bacteria 6890
357 Ga0495679_004206 3300047446 Bacteria 6701
358 Ga0495679_009192 3300047446 Bacteria 3972
359 Ga0495673_0001451 3300047469 Bacteria 18852
360 Ga0495673_0005021 3300047469 Bacteria 8115
361 Ga0495673_0006444 3300047469 Bacteria 6896
362 Ga0495673_0013259 3300047469 Bacteria 4337
363 Ga0495673_0015824 3300047469 Bacteria 3874
364 Ga0495673_0016735 3300047469 Bacteria 3741
365 Ga0495681_0000478 3300047470 Bacteria 30665
366 Ga0495681_0002364 3300047470 Bacteria 13536
367 Ga0495681_0005548 3300047470 Bacteria 8428
368 Ga0495681_0011741 3300047470 Bacteria 5190
369 Ga0495681_0011854 3300047470 Bacteria 5158
370 Ga0495681_0012026 3300047470 Bacteria 5108
371 Ga0495681_0026819 3300047470 Bacteria 2990
372 Ga0495681_0028170 3300047470 Bacteria 2894
373 Ga0495684_0007118 3300047471 Bacteria 8682
374 Ga0495684_0010777 3300047471 Bacteria 7065
375 Ga0495686_0003002 3300047472 Bacteria 14995
376 Ga0495686_0014588 3300047472 Bacteria 5404
377 Ga0495593_0001207 3300047673 Bacteria 15111
378 Ga0495593_0016466 3300047673 Bacteria 4168
379 Ga0495593_0026775 3300047673 Bacteria 3180
380 Ga0495593_0034451 3300047673 Bacteria 2754
381 Ga0495593_0073381 3300047673 Bacteria 1775
382 Ga0495602_0003908 3300048088 Bacteria 15513
383 Ga0495626_0000064 3300048091 Bacteria 142060
384 Ga0495626_0000616 3300048091 Bacteria 34739
385 Ga0495626_0000958 3300048091 Bacteria 25047
386 Ga0495626_0007427 3300048091 Bacteria 6104
387 Ga0495626_0029031 3300048091 Bacteria 2679
388 Ga0496102_0000774 3300048905 Bacteria 31153
389 Ga0496103_0033811 3300048906 Bacteria 3124
390 Ga0496104_0244380 3300048907 Bacteria 1707
391 Ga0496105_0147565 3300048908 Bacteria 1934
392 Ga0496106_0102144 3300048909 Bacteria 2224
393 Ga0496116_0000382 3300048919 Bacteria 65862
394 Ga0496116_0002706 3300048919 Bacteria 18251
395 Ga0496116_0008609 3300048919 Bacteria 8828
396 Ga0496116_0009233 3300048919 Bacteria 8439
397 Ga0496116_0054568 3300048919 Bacteria 2631
398 Ga0496117_0007085 3300048920 Bacteria 11081
399 Ga0496117_0022162 3300048920 Bacteria 5101
400 Ga0496117_0037737 3300048920 Bacteria 3594
401 Ga0496117_0048903 3300048920 Bacteria 3014
402 Ga0496117_0053943 3300048920 Bacteria 2820
403 Ga0496117_0057377 3300048920 Bacteria 2705
404 Ga0496118_0009595 3300048921 Bacteria 9742
405 Ga0496118_0018594 3300048921 Bacteria 6257
406 Ga0496118_0027819 3300048921 Bacteria 4775
407 Ga0496118_0029914 3300048921 Bacteria 4557
408 Ga0496118_0037697 3300048921 Bacteria 3886
409 Ga0496118_0044807 3300048921 Bacteria 3460
410 Ga0496119_0013764 3300048922 Bacteria 6406
411 Ga0496119_0019342 3300048922 Bacteria 5021
412 Ga0496120_0009871 3300048923 Bacteria 6724
413 Ga0496120_0011884 3300048923 Bacteria 5956
414 Ga0496120_0013171 3300048923 Bacteria 5581
415 Ga0496120_0051741 3300048923 Bacteria 2343
416 Ga0496121_0000589 3300048924 Bacteria 68077
417 Ga0496121_0001708 3300048924 Bacteria 35986
418 Ga0496121_0014964 3300048924 Bacteria 8172
419 Ga0496121_0032565 3300048924 Bacteria 4735
420 Ga0496121_0068490 3300048924 Bacteria 2870
421 Ga0496121_0105614 3300048924 Bacteria 2161
422 Ga0496122_0011011 3300048925 Bacteria 9241
423 Ga0496122_0020192 3300048925 Bacteria 6037
424 Ga0496122_0041565 3300048925 Bacteria 3632
425 Ga0496122_0043894 3300048925 Bacteria 3497
426 Ga0496122_0051450 3300048925 Bacteria 3129
427 Ga0496122_0093534 3300048925 Bacteria 2038
428 Ga0496123_0003547 3300048926 Bacteria 17321
429 Ga0496123_0017509 3300048926 Bacteria 5759
430 Ga0496123_0027501 3300048926 Bacteria 4234
431 Ga0496123_0036587 3300048926 Bacteria 3479
432 Ga0496123_0042638 3300048926 Bacteria 3128
433 Ga0496123_0059533 3300048926 Bacteria 2468
434 Ga0496123_0074914 3300048926 Bacteria 2091
435 Ga0496124_0004348 3300048927 Bacteria 16595
436 Ga0496124_0007542 3300048927 Bacteria 11542
437 Ga0496124_0018066 3300048927 Bacteria 6620
438 Ga0496124_0056531 3300048927 Bacteria 3308
439 Ga0496124_0072065 3300048927 Bacteria 2862
440 Ga0496124_0102748 3300048927 Bacteria 2312
441 Ga0496125_0000641 3300048928 Bacteria 58364
442 Ga0496125_0004187 3300048928 Bacteria 16817
443 Ga0496125_0009776 3300048928 Bacteria 9780
444 Ga0496125_0019631 3300048928 Bacteria 6367
445 Ga0496125_0028884 3300048928 Bacteria 4996
446 Ga0496125_0045691 3300048928 Bacteria 3681
447 Ga0496125_0046986 3300048928 Bacteria 3615
448 Ga0496125_0072651 3300048928 Bacteria 2679
449 Ga0496126_0008374 3300048929 Bacteria 11157
450 Ga0496126_0134535 3300048929 Bacteria 2133
451 Ga0495678_000014 3300049459 Bacteria 313755
452 Ga0495678_000578 3300049459 Bacteria 34746
453 Ga0495678_008704 3300049459 Bacteria 5091
454 Ga0495682_0001018 3300049460 Bacteria 16623
455 Ga0495682_0006818 3300049460 Bacteria 4598
456 Ga0495682_0014656 3300049460 Bacteria 2971
457 Ga0495682_0029320 3300049460 Bacteria 2038
458 nmdc:mga03683_8680_c1 3300050489 Bacteria 3582
459 Ga0500572_000710 3300053111 Bacteria 10800

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005289 Ga0065704_10017516 Ga0065704_100175161 462
2 3300009092 Ga0105250_10000015 Ga0105250_10000015201 462
3 3300017792 Ga0163161_10001073 Ga0163161_100010732 462
4 3300025711 Ga0207696_1000017 Ga0207696_1000017162 462
5 3300046507 Ga0495606_0013688 Ga0495606_0013688_4343_5953 462
6 3300046520 Ga0495637_0040047 Ga0495637_0040047_150_1760 462
7 3300048921 Ga0496118_0018594 Ga0496118_0018594_323_1945 462
8 3300048921 Ga0496118_0029914 Ga0496118_0029914_2450_4072 462
9 3300048924 Ga0496121_0068490 Ga0496121_0068490_854_2476 462
10 3300048928 Ga0496125_0045691 Ga0496125_0045691_375_1997 462
11 3300048928 Ga0496125_0046986 Ga0496125_0046986_1685_3307 462
12 3300025735 Ga0207713_1000284 Ga0207713_100028443 463
13 3300031731 Ga0307405_10000080 Ga0307405_100000802 463
14 3300042131 Ga0450894_002004 Ga0450894_002004_1103_2725 463
15 3300013306 Ga0163162_10091282 Ga0163162_100912822 466
16 3300048927 Ga0496124_0102748 Ga0496124_0102748_430_2052 466
17 3300048925 Ga0496122_0093534 Ga0496122_0093534_261_1883 469
18 3300048926 Ga0496123_0074914 Ga0496123_0074914_209_1831 469
19 3300046463 Ga0495653_0004505 Ga0495653_0004505_4516_6126 470
20 3300013308 Ga0157375_10001060 Ga0157375_1000106016 472
21 3300005344 Ga0070661_100000024 Ga0070661_10000002458 475
22 3300005564 Ga0070664_100000024 Ga0070664_10000002452 475
23 3300009036 Ga0105244_10000907 Ga0105244_1000090717 475
24 3300009545 Ga0105237_10000042 Ga0105237_10000042123 475
25 3300013308 Ga0157375_10004219 Ga0157375_100042192 475
26 3300025728 Ga0207655_1000074 Ga0207655_100007438 475
27 3300025914 Ga0207671_10000474 Ga0207671_1000047443 475
28 3300025920 Ga0207649_10000010 Ga0207649_10000010226 475
29 3300025945 Ga0207679_10000022 Ga0207679_10000022142 475
30 3300009011 Ga0105251_10021442 Ga0105251_100214422 476
31 3300046452 Ga0495617_040974 Ga0495617_040974_19_1455 477
32 3300046507 Ga0495606_0084441 Ga0495606_0084441_512_1954 479
33 3300047320 Ga0495672_0003332 Ga0495672_0003332_4756_6369 479
34 3300047320 Ga0495672_0028393 Ga0495672_0028393_2090_3529 479
35 3300017792 Ga0163161_10011131 Ga0163161_100111316 480
36 3300013100 Ga0157373_10005100 Ga0157373_100051006 486
37 3300015262 Ga0182007_10003756 Ga0182007_100037566 486
38 3300046692 Ga0495671_0084764 Ga0495671_0084764_50_1513 486
39 3300047469 Ga0495673_0013259 Ga0495673_0013259_30_1490 486
40 3300048920 Ga0496117_0053943 Ga0496117_0053943_1065_2630 486
41 3300048921 Ga0496118_0027819 Ga0496118_0027819_2937_4502 486
42 3300048928 Ga0496125_0009776 Ga0496125_0009776_721_2286 490
43 3300013100 Ga0157373_10004083 Ga0157373_100040832 491
44 3300013104 Ga0157370_10090460 Ga0157370_100904602 491
45 3300013105 Ga0157369_10019056 Ga0157369_100190563 491
46 3300025934 Ga0207686_10011018 Ga0207686_100110184 491
47 3300038705 Ga0237819_01218 Ga0237819_01218_1975_3597 493
48 3300013105 Ga0157369_10028514 Ga0157369_100285145 494
49 3300009036 Ga0105244_10005358 Ga0105244_100053587 495
50 3300009092 Ga0105250_10000679 Ga0105250_100006797 495
51 3300009148 Ga0105243_10000020 Ga0105243_10000020146 495
52 3300011119 Ga0105246_10000641 Ga0105246_100006417 495
53 3300013307 Ga0157372_10004428 Ga0157372_100044289 495
54 3300015261 Ga0182006_1008799 Ga0182006_10087991 495
55 3300025711 Ga0207696_1000002 Ga0207696_1000002926 495
56 3300025728 Ga0207655_1000098 Ga0207655_10000984 495
57 3300025935 Ga0207709_10000004 Ga0207709_10000004511 495
58 3300046454 Ga0495592_0033025 Ga0495592_0033025_765_2363 495
59 3300046463 Ga0495653_0000652 Ga0495653_0000652_15380_16978 495
60 3300046526 Ga0495666_0038491 Ga0495666_0038491_692_2290 495
61 3300046536 Ga0495587_0022533 Ga0495587_0022533_1580_3178 495
62 3300046543 Ga0495645_0013497 Ga0495645_0013497_1369_2967 495
63 3300046642 Ga0495634_0016683 Ga0495634_0016683_639_2237 495
64 3300046680 Ga0495646_0012535 Ga0495646_0012535_2220_3818 495
65 3300046689 Ga0495613_0011601 Ga0495613_0011601_4246_5844 495
66 3300046690 Ga0495624_0000237 Ga0495624_0000237_25531_27129 495
67 3300046809 Ga0495600_0004310 Ga0495600_0004310_2911_4509 495
68 3300047320 Ga0495672_0000787 Ga0495672_0000787_25536_27134 495
69 3300047321 Ga0495676_0017594 Ga0495676_0017594_3010_4608 495
70 3300047471 Ga0495684_0007118 Ga0495684_0007118_4046_5644 495
71 3300047673 Ga0495593_0016466 Ga0495593_0016466_1578_3176 495
72 3300048088 Ga0495602_0003908 Ga0495602_0003908_4135_5733 495
73 3300048919 Ga0496116_0009233 Ga0496116_0009233_3192_4790 495
74 3300048921 Ga0496118_0009595 Ga0496118_0009595_1939_3537 495
75 3300048923 Ga0496120_0011884 Ga0496120_0011884_713_2311 495
76 3300048926 Ga0496123_0027501 Ga0496123_0027501_602_2200 495
77 3300048929 Ga0496126_0008374 Ga0496126_0008374_7984_9582 495
78 3300014497 Ga0182008_10006321 Ga0182008_100063216 496
79 3300025230 Ga0209563_100298 Ga0209563_1002987 496
80 3300025728 Ga0207655_1002796 Ga0207655_100279610 496
81 3300046457 Ga0495590_0011110 Ga0495590_0011110_624_2222 496
82 3300046689 Ga0495613_0030414 Ga0495613_0030414_825_2447 496
83 3300048923 Ga0496120_0051741 Ga0496120_0051741_730_2328 496
84 3300048924 Ga0496121_0014964 Ga0496121_0014964_5804_7402 496
85 3300048927 Ga0496124_0018066 Ga0496124_0018066_3551_5149 496
86 3300048928 Ga0496125_0028884 Ga0496125_0028884_2817_4415 496
87 3300048925 Ga0496122_0043894 Ga0496122_0043894_1443_3065 497
88 3300046507 Ga0495606_0035935 Ga0495606_0035935_135_1757 498
89 3300017792 Ga0163161_10149631 Ga0163161_101496311 499
90 3300005331 Ga0070670_100000079 Ga0070670_10000007966 500
91 3300005331 Ga0070670_100041986 Ga0070670_1000419864 500
92 3300013102 Ga0157371_10000573 Ga0157371_1000057338 500
93 3300014497 Ga0182008_10001212 Ga0182008_100012127 500
94 3300025925 Ga0207650_10000690 Ga0207650_1000069014 500
95 3300046665 Ga0495661_0005371 Ga0495661_0005371_6767_8389 500
96 3300048924 Ga0496121_0000589 Ga0496121_0000589_7272_8849 500
97 3300009148 Ga0105243_10018786 Ga0105243_100187865 501
98 3300025935 Ga0207709_10004919 Ga0207709_100049197 501
99 3300048919 Ga0496116_0000382 Ga0496116_0000382_58844_60421 501
100 3300048920 Ga0496117_0022162 Ga0496117_0022162_2597_4174 501
101 3300048925 Ga0496122_0011011 Ga0496122_0011011_812_2389 501
102 3300048926 Ga0496123_0003547 Ga0496123_0003547_14932_16509 501
103 3300042532 Ga0450893_0001169 Ga0450893_0001169_1671_3269 503
104 3300002737 JGI25162J39368_1000065 JGI25162J39368_100006560 504
105 3300002771 JGI25163J39215_1001093 JGI25163J39215_10010932 504
106 3300002772 JGI25164J39214_1000038 JGI25164J39214_100003870 504
107 3300003214 JGI25165J46597_1000126 JGI25165J46597_100012670 504
108 3300025207 Ga0209760_100036 Ga0209760_10003666 504
109 3300025231 Ga0207427_100004 Ga0207427_10000498 504
110 3300025233 Ga0209437_100025 Ga0209437_100025385 504
111 3300025261 Ga0209233_1000145 Ga0209233_100014598 504
112 3300046458 Ga0495591_000465 Ga0495591_000465_7919_9514 504
113 3300047446 Ga0495679_000171 Ga0495679_000171_56316_57938 504
114 3300047470 Ga0495681_0011854 Ga0495681_0011854_2852_4417 504
115 3300013100 Ga0157373_10000998 Ga0157373_1000099816 505
116 3300046648 Ga0495611_0000019 Ga0495611_0000019_22676_24271 505
117 3300017792 Ga0163161_10100474 Ga0163161_101004741 506
118 3300047446 Ga0495679_009192 Ga0495679_009192_804_2402 506
119 3300047470 Ga0495681_0011741 Ga0495681_0011741_1735_3345 508
120 3300048920 Ga0496117_0048903 Ga0496117_0048903_834_2420 510
121 3300046457 Ga0495590_0021801 Ga0495590_0021801_178_1716 511
122 3300046460 Ga0495638_0045916 Ga0495638_0045916_380_1918 511
123 3300046519 Ga0495632_0006774 Ga0495632_0006774_2229_3767 511
124 3300046528 Ga0495642_0001263 Ga0495642_0001263_8187_9725 511
125 3300046530 Ga0495654_0000600 Ga0495654_0000600_24785_26323 511
126 3300046538 Ga0495609_0001936 Ga0495609_0001936_1955_3493 511
127 3300046542 Ga0495597_0019818 Ga0495597_0019818_292_1830 511
128 3300046648 Ga0495611_0013578 Ga0495611_0013578_1076_2614 511
129 3300046664 Ga0495659_0011088 Ga0495659_0011088_54_1592 511
130 3300046694 Ga0495649_0002964 Ga0495649_0002964_3336_4874 511
131 3300047320 Ga0495672_0011707 Ga0495672_0011707_3777_5315 511
132 3300047469 Ga0495673_0005021 Ga0495673_0005021_3663_5201 511
133 3300048909 Ga0496106_0102144 Ga0496106_0102144_13_1551 511
134 3300049459 Ga0495678_000578 Ga0495678_000578_2372_3910 511
135 3300046455 Ga0495603_0045443 Ga0495603_0045443_715_2322 512
136 3300046694 Ga0495649_0005325 Ga0495649_0005325_5313_6920 512
137 3300046810 Ga0495660_0007922 Ga0495660_0007922_711_2327 512
138 3300047321 Ga0495676_0001439 Ga0495676_0001439_2099_3706 512
139 3300006051 Ga0075364_10027324 Ga0075364_100273243 513
140 3300006058 Ga0075432_10006128 Ga0075432_100061282 513
141 3300006177 Ga0075362_10042319 Ga0075362_100423192 513
142 3300025292 Ga0209676_1009390 Ga0209676_10093902 513
143 3300027907 Ga0207428_10017939 Ga0207428_100179392 513
144 3300046455 Ga0495603_0073564 Ga0495603_0073564_179_1795 513
145 3300046457 Ga0495590_0000177 Ga0495590_0000177_25921_27537 513
146 3300046458 Ga0495591_008150 Ga0495591_008150_305_1921 513
147 3300046458 Ga0495591_011419 Ga0495591_011419_1513_3138 513
148 3300046463 Ga0495653_0002131 Ga0495653_0002131_2414_4033 513
149 3300046471 Ga0495650_0003897 Ga0495650_0003897_5137_6762 513
150 3300046474 Ga0495605_0000007 Ga0495605_0000007_337217_338842 513
151 3300046474 Ga0495605_0009605 Ga0495605_0009605_1466_3082 513
152 3300046474 Ga0495605_0012878 Ga0495605_0012878_734_2320 513
153 3300046475 Ga0495639_0017907 Ga0495639_0017907_1347_2930 513
154 3300046501 Ga0495607_0047798 Ga0495607_0047798_785_2395 513
155 3300046506 Ga0495583_0000007 Ga0495583_0000007_295684_297309 513
156 3300046506 Ga0495583_0009853 Ga0495583_0009853_783_2399 513
157 3300046512 Ga0495610_0000455 Ga0495610_0000455_33014_34630 513
158 3300046515 Ga0495620_0000014 Ga0495620_0000014_130487_132112 513
159 3300046518 Ga0495631_0005882 Ga0495631_0005882_48_1673 513
160 3300046520 Ga0495637_0031082 Ga0495637_0031082_576_2201 513
161 3300046524 Ga0495648_0002500 Ga0495648_0002500_10599_12215 513
162 3300046524 Ga0495648_0006335 Ga0495648_0006335_1020_2645 513
163 3300046526 Ga0495666_0000908 Ga0495666_0000908_5749_7335 513
164 3300046528 Ga0495642_0000006 Ga0495642_0000006_24710_26326 513
165 3300046530 Ga0495654_0013825 Ga0495654_0013825_2460_4043 513
166 3300046530 Ga0495654_0025610 Ga0495654_0025610_1057_2673 513
167 3300046538 Ga0495609_0000004 Ga0495609_0000004_339444_341069 513
168 3300046542 Ga0495597_0000800 Ga0495597_0000800_5434_7059 513
169 3300046557 Ga0495622_0004607 Ga0495622_0004607_352_1968 513
170 3300046557 Ga0495622_0005482 Ga0495622_0005482_1531_3114 513
171 3300046557 Ga0495622_0028748 Ga0495622_0028748_186_1772 513
172 3300046558 Ga0495633_0000051 Ga0495633_0000051_130212_131837 513
173 3300046648 Ga0495611_0001208 Ga0495611_0001208_4655_6280 513
174 3300046665 Ga0495661_0000051 Ga0495661_0000051_85725_87335 513
175 3300046665 Ga0495661_0000106 Ga0495661_0000106_33482_35107 513
176 3300046674 Ga0495588_0002024 Ga0495588_0002024_6627_8243 513
177 3300046679 Ga0495623_0002773 Ga0495623_0002773_8949_10535 513
178 3300046684 Ga0495669_0006622 Ga0495669_0006622_3165_4781 513
179 3300046692 Ga0495671_0032766 Ga0495671_0032766_705_2321 513
180 3300046694 Ga0495649_0000748 Ga0495649_0000748_2124_3740 513
181 3300046694 Ga0495649_0013818 Ga0495649_0013818_2664_4280 513
182 3300046794 Ga0495589_0038113 Ga0495589_0038113_276_1892 513
183 3300047320 Ga0495672_0002413 Ga0495672_0002413_11093_12709 513
184 3300047320 Ga0495672_0018130 Ga0495672_0018130_455_2071 513
185 3300047320 Ga0495672_0018826 Ga0495672_0018826_559_2175 513
186 3300047322 Ga0495680_0095154 Ga0495680_0095154_326_1909 513
187 3300047323 Ga0495683_0000004 Ga0495683_0000004_135211_136836 513
188 3300047323 Ga0495683_0000318 Ga0495683_0000318_26311_27864 513
189 3300047323 Ga0495683_0011260 Ga0495683_0011260_2846_4471 513
190 3300047323 Ga0495683_0027136 Ga0495683_0027136_599_2215 513
191 3300047446 Ga0495679_000137 Ga0495679_000137_41190_42815 513
192 3300047446 Ga0495679_004040 Ga0495679_004040_2080_3666 513
193 3300047470 Ga0495681_0005548 Ga0495681_0005548_2470_4056 513
194 3300047471 Ga0495684_0010777 Ga0495684_0010777_745_2331 513
195 3300047673 Ga0495593_0001207 Ga0495593_0001207_8063_9649 513
196 3300048091 Ga0495626_0000064 Ga0495626_0000064_115631_117247 513
197 3300048091 Ga0495626_0000958 Ga0495626_0000958_23121_24737 513
198 3300048091 Ga0495626_0029031 Ga0495626_0029031_662_2245 513
199 3300048924 Ga0496121_0105614 Ga0496121_0105614_52_1647 513
200 3300048926 Ga0496123_0042638 Ga0496123_0042638_1244_2794 513
201 3300048926 Ga0496123_0059533 Ga0496123_0059533_268_1860 513
202 3300048927 Ga0496124_0007542 Ga0496124_0007542_5318_6910 513
203 3300048929 Ga0496126_0134535 Ga0496126_0134535_375_1967 513
204 3300049459 Ga0495678_000014 Ga0495678_000014_177533_179158 513
205 3300049460 Ga0495682_0006818 Ga0495682_0006818_1589_3214 513
206 3300050489 nmdc:mga03683_8680_c1 nmdc:mga03683_8680_c1_1659_3242 513
207 iso_pu_bacteria 2511231015 2511321307 513
208 iso_pu_bacteria 2511231017 2511334575 513
209 iso_pu_bacteria 2511231020 2511351794 513
210 iso_pu_bacteria 2738543015 2739258759 513
211 iso_pu_bacteria 2765235841 2765584025 513
212 iso_pu_bacteria 8054929484 8054932682 513
213 2124908027 MRS2a_Contig_19 MRS2a_00089370 514
214 2124908027 MRS2a_Contig_6878 MRS2a_00723730 514
215 3300002737 JGI25162J39368_1000004 JGI25162J39368_100000480 514
216 3300002771 JGI25163J39215_1000179 JGI25163J39215_10001792 514
217 3300002772 JGI25164J39214_1000031 JGI25164J39214_100003181 514
218 3300003214 JGI25165J46597_1000011 JGI25165J46597_100001180 514
219 3300003752 Ga0055539_1000011 Ga0055539_1000011161 514
220 3300003756 Ga0055533_1000014 Ga0055533_1000014161 514
221 3300003758 Ga0055532_1000009 Ga0055532_1000009161 514
222 3300003759 Ga0055525_1000016 Ga0055525_1000016161 514
223 3300003761 Ga0055535_1008273 Ga0055535_10082732 514
224 3300003781 Ga0055536_1000025 Ga0055536_1000025141 514
225 3300003781 Ga0055536_1000053 Ga0055536_100005387 514
226 3300003791 Ga0055530_10000007 Ga0055530_10000007141 514
227 3300003792 Ga0055540_1000006 Ga0055540_100000616 514
228 3300003792 Ga0055540_1000125 Ga0055540_100012518 514
229 3300003794 Ga0055531_10000285 Ga0055531_1000028548 514
230 3300003794 Ga0055531_10001653 Ga0055531_100016534 514
231 3300003841 Ga0055541_1000008 Ga0055541_1000008161 514
232 3300005288 Ga0065714_10000048 Ga0065714_1000004817 514
233 3300005288 Ga0065714_10003988 Ga0065714_100039886 514
234 3300005288 Ga0065714_10066486 Ga0065714_100664866 514
235 3300005288 Ga0065714_10082907 Ga0065714_100829071 514
236 3300005353 Ga0070669_100046216 Ga0070669_1000462162 514
237 3300005457 Ga0070662_100014437 Ga0070662_1000144375 514
238 3300005539 Ga0068853_100013644 Ga0068853_1000136443 514
239 3300005834 Ga0068851_10000552 Ga0068851_100005524 514
240 3300009011 Ga0105251_10014381 Ga0105251_100143812 514
241 3300009011 Ga0105251_10017294 Ga0105251_100172943 514
242 3300009036 Ga0105244_10026725 Ga0105244_100267252 514
243 3300009092 Ga0105250_10014262 Ga0105250_100142623 514
244 3300009092 Ga0105250_10019315 Ga0105250_100193153 514
245 3300012498 Ga0157345_1000060 Ga0157345_10000607 514
246 3300013100 Ga0157373_10001425 Ga0157373_100014257 514
247 3300013100 Ga0157373_10018779 Ga0157373_100187794 514
248 3300013102 Ga0157371_10000635 Ga0157371_100006354 514
249 3300013104 Ga0157370_10032680 Ga0157370_100326803 514
250 3300013104 Ga0157370_10089265 Ga0157370_100892652 514
251 3300013105 Ga0157369_10005158 Ga0157369_1000515812 514
252 3300013306 Ga0163162_10000169 Ga0163162_1000016924 514
253 3300014497 Ga0182008_10001297 Ga0182008_100012972 514
254 3300014497 Ga0182008_10033628 Ga0182008_100336282 514
255 3300015261 Ga0182006_1000387 Ga0182006_10003875 514
256 3300015261 Ga0182006_1004833 Ga0182006_10048335 514
257 3300015262 Ga0182007_10000108 Ga0182007_1000010844 514
258 3300015265 Ga0182005_1000470 Ga0182005_100047017 514
259 3300015265 Ga0182005_1009368 Ga0182005_10093682 514
260 3300017792 Ga0163161_10001353 Ga0163161_100013532 514
261 3300017792 Ga0163161_10013542 Ga0163161_100135425 514
262 3300025207 Ga0209760_100032 Ga0209760_10003256 514
263 3300025224 Ga0209784_100023 Ga0209784_100023159 514
264 3300025225 Ga0209566_100019 Ga0209566_100019172 514
265 3300025226 Ga0209674_100034 Ga0209674_100034172 514
266 3300025229 Ga0209147_100027 Ga0209147_100027174 514
267 3300025230 Ga0209563_100037 Ga0209563_100037172 514
268 3300025231 Ga0207427_100003 Ga0207427_10000380 514
269 3300025233 Ga0209437_100002 Ga0209437_100002933 514
270 3300025242 Ga0209258_100166 Ga0209258_1001665 514
271 3300025246 Ga0209646_1000318 Ga0209646_100031829 514
272 3300025253 Ga0209677_100021 Ga0209677_100021172 514
273 3300025261 Ga0209233_1000004 Ga0209233_1000004492 514
274 3300025291 Ga0209675_1004196 Ga0209675_10041964 514
275 3300025292 Ga0209676_1000002 Ga0209676_1000002980 514
276 3300025292 Ga0209676_1000003 Ga0209676_1000003680 514
277 3300025298 Ga0209050_1000004 Ga0209050_1000004662 514
278 3300025298 Ga0209050_1000006 Ga0209050_1000006590 514
279 3300025303 Ga0209051_1000001 Ga0209051_1000001980 514
280 3300025303 Ga0209051_1000006 Ga0209051_1000006313 514
281 3300025304 Ga0209257_1000029 Ga0209257_1000029590 514
282 3300025321 Ga0207656_10000769 Ga0207656_100007695 514
283 3300025711 Ga0207696_1002160 Ga0207696_10021605 514
284 3300025711 Ga0207696_1012285 Ga0207696_10122852 514
285 3300025728 Ga0207655_1000410 Ga0207655_100041035 514
286 3300025728 Ga0207655_1004728 Ga0207655_10047284 514
287 3300025735 Ga0207713_1001602 Ga0207713_10016025 514
288 3300025735 Ga0207713_1006155 Ga0207713_10061557 514
289 3300025923 Ga0207681_10003542 Ga0207681_100035422 514
290 3300025933 Ga0207706_10002181 Ga0207706_1000218119 514
291 3300026041 Ga0207639_10028424 Ga0207639_100284243 514
292 3300031507 Ga0307509_10153943 Ga0307509_101539432 514
293 3300033180 Ga0307510_10003671 Ga0307510_100036717 514
294 3300046453 Ga0495627_000031 Ga0495627_000031_10997_12592 514
295 3300046453 Ga0495627_001436 Ga0495627_001436_9965_11587 514
296 3300046453 Ga0495627_003204 Ga0495627_003204_2912_4507 514
297 3300046457 Ga0495590_0006098 Ga0495590_0006098_216_1811 514
298 3300046458 Ga0495591_001420 Ga0495591_001420_9937_11505 514
299 3300046458 Ga0495591_010354 Ga0495591_010354_611_2206 514
300 3300046458 Ga0495591_013829 Ga0495591_013829_701_2296 514
301 3300046460 Ga0495638_0027594 Ga0495638_0027594_730_2352 514
302 3300046463 Ga0495653_0044480 Ga0495653_0044480_1055_2650 514
303 3300046471 Ga0495650_0004343 Ga0495650_0004343_4939_6561 514
304 3300046471 Ga0495650_0007351 Ga0495650_0007351_3081_4703 514
305 3300046471 Ga0495650_0009484 Ga0495650_0009484_1420_3009 514
306 3300046474 Ga0495605_0033159 Ga0495605_0033159_650_2248 514
307 3300046474 Ga0495605_0035556 Ga0495605_0035556_290_1885 514
308 3300046475 Ga0495639_0000053 Ga0495639_0000053_45069_46691 514
309 3300046491 Ga0495584_0003352 Ga0495584_0003352_736_2331 514
310 3300046492 Ga0495585_0010781 Ga0495585_0010781_663_2258 514
311 3300046492 Ga0495585_0012153 Ga0495585_0012153_3165_4751 514
312 3300046492 Ga0495585_0012829 Ga0495585_0012829_3043_4641 514
313 3300046492 Ga0495585_0023387 Ga0495585_0023387_1885_3510 514
314 3300046499 Ga0495594_0005932 Ga0495594_0005932_2007_3551 514
315 3300046499 Ga0495594_0026324 Ga0495594_0026324_1430_3052 514
316 3300046501 Ga0495607_0000041 Ga0495607_0000041_124168_125790 514
317 3300046501 Ga0495607_0004345 Ga0495607_0004345_5589_7184 514
318 3300046501 Ga0495607_0006048 Ga0495607_0006048_1885_3474 514
319 3300046501 Ga0495607_0007191 Ga0495607_0007191_4872_6494 514
320 3300046501 Ga0495607_0007368 Ga0495607_0007368_1601_3223 514
321 3300046506 Ga0495583_0000865 Ga0495583_0000865_4772_6394 514
322 3300046506 Ga0495583_0021031 Ga0495583_0021031_734_2356 514
323 3300046507 Ga0495606_0008267 Ga0495606_0008267_4073_5695 514
324 3300046507 Ga0495606_0011945 Ga0495606_0011945_1468_3063 514
325 3300046507 Ga0495606_0017591 Ga0495606_0017591_616_2217 514
326 3300046507 Ga0495606_0018634 Ga0495606_0018634_766_2361 514
327 3300046507 Ga0495606_0068317 Ga0495606_0068317_186_1781 514
328 3300046512 Ga0495610_0005087 Ga0495610_0005087_4593_6152 514
329 3300046512 Ga0495610_0007848 Ga0495610_0007848_5334_6932 514
330 3300046512 Ga0495610_0016320 Ga0495610_0016320_443_2032 514
331 3300046513 Ga0495616_0000535 Ga0495616_0000535_24234_25829 514
332 3300046513 Ga0495616_0001570 Ga0495616_0001570_7366_8961 514
333 3300046513 Ga0495616_0008441 Ga0495616_0008441_3707_5329 514
334 3300046513 Ga0495616_0016806 Ga0495616_0016806_570_2159 514
335 3300046515 Ga0495620_0001722 Ga0495620_0001722_2059_3654 514
336 3300046515 Ga0495620_0005771 Ga0495620_0005771_4475_6040 514
337 3300046515 Ga0495620_0009689 Ga0495620_0009689_3012_4598 514
338 3300046515 Ga0495620_0011670 Ga0495620_0011670_2059_3654 514
339 3300046515 Ga0495620_0021661 Ga0495620_0021661_438_2054 514
340 3300046518 Ga0495631_0000175 Ga0495631_0000175_38614_40203 514
341 3300046518 Ga0495631_0000526 Ga0495631_0000526_8211_9806 514
342 3300046519 Ga0495632_0005275 Ga0495632_0005275_1455_3050 514
343 3300046519 Ga0495632_0014815 Ga0495632_0014815_647_2215 514
344 3300046519 Ga0495632_0022997 Ga0495632_0022997_642_2237 514
345 3300046519 Ga0495632_0038757 Ga0495632_0038757_750_2345 514
346 3300046520 Ga0495637_0000606 Ga0495637_0000606_7330_8925 514
347 3300046520 Ga0495637_0005923 Ga0495637_0005923_3008_4603 514
348 3300046520 Ga0495637_0008614 Ga0495637_0008614_564_2159 514
349 3300046522 Ga0495643_0007055 Ga0495643_0007055_1265_2863 514
350 3300046524 Ga0495648_0002645 Ga0495648_0002645_6788_8383 514
351 3300046524 Ga0495648_0035018 Ga0495648_0035018_1627_3213 514
352 3300046526 Ga0495666_0014730 Ga0495666_0014730_615_2237 514
353 3300046530 Ga0495654_0000113 Ga0495654_0000113_85480_87102 514
354 3300046530 Ga0495654_0010655 Ga0495654_0010655_649_2214 514
355 3300046530 Ga0495654_0024549 Ga0495654_0024549_925_2514 514
356 3300046530 Ga0495654_0052890 Ga0495654_0052890_32_1654 514
357 3300046536 Ga0495587_0003803 Ga0495587_0003803_6843_8441 514
358 3300046538 Ga0495609_0001070 Ga0495609_0001070_7970_9565 514
359 3300046538 Ga0495609_0002104 Ga0495609_0002104_5533_7128 514
360 3300046538 Ga0495609_0010540 Ga0495609_0010540_2059_3654 514
361 3300046538 Ga0495609_0041417 Ga0495609_0041417_247_1872 514
362 3300046542 Ga0495597_0004858 Ga0495597_0004858_4371_5966 514
363 3300046557 Ga0495622_0000414 Ga0495622_0000414_2210_3805 514
364 3300046557 Ga0495622_0002204 Ga0495622_0002204_3893_5515 514
365 3300046557 Ga0495622_0009125 Ga0495622_0009125_1553_3097 514
366 3300046557 Ga0495622_0028463 Ga0495622_0028463_941_2503 514
367 3300046558 Ga0495633_0003219 Ga0495633_0003219_5443_7038 514
368 3300046558 Ga0495633_0009087 Ga0495633_0009087_2682_4271 514
369 3300046642 Ga0495634_0000815 Ga0495634_0000815_3381_4979 514
370 3300046648 Ga0495611_0015109 Ga0495611_0015109_38_1633 514
371 3300046660 Ga0495625_0004063 Ga0495625_0004063_5428_7023 514
372 3300046660 Ga0495625_0037273 Ga0495625_0037273_727_2316 514
373 3300046660 Ga0495625_0061295 Ga0495625_0061295_279_1874 514
374 3300046663 Ga0495635_0021217 Ga0495635_0021217_738_2336 514
375 3300046664 Ga0495659_0000119 Ga0495659_0000119_3716_5338 514
376 3300046665 Ga0495661_0000269 Ga0495661_0000269_5288_6856 514
377 3300046665 Ga0495661_0021312 Ga0495661_0021312_599_2194 514
378 3300046665 Ga0495661_0025310 Ga0495661_0025310_744_2333 514
379 3300046665 Ga0495661_0053080 Ga0495661_0053080_220_1815 514
380 3300046674 Ga0495588_0010121 Ga0495588_0010121_586_2130 514
381 3300046679 Ga0495623_0043682 Ga0495623_0043682_526_2124 514
382 3300046680 Ga0495646_0003495 Ga0495646_0003495_6385_7983 514
383 3300046684 Ga0495669_0001087 Ga0495669_0001087_6238_7782 514
384 3300046689 Ga0495613_0055646 Ga0495613_0055646_577_2175 514
385 3300046691 Ga0495670_0000455 Ga0495670_0000455_9954_11549 514
386 3300046691 Ga0495670_0009962 Ga0495670_0009962_2632_4257 514
387 3300046691 Ga0495670_0011994 Ga0495670_0011994_406_2028 514
388 3300046692 Ga0495671_0003398 Ga0495671_0003398_5368_6963 514
389 3300046692 Ga0495671_0032538 Ga0495671_0032538_36_1631 514
390 3300046694 Ga0495649_0008177 Ga0495649_0008177_4062_5657 514
391 3300046694 Ga0495649_0047309 Ga0495649_0047309_157_1746 514
392 3300046794 Ga0495589_0000352 Ga0495589_0000352_25328_26923 514
393 3300046794 Ga0495589_0006145 Ga0495589_0006145_652_2274 514
394 3300046794 Ga0495589_0013758 Ga0495589_0013758_2060_3682 514
395 3300046794 Ga0495589_0025278 Ga0495589_0025278_585_2174 514
396 3300046810 Ga0495660_0007793 Ga0495660_0007793_1442_3037 514
397 3300046810 Ga0495660_0008057 Ga0495660_0008057_1415_3010 514
398 3300046810 Ga0495660_0010141 Ga0495660_0010141_1235_2830 514
399 3300046810 Ga0495660_0034391 Ga0495660_0034391_606_2201 514
400 3300046810 Ga0495660_0035725 Ga0495660_0035725_556_2145 514
401 3300047315 Ga0495581_0019171 Ga0495581_0019171_616_2238 514
402 3300047319 Ga0495674_0009374 Ga0495674_0009374_5751_7349 514
403 3300047320 Ga0495672_0016106 Ga0495672_0016106_544_2139 514
404 3300047320 Ga0495672_0021016 Ga0495672_0021016_2631_4217 514
405 3300047321 Ga0495676_0000368 Ga0495676_0000368_10135_11730 514
406 3300047322 Ga0495680_0055415 Ga0495680_0055415_937_2523 514
407 3300047322 Ga0495680_0110240 Ga0495680_0110240_320_1918 514
408 3300047323 Ga0495683_0000356 Ga0495683_0000356_33744_35333 514
409 3300047323 Ga0495683_0006570 Ga0495683_0006570_4133_5728 514
410 3300047323 Ga0495683_0023149 Ga0495683_0023149_107_1729 514
411 3300047323 Ga0495683_0041126 Ga0495683_0041126_635_2230 514
412 3300047443 Ga0495687_000977 Ga0495687_000977_5770_7395 514
413 3300047443 Ga0495687_007915 Ga0495687_007915_3822_5444 514
414 3300047446 Ga0495679_004206 Ga0495679_004206_4436_6034 514
415 3300047469 Ga0495673_0001451 Ga0495673_0001451_2356_3945 514
416 3300047469 Ga0495673_0006444 Ga0495673_0006444_1204_2799 514
417 3300047469 Ga0495673_0015824 Ga0495673_0015824_1720_3267 514
418 3300047469 Ga0495673_0016735 Ga0495673_0016735_288_1883 514
419 3300047470 Ga0495681_0000478 Ga0495681_0000478_18370_19965 514
420 3300047470 Ga0495681_0002364 Ga0495681_0002364_5287_6909 514
421 3300047470 Ga0495681_0012026 Ga0495681_0012026_657_2252 514
422 3300047470 Ga0495681_0026819 Ga0495681_0026819_179_1774 514
423 3300047470 Ga0495681_0028170 Ga0495681_0028170_470_2038 514
424 3300047472 Ga0495686_0003002 Ga0495686_0003002_9227_10822 514
425 3300047472 Ga0495686_0014588 Ga0495686_0014588_3028_4623 514
426 3300047673 Ga0495593_0026775 Ga0495593_0026775_424_2046 514
427 3300047673 Ga0495593_0034451 Ga0495593_0034451_321_1907 514
428 3300047673 Ga0495593_0073381 Ga0495593_0073381_206_1753 514
429 3300048091 Ga0495626_0000616 Ga0495626_0000616_30770_32392 514
430 3300048091 Ga0495626_0007427 Ga0495626_0007427_534_2129 514
431 3300048905 Ga0496102_0000774 Ga0496102_0000774_25519_27117 514
432 3300048906 Ga0496103_0033811 Ga0496103_0033811_821_2419 514
433 3300048907 Ga0496104_0244380 Ga0496104_0244380_75_1697 514
434 3300048908 Ga0496105_0147565 Ga0496105_0147565_110_1732 514
435 3300048919 Ga0496116_0002706 Ga0496116_0002706_15891_17486 514
436 3300048919 Ga0496116_0008609 Ga0496116_0008609_3497_5119 514
437 3300048919 Ga0496116_0054568 Ga0496116_0054568_837_2435 514
438 3300048920 Ga0496117_0007085 Ga0496117_0007085_4325_5947 514
439 3300048920 Ga0496117_0037737 Ga0496117_0037737_283_1905 514
440 3300048920 Ga0496117_0057377 Ga0496117_0057377_102_1724 514
441 3300048921 Ga0496118_0037697 Ga0496118_0037697_1733_3331 514
442 3300048921 Ga0496118_0044807 Ga0496118_0044807_203_1825 514
443 3300048922 Ga0496119_0013764 Ga0496119_0013764_4158_5780 514
444 3300048922 Ga0496119_0019342 Ga0496119_0019342_3345_4967 514
445 3300048923 Ga0496120_0009871 Ga0496120_0009871_664_2286 514
446 3300048923 Ga0496120_0013171 Ga0496120_0013171_3316_4938 514
447 3300048924 Ga0496121_0001708 Ga0496121_0001708_30637_32259 514
448 3300048924 Ga0496121_0032565 Ga0496121_0032565_2678_4243 514
449 3300048925 Ga0496122_0020192 Ga0496122_0020192_3685_5283 514
450 3300048925 Ga0496122_0041565 Ga0496122_0041565_1547_3169 514
451 3300048925 Ga0496122_0051450 Ga0496122_0051450_861_2483 514
452 3300048926 Ga0496123_0017509 Ga0496123_0017509_720_2318 514
453 3300048926 Ga0496123_0036587 Ga0496123_0036587_1619_3241 514
454 3300048927 Ga0496124_0004348 Ga0496124_0004348_9974_11596 514
455 3300048927 Ga0496124_0056531 Ga0496124_0056531_1578_3200 514
456 3300048927 Ga0496124_0072065 Ga0496124_0072065_929_2551 514
457 3300048928 Ga0496125_0000641 Ga0496125_0000641_56004_57602 514
458 3300048928 Ga0496125_0004187 Ga0496125_0004187_9975_11597 514
459 3300048928 Ga0496125_0019631 Ga0496125_0019631_4121_5743 514
460 3300048928 Ga0496125_0072651 Ga0496125_0072651_549_2138 514
461 3300049459 Ga0495678_008704 Ga0495678_008704_748_2343 514
462 3300049460 Ga0495682_0001018 Ga0495682_0001018_5423_7018 514
463 3300049460 Ga0495682_0014656 Ga0495682_0014656_653_2275 514
464 3300049460 Ga0495682_0029320 Ga0495682_0029320_335_1930 514
465 3300053111 Ga0500572_000710 Ga0500572_000710_3957_5552 514
466 iso_pu_bacteria 2511231004 2511255179 514
467 iso_pu_bacteria 2511231006 2511265495 514
468 iso_pu_bacteria 2511231007 2511271807 514
469 iso_pu_bacteria 2511231010 2511288053 514
470 iso_pu_bacteria 2511231011 2511298697 514
471 iso_pu_bacteria 2511231014 2511312483 514
472 iso_pu_bacteria 2511231016 2511329403 514
473 iso_pu_bacteria 2511231031 2511411654 514
474 iso_pu_bacteria 2554235341 2555670022 514
475 iso_pu_bacteria 2597489888 2597863936 514
476 iso_pu_bacteria 2599185160 2599352942 514
477 iso_pu_bacteria 2599185161 2599359294 514
478 iso_pu_bacteria 2599185162 2599365185 514
479 iso_pu_bacteria 2599185163 2599371988 514
480 iso_pu_bacteria 2599185164 2599378050 514
481 iso_pu_bacteria 2599185165 2599384573 514
482 iso_pu_bacteria 2599185166 2599390846 514
483 iso_pu_bacteria 2599185167 2599398333 514
484 iso_pu_bacteria 2599185168 2599403031 514
485 iso_pu_bacteria 2599185179 2599450355 514
486 iso_pu_bacteria 2599185181 2599459776 514
487 iso_pu_bacteria 2599185182 2599465878 514
488 iso_pu_bacteria 2599185186 2599488797 514
489 iso_pu_bacteria 2599185189 2599507371 514
490 iso_pu_bacteria 2599185190 2599512837 514
491 iso_pu_bacteria 2599185191 2599522143 514
492 iso_pu_bacteria 2599185288 2599881327 514
493 iso_pu_bacteria 2599185290 2599891514 514
494 iso_pu_bacteria 2599185303 2599946653 514
495 iso_pu_bacteria 2599185356 2600212383 514
496 iso_pu_bacteria 2600255296 2601691877 514
497 iso_pu_bacteria 2600255313 2601772551 514
498 iso_pu_bacteria 2600255318 2601798968 514
499 iso_pu_bacteria 2603880185 2606077864 514
500 iso_pu_bacteria 2603880199 2606129961 514
501 iso_pu_bacteria 2619619299 2621299896 514
502 iso_pu_bacteria 2623620443 2624480910 514
503 iso_pu_bacteria 2623620446 2624492215 514
504 iso_pu_bacteria 2643221571 2643874220 514
505 iso_pu_bacteria 2643221713 2644620206 514
506 iso_pu_bacteria 2667528171 2671095474 514
507 iso_pu_bacteria 2675903420 2677896547 514
508 iso_pu_bacteria 2713897149 2715756963 514
509 iso_pu_bacteria 2721755607 2723248724 514
510 iso_pu_bacteria 2738541265 2738669893 514
511 iso_pu_bacteria 2738541282 2738748286 514
512 iso_pu_bacteria 2738541294 2738806844 514
513 iso_pu_bacteria 2738541303 2738857328 514
514 iso_pu_bacteria 2738541309 2738894204 514
515 iso_pu_bacteria 2738543004 2739197524 514
516 iso_pu_bacteria 2738543025 2739311830 514
517 iso_pu_bacteria 2773857670 2774122513 514
518 iso_pu_bacteria 2773857673 2774133712 514
519 iso_pu_bacteria 2784132063 2784264527 514
520 iso_pu_bacteria 2784132072 2784314654 514
521 iso_pu_bacteria 2808606377 2808929139 514
522 iso_pu_bacteria 2808606381 2808951260 514
523 iso_pu_bacteria 2808606385 2808979109 514
524 iso_pu_bacteria 2808606388 2808995008 514
525 iso_pu_bacteria 2816332298 2817491189 514
526 iso_pu_bacteria 2818991456 2819658807 514
527 iso_pu_bacteria 2818991464 2819701049 514
528 iso_pu_bacteria 2834028612 2834034028 514
529 iso_pu_bacteria 2842826826 2842826945 514
530 iso_pu_bacteria 2842837860 2842839284 514
531 iso_pu_bacteria 2844665904 2844670649 514
532 iso_pu_bacteria 2852612431 2852614447 514
533 iso_pu_bacteria 2852657418 2852662055 514
534 iso_pu_bacteria 2852667396 2852667815 514
535 iso_pu_bacteria 2860339153 2860342763 514
536 iso_pu_bacteria 2878029506 2878032842 514
537 iso_pu_bacteria 2880230671 2880233417 514
538 iso_pu_bacteria 2904518522 2904520221 514
539 iso_pu_bacteria 2904550169 2904552452 514
540 iso_pu_bacteria 2908446538 2908449749 514
541 iso_pu_bacteria 2917070673 2917073845 514
542 iso_pu_bacteria 2919063839 2919064863 514
543 iso_pu_bacteria 2919456309 2919460664 514
544 iso_pu_bacteria 2919697872 2919698401 514
545 iso_pu_bacteria 2929189879 2929192615 514
546 iso_pu_bacteria 2931390751 2931393999 514
547 iso_pu_bacteria 2935353572 2935357100 514
548 iso_pu_bacteria 2945928738 2945933470 514
549 iso_pu_bacteria 2945961074 2945963423 514
550 iso_pu_bacteria 2946006987 2946009776 514
551 iso_pu_bacteria 2969304461 2969307623 514
552 iso_pu_bacteria 2984286254 2984289459 514
553 iso_pu_bacteria 3007619802 3007624039 514
554 iso_pu_bacteria 3007718800 3007719866 514
555 iso_pu_bacteria 637000220 637320390 514
556 iso_pu_bacteria 8019769354 8019773209 514
557 iso_pu_bacteria 8019775933 8019779170 514
558 iso_pu_bacteria 8054285046 8054286653 514
559 iso_pu_bacteria 8054347763 8054352282 514
560 iso_pu_bacteria 8054503363 8054506369 514
561 iso_pu_bacteria 8055817908 8055821118 514
562 iso_pu_bacteria 8056131705 8056134801 514
563 iso_pu_bacteria 8056161164 8056166073 514
564 iso_pu_bacteria 8056172158 8056174277 514
565 iso_pu_bacteria 8056569372 8056573864 514
566 iso_pu_bacteria 8057798959 8057800534 514

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13231

PMT_2

Dolichyl-phosphate-mannose-protein mannosyltransferase

63

216

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
5ezm-assembly1.cif.gz_A crystal structure of arnt from cupriavidus metallidurans in the apo state 0.7057 2 508
5ezm-assembly1.cif.gz_A crystal structure of arnt from cupriavidus metallidurans in the apo state 0.6973 2 508
3v8h-assembly2.cif.gz_C crystal structure of thymidylate synthase from burkholderia thailandensis 0.6891 472 513
5f15-assembly1.cif.gz_A crystal structure of arnt from cupriavidus metallidurans bound to undecaprenyl phosphate 0.6826 2 508
5f15-assembly1.cif.gz_A crystal structure of arnt from cupriavidus metallidurans bound to undecaprenyl phosphate 0.6746 2 508
ID Description Score Start End Superfamily
af_O06152_111_270_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.748 52 173 1.20.1250.20
af_O06152_111_270_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.5913 52 173 1.20.1250.20
af_Q55B20_2_174_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.5861 473 512 3.40.630.30
3juwC00 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.5608 464 509 3.40.630.30
af_Q2FZM1_1_183_3.40.630.30 Alpha Beta;3-Layer(aba) Sandwich;Aminopeptidase;Gcn5-related N-acetyltransferase (GNAT) 0.5532 463 512 3.40.630.30
ID Description Score Start End GO Terms
AF-A0A4Z0AEQ2-F1-model_v4 Phospholipid carrier-dependent glycosyltransferase 0.9723 2 185 GO:0016020
GO:0016740
AF-A0A101LGC0-F1-model_v4 Glycosyltransferase RgtA/B/C/D-like domain-containing protein 0.9431 2 511 GO:0005886
GO:0009103
GO:0016763
AF-A0A101LGC0-F1-model_v4 Glycosyltransferase RgtA/B/C/D-like domain-containing protein 0.936 2 511 GO:0005886
GO:0009103
GO:0016763
AF-A0A6A7RR71-F1-model_v4 Glycosyltransferase 0.9261 2 512 GO:0000030
GO:0005886
GO:0006493
GO:0009103
GO:0010041
GO:0016763
AF-A0A6A7RR71-F1-model_v4 Glycosyltransferase 0.9209 2 512 GO:0000030
GO:0005886
GO:0006493
GO:0009103
GO:0010041
GO:0016763

Feature Viewer

pLDDT pTM Quality
87.19 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map