F464179

General Info

Members Datasets Scaffolds Average Seq Length
564 219 1128 199

Family's Representative Sequence

Representative Sequence 3300025940|Ga0207691_10057977|Ga0207691_100579773
Length 194
Sequence LIDEFKRLPGIGQKSAQRLAFYVLRRPENEVRDFAHALLDVKDKITFCSVCNNLTDVNPCLYCSNPKRDRSIICIVEEPYNLVAVEKTRSFRGLYHILHGSLSPIRGVGPDELMLANLLPRLLPENNDGVEVKEVIVATNPTTEGEATANYIARLLKPLGVRVTRIAMGMPVGSDLEYVDEVTMDRALANRHEI

Samples

Sample ID Description Type Environment
1 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
9 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
10 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
11 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
12 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
13 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
14 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
15 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
16 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
17 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
18 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
19 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
20 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
21 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
22 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
23 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
24 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
25 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
26 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
27 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
28 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
29 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
30 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
31 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
32 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
33 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
34 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
35 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
36 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
37 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
38 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
39 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
40 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
41 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
42 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
43 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
44 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
45 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
46 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
47 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
48 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
49 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
50 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
51 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
52 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
53 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
54 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
55 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
56 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
57 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
58 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
59 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
60 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
61 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
62 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
63 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
64 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
65 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
66 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
67 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
68 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
69 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
70 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
71 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
72 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
73 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
74 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
75 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
76 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
77 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
78 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
79 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
80 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
81 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
82 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
83 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
122 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
123 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
126 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
127 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
128 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
129 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
130 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
131 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
132 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
133 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
134 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
135 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
136 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
137 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
138 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
139 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
140 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
141 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
142 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
143 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
144 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
145 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
146 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
147 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
148 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
149 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
150 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
151 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
152 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
153 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
154 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
155 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
156 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
157 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
158 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
159 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
160 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
161 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
162 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
163 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
164 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
165 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
166 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
167 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
168 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
169 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
170 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
171 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
172 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
173 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
174 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
175 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
176 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
177 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
178 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
179 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
180 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
181 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
182 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
183 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
184 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
185 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
186 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
187 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
188 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
189 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
190 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
191 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
192 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
193 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
194 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
195 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
196 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
197 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
198 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
199 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
200 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
201 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
202 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
203 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
204 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
205 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
206 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
207 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
208 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
209 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
210 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
211 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
212 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
213 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
214 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
215 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
216 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
217 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
218 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
219 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.18
Nodule 0
Rhizoplane 0.35
Rhizosphere 96.99
Stem 0
Stem Tuber 0
Unclassified 11.17

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207691_10057977 3300025940 Bacteria 3523
2 Ga0070658_10219115 3300005327 Bacteria 1609
3 Ga0070683_100000003 3300005329 Bacteria 375084
4 Ga0070683_100010411 3300005329 Bacteria 7998
5 Ga0070690_100142057 3300005330 Bacteria 1630
6 Ga0070666_10293193 3300005335 Bacteria 1158
7 Ga0070680_100046460 3300005336 Bacteria 3532
8 Ga0070680_100979511 3300005336 Unclassified 730
9 Ga0068868_100481667 3300005338 Bacteria 1084
10 Ga0070660_100064256 3300005339 Bacteria 2855
11 Ga0070689_100302376 3300005340 Bacteria 1332
12 Ga0070661_100232763 3300005344 Bacteria 1416
13 Ga0070671_100000979 3300005355 Bacteria 20950
14 Ga0070671_100076483 3300005355 Bacteria 2796
15 Ga0070671_100121530 3300005355 Bacteria 2198
16 Ga0070674_100006428 3300005356 Bacteria 6857
17 Ga0070688_100242773 3300005365 Bacteria 1279
18 Ga0070667_100156307 3300005367 Bacteria 2006
19 Ga0070667_100791211 3300005367 Bacteria 880
20 Ga0070667_100824065 3300005367 Bacteria 862
21 Ga0070667_100833495 3300005367 Bacteria 857
22 Ga0070709_10154786 3300005434 Bacteria 1588
23 Ga0070709_10157116 3300005434 Unclassified 1577
24 Ga0070709_10213171 3300005434 Bacteria 1374
25 Ga0070709_10528115 3300005434 Bacteria 900
26 Ga0070714_100097072 3300005435 Bacteria 2590
27 Ga0070714_100122103 3300005435 Unclassified 2318
28 Ga0070713_100077473 3300005436 Bacteria 2827
29 Ga0070713_101270585 3300005436 Unclassified 713
30 Ga0070710_10388069 3300005437 Bacteria 933
31 Ga0070710_10595207 3300005437 Unclassified 769
32 Ga0070711_100125623 3300005439 Bacteria 1904
33 Ga0070705_100038356 3300005440 Bacteria 2710
34 Ga0070708_100790678 3300005445 Bacteria 892
35 Ga0070681_10008950 3300005458 Bacteria 9846
36 Ga0070681_10045451 3300005458 Bacteria 4393
37 Ga0070681_10053313 3300005458 Bacteria 4030
38 Ga0070681_10068644 3300005458 Bacteria 3511
39 Ga0070681_10069265 3300005458 Bacteria 3494
40 Ga0070681_10226600 3300005458 Bacteria 1784
41 Ga0068867_100046218 3300005459 Bacteria 3197
42 Ga0070706_100265914 3300005467 Bacteria 1601
43 Ga0070698_100326714 3300005471 Bacteria 1465
44 Ga0070699_100122714 3300005518 Bacteria 2286
45 Ga0070699_100551850 3300005518 Bacteria 1049
46 Ga0070679_100019912 3300005530 Bacteria 6534
47 Ga0070679_100039082 3300005530 Bacteria 4716
48 Ga0070679_100115410 3300005530 Bacteria 2671
49 Ga0070679_100273455 3300005530 Bacteria 1643
50 Ga0070679_100510162 3300005530 Bacteria 1146
51 Ga0070684_100000014 3300005535 Bacteria 158815
52 Ga0070684_100074862 3300005535 Bacteria 2985
53 Ga0070684_100224853 3300005535 Bacteria 1713
54 Ga0070684_100657709 3300005535 Bacteria 976
55 Ga0070697_100036952 3300005536 Bacteria 3945
56 Ga0070697_100112040 3300005536 Bacteria 2275
57 Ga0070697_100719787 3300005536 Bacteria 881
58 Ga0068853_100054417 3300005539 Bacteria 3449
59 Ga0068853_100077469 3300005539 Bacteria 2904
60 Ga0068853_100096953 3300005539 Bacteria 2602
61 Ga0068853_101084608 3300005539 Bacteria 772
62 Ga0070695_100510365 3300005545 Bacteria 931
63 Ga0070696_100011381 3300005546 Bacteria 5959
64 Ga0070665_100010110 3300005548 Bacteria 9544
65 Ga0070665_100351836 3300005548 Bacteria 1479
66 Ga0068855_100006924 3300005563 Bacteria 13751
67 Ga0068855_100018469 3300005563 Bacteria 8380
68 Ga0068855_100689449 3300005563 Bacteria 1094
69 Ga0068855_100719828 3300005563 Bacteria 1066
70 Ga0070664_100523273 3300005564 Bacteria 1095
71 Ga0068857_100023171 3300005577 Bacteria 5464
72 Ga0068857_100057260 3300005577 Bacteria 3459
73 Ga0068857_100077256 3300005577 Bacteria 2970
74 Ga0068857_100402984 3300005577 Bacteria 1273
75 Ga0068857_101083589 3300005577 Bacteria 773
76 Ga0068856_100022608 3300005614 Bacteria 6113
77 Ga0068856_100023083 3300005614 Bacteria 6050
78 Ga0068856_100056854 3300005614 Bacteria 3861
79 Ga0068856_100492693 3300005614 Bacteria 1246
80 Ga0070702_100872753 3300005615 Bacteria 702
81 Ga0068852_100061359 3300005616 Bacteria 3267
82 Ga0068852_100122280 3300005616 Bacteria 2385
83 Ga0068852_100567242 3300005616 Bacteria 1137
84 Ga0068859_100491072 3300005617 Bacteria 1323
85 Ga0068859_100950113 3300005617 Bacteria 943
86 Ga0068864_100010446 3300005618 Bacteria 7671
87 Ga0068866_10082256 3300005718 Bacteria 1732
88 Ga0068863_100047600 3300005841 Bacteria 4067
89 Ga0068863_100458522 3300005841 Bacteria 1251
90 Ga0068858_100060382 3300005842 Bacteria 3504
91 Ga0068858_100093670 3300005842 Bacteria 2796
92 Ga0068858_100360788 3300005842 Unclassified 1393
93 Ga0068858_100443130 3300005842 Bacteria 1251
94 Ga0068858_100629709 3300005842 Viruses 1042
95 Ga0070717_10054054 3300006028 Unclassified 3311
96 Ga0070717_10573160 3300006028 Unclassified 1023
97 Ga0070716_100344964 3300006173 Bacteria 1052
98 Ga0070716_100792500 3300006173 Bacteria 733
99 Ga0097621_100004895 3300006237 Bacteria 9389
100 Ga0097621_100128077 3300006237 Bacteria 2158
101 Ga0097621_100788380 3300006237 Unclassified 880
102 Ga0097621_101296334 3300006237 Bacteria 688
103 Ga0068871_100056155 3300006358 Bacteria 3199
104 Ga0068871_100089644 3300006358 Bacteria 2560
105 Ga0068871_100156888 3300006358 Bacteria 1944
106 Ga0068871_100280116 3300006358 Bacteria 1458
107 Ga0068871_100844972 3300006358 Bacteria 846
108 Ga0075428_100076984 3300006844 Bacteria 3642
109 Ga0075428_100563295 3300006844 Unclassified 1218
110 Ga0075430_100095041 3300006846 Unclassified 2491
111 Ga0075430_100542844 3300006846 Unclassified 959
112 Ga0075430_100816124 3300006846 Unclassified 769
113 Ga0075431_100029723 3300006847 Bacteria 5626
114 Ga0075431_100032058 3300006847 Bacteria 5415
115 Ga0075434_100773413 3300006871 Bacteria 977
116 Ga0068865_100200272 3300006881 Bacteria 1550
117 Ga0068865_100783673 3300006881 Bacteria 821
118 Ga0068865_101102971 3300006881 Archaea 699
119 Ga0075436_100001903 3300006914 Bacteria 14332
120 Ga0097620_100490986 3300006931 Bacteria 1323
121 Ga0097620_100950065 3300006931 Bacteria 943
122 Ga0075435_100244259 3300007076 Bacteria 1528
123 Ga0075435_100353300 3300007076 Bacteria 1260
124 Ga0105240_10002132 3300009093 Bacteria 32323
125 Ga0105240_10005509 3300009093 Bacteria 18864
126 Ga0105240_10006740 3300009093 Bacteria 16817
127 Ga0105240_10138777 3300009093 Bacteria 2909
128 Ga0105240_10196355 3300009093 Bacteria 2369
129 Ga0105240_10258367 3300009093 Bacteria 2011
130 Ga0105240_10282279 3300009093 Bacteria 1907
131 Ga0105240_10287701 3300009093 Bacteria 1885
132 Ga0105240_10369795 3300009093 Bacteria 1621
133 Ga0105240_10483796 3300009093 Bacteria 1379
134 Ga0105240_10663509 3300009093 Bacteria 1142
135 Ga0105245_10032993 3300009098 Bacteria 4585
136 Ga0105245_10071716 3300009098 Bacteria 3146
137 Ga0105245_10110493 3300009098 Unclassified 2556
138 Ga0105245_10149779 3300009098 Bacteria 2205
139 Ga0105245_10255202 3300009098 Bacteria 1705
140 Ga0105245_10265656 3300009098 Bacteria 1671
141 Ga0105245_10739452 3300009098 Bacteria 1019
142 Ga0105247_10112516 3300009101 Bacteria 1754
143 Ga0105247_10172955 3300009101 Bacteria 1437
144 Ga0105247_10323715 3300009101 Unclassified 1076
145 Ga0114129_10875874 3300009147 Bacteria 1140
146 Ga0114129_10921685 3300009147 Bacteria 1106
147 Ga0105243_10095253 3300009148 Bacteria 2460
148 Ga0105241_10046334 3300009174 Bacteria 3302
149 Ga0105241_10049952 3300009174 Bacteria 3187
150 Ga0105241_10056037 3300009174 Bacteria 3021
151 Ga0105241_10058382 3300009174 Bacteria 2963
152 Ga0105241_10402518 3300009174 Bacteria 1201
153 Ga0105242_10039092 3300009176 Bacteria 3818
154 Ga0105242_10042188 3300009176 Bacteria 3683
155 Ga0105242_10849352 3300009176 Bacteria 908
156 Ga0105248_10010342 3300009177 Bacteria 10269
157 Ga0105248_10158624 3300009177 Bacteria 2552
158 Ga0105248_10163115 3300009177 Bacteria 2513
159 Ga0105248_10301589 3300009177 Bacteria 1804
160 Ga0105248_10411094 3300009177 Bacteria 1523
161 Ga0105248_10439137 3300009177 Bacteria 1470
162 Ga0105248_10985337 3300009177 Bacteria 952
163 Ga0105237_10048339 3300009545 Bacteria 4276
164 Ga0105237_10133187 3300009545 Bacteria 2480
165 Ga0105237_10459285 3300009545 Bacteria 1279
166 Ga0105237_10527160 3300009545 Bacteria 1188
167 Ga0105237_10546830 3300009545 Bacteria 1164
168 Ga0105238_10024088 3300009551 Bacteria 6206
169 Ga0105238_10029359 3300009551 Bacteria 5602
170 Ga0105238_10036778 3300009551 Bacteria 4978
171 Ga0105238_10105210 3300009551 Bacteria 2803
172 Ga0105238_10169675 3300009551 Bacteria 2158
173 Ga0105238_10254762 3300009551 Bacteria 1734
174 Ga0105238_10329126 3300009551 Bacteria 1514
175 Ga0105238_10433334 3300009551 Bacteria 1310
176 Ga0105238_10508844 3300009551 Unclassified 1206
177 Ga0105238_10523521 3300009551 Bacteria 1188
178 Ga0105249_10004805 3300009553 Bacteria 11662
179 Ga0105239_10035735 3300010375 Bacteria 5455
180 Ga0105239_10051805 3300010375 Bacteria 4499
181 Ga0105239_10156846 3300010375 Bacteria 2542
182 Ga0105239_10168302 3300010375 Bacteria 2451
183 Ga0105239_10195280 3300010375 Bacteria 2266
184 Ga0105239_10400091 3300010375 Bacteria 1554
185 Ga0105239_11466516 3300010375 Bacteria 788
186 Ga0105246_10028169 3300011119 Bacteria 3688
187 Ga0157371_10167702 3300013102 Bacteria 1569
188 Ga0157370_10006421 3300013104 Bacteria 12970
189 Ga0157370_10076614 3300013104 Bacteria 3150
190 Ga0157370_10085202 3300013104 Bacteria 2968
191 Ga0157370_10113150 3300013104 Bacteria 2536
192 Ga0157370_10207497 3300013104 Bacteria 1816
193 Ga0157370_11190833 3300013104 Bacteria 687
194 Ga0157369_10010268 3300013105 Bacteria 10683
195 Ga0157369_10012948 3300013105 Bacteria 9451
196 Ga0157369_10112558 3300013105 Bacteria 2891
197 Ga0157369_10140289 3300013105 Bacteria 2558
198 Ga0157369_10183057 3300013105 Bacteria 2204
199 Ga0157369_10319235 3300013105 Bacteria 1615
200 Ga0157369_10320375 3300013105 Unclassified 1612
201 Ga0157369_10339288 3300013105 Bacteria 1561
202 Ga0157369_10567374 3300013105 Bacteria 1172
203 Ga0157374_10096930 3300013296 Bacteria 2821
204 Ga0157374_10439983 3300013296 Bacteria 1304
205 Ga0157374_10715961 3300013296 Unclassified 1014
206 Ga0157374_10836422 3300013296 Bacteria 937
207 Ga0157378_10307775 3300013297 Bacteria 1536
208 Ga0157378_10422647 3300013297 Unclassified 1317
209 Ga0157378_10495029 3300013297 Bacteria 1220
210 Ga0157378_10563519 3300013297 Bacteria 1146
211 Ga0163162_10603490 3300013306 Bacteria 1224
212 Ga0157372_10059089 3300013307 Bacteria 4288
213 Ga0157372_10207867 3300013307 Bacteria 2268
214 Ga0157372_10783737 3300013307 Bacteria 1108
215 Ga0157375_10005487 3300013308 Bacteria 11027
216 Ga0157375_10785664 3300013308 Unclassified 1101
217 Ga0157375_11235709 3300013308 Bacteria 877
218 Ga0157375_11374747 3300013308 Archaea 831
219 Ga0163163_10005820 3300014325 Bacteria 10715
220 Ga0163163_10053149 3300014325 Unclassified 3998
221 Ga0163163_10123289 3300014325 Bacteria 2627
222 Ga0163163_10164780 3300014325 Bacteria 2262
223 Ga0157380_10086036 3300014326 Bacteria 2582
224 Ga0157380_10515105 3300014326 Unclassified 1165
225 Ga0157380_10730675 3300014326 Unclassified 999
226 Ga0157379_10275328 3300014968 Bacteria 1531
227 Ga0157379_10693991 3300014968 Bacteria 955
228 Ga0157376_10030654 3300014969 Bacteria 4297
229 Ga0157376_10764738 3300014969 Bacteria 976
230 Ga0213875_10020238 3300021388 Bacteria 3193
231 Ga0213875_10033008 3300021388 Bacteria 2445
232 Ga0213875_10122484 3300021388 Unclassified 1215
233 Ga0213875_10204784 3300021388 Bacteria 928
234 Ga0207697_10184549 3300025315 Unclassified 915
235 Ga0207680_10012685 3300025903 Bacteria 4301
236 Ga0207680_10275955 3300025903 Bacteria 1167
237 Ga0207699_10026119 3300025906 Bacteria 3215
238 Ga0207699_10253099 3300025906 Bacteria 1214
239 Ga0207699_10456007 3300025906 Bacteria 918
240 Ga0207705_10060937 3300025909 Bacteria 2726
241 Ga0207705_10073522 3300025909 Bacteria 2480
242 Ga0207705_10233213 3300025909 Bacteria 1400
243 Ga0207654_10032216 3300025911 Bacteria 2894
244 Ga0207654_10041210 3300025911 Bacteria 2606
245 Ga0207654_10059331 3300025911 Bacteria 2231
246 Ga0207654_10190593 3300025911 Bacteria 1343
247 Ga0207654_10214356 3300025911 Bacteria 1274
248 Ga0207654_10374557 3300025911 Bacteria 985
249 Ga0207707_10045673 3300025912 Bacteria 3816
250 Ga0207707_10055505 3300025912 Bacteria 3446
251 Ga0207707_10186214 3300025912 Bacteria 1812
252 Ga0207707_10188531 3300025912 Bacteria 1799
253 Ga0207707_10200665 3300025912 Bacteria 1739
254 Ga0207707_10331628 3300025912 Bacteria 1313
255 Ga0207707_10351058 3300025912 Bacteria 1271
256 Ga0207695_10007356 3300025913 Bacteria 14049
257 Ga0207695_10009657 3300025913 Bacteria 11894
258 Ga0207695_10014863 3300025913 Bacteria 9191
259 Ga0207695_10021385 3300025913 Bacteria 7382
260 Ga0207695_10104031 3300025913 Bacteria 2830
261 Ga0207695_10169081 3300025913 Bacteria 2113
262 Ga0207695_10248757 3300025913 Bacteria 1677
263 Ga0207695_10263238 3300025913 Bacteria 1621
264 Ga0207695_10408794 3300025913 Unclassified 1241
265 Ga0207695_10431181 3300025913 Bacteria 1202
266 Ga0207695_10501911 3300025913 Bacteria 1095
267 Ga0207695_10554395 3300025913 Bacteria 1031
268 Ga0207671_10036875 3300025914 Bacteria 3626
269 Ga0207671_10108419 3300025914 Bacteria 2110
270 Ga0207671_10448228 3300025914 Bacteria 1028
271 Ga0207671_10471484 3300025914 Bacteria 1000
272 Ga0207693_10100911 3300025915 Bacteria 2263
273 Ga0207660_10022296 3300025917 Bacteria 4266
274 Ga0207660_10090356 3300025917 Bacteria 2269
275 Ga0207660_10171058 3300025917 Unclassified 1682
276 Ga0207662_10177928 3300025918 Bacteria 1367
277 Ga0207657_10060268 3300025919 Bacteria 3257
278 Ga0207649_10090254 3300025920 Bacteria 2005
279 Ga0207649_10409316 3300025920 Bacteria 1016
280 Ga0207649_10791071 3300025920 Bacteria 740
281 Ga0207652_10172124 3300025921 Bacteria 1943
282 Ga0207652_10319504 3300025921 Bacteria 1402
283 Ga0207652_10334171 3300025921 Bacteria 1368
284 Ga0207652_10401491 3300025921 Bacteria 1237
285 Ga0207694_10018153 3300025924 Bacteria 5318
286 Ga0207694_10054961 3300025924 Bacteria 3090
287 Ga0207694_10078778 3300025924 Bacteria 2583
288 Ga0207694_10185011 3300025924 Bacteria 1690
289 Ga0207694_10346756 3300025924 Bacteria 1229
290 Ga0207650_11114338 3300025925 Bacteria 672
291 Ga0207687_10020395 3300025927 Bacteria 4396
292 Ga0207687_10048444 3300025927 Bacteria 2951
293 Ga0207687_10084275 3300025927 Bacteria 2303
294 Ga0207687_10130517 3300025927 Bacteria 1893
295 Ga0207687_10219347 3300025927 Bacteria 1496
296 Ga0207700_10009991 3300025928 Bacteria 5963
297 Ga0207700_10352428 3300025928 Bacteria 1282
298 Ga0207700_10422994 3300025928 Bacteria 1170
299 Ga0207700_10540582 3300025928 Bacteria 1033
300 Ga0207700_10996690 3300025928 Bacteria 750
301 Ga0207644_10075607 3300025931 Unclassified 2475
302 Ga0207644_10342851 3300025931 Bacteria 1212
303 Ga0207686_10009485 3300025934 Bacteria 5281
304 Ga0207686_10056016 3300025934 Bacteria 2476
305 Ga0207686_10066266 3300025934 Bacteria 2306
306 Ga0207686_10113643 3300025934 Bacteria 1831
307 Ga0207709_10077111 3300025935 Bacteria 2135
308 Ga0207670_10322354 3300025936 Bacteria 1216
309 Ga0207669_10003333 3300025937 Bacteria 6950
310 Ga0207704_10073091 3300025938 Unclassified 2182
311 Ga0207711_10005538 3300025941 Bacteria 10677
312 Ga0207711_10155179 3300025941 Bacteria 2069
313 Ga0207711_10241059 3300025941 Bacteria 1658
314 Ga0207711_10295385 3300025941 Unclassified 1494
315 Ga0207711_10519662 3300025941 Bacteria 1110
316 Ga0207711_10710719 3300025941 Bacteria 937
317 Ga0207661_10000014 3300025944 Bacteria 322246
318 Ga0207661_10009339 3300025944 Bacteria 7029
319 Ga0207661_10036162 3300025944 Bacteria 3853
320 Ga0207661_10324714 3300025944 Bacteria 1384
321 Ga0207679_10343011 3300025945 Bacteria 1300
322 Ga0207667_10028766 3300025949 Bacteria 6033
323 Ga0207667_10074323 3300025949 Bacteria 3531
324 Ga0207667_10075027 3300025949 Bacteria 3512
325 Ga0207667_10096921 3300025949 Bacteria 3044
326 Ga0207667_10154999 3300025949 Bacteria 2357
327 Ga0207651_10759642 3300025960 Unclassified 857
328 Ga0207712_10008564 3300025961 Bacteria 6467
329 Ga0207658_10246636 3300025986 Bacteria 1516
330 Ga0207658_10569568 3300025986 Bacteria 1015
331 Ga0207658_10869823 3300025986 Bacteria 820
332 Ga0207703_10011093 3300026035 Bacteria 7019
333 Ga0207703_10033391 3300026035 Bacteria 4079
334 Ga0207703_10051823 3300026035 Bacteria 3329
335 Ga0207703_10283120 3300026035 Bacteria 1506
336 Ga0207703_10416216 3300026035 Unclassified 1250
337 Ga0207703_11101413 3300026035 Bacteria 763
338 Ga0207639_10042462 3300026041 Bacteria 3408
339 Ga0207639_10077840 3300026041 Bacteria 2615
340 Ga0207702_10053390 3300026078 Bacteria 3421
341 Ga0207702_10166118 3300026078 Bacteria 2019
342 Ga0207702_10185144 3300026078 Bacteria 1920
343 Ga0207702_10535529 3300026078 Bacteria 1144
344 Ga0207702_10989079 3300026078 Unclassified 834
345 Ga0207702_11359563 3300026078 Bacteria 704
346 Ga0207641_10130444 3300026088 Bacteria 2256
347 Ga0207641_10265068 3300026088 Bacteria 1610
348 Ga0207641_10922480 3300026088 Bacteria 868
349 Ga0207641_11130386 3300026088 Bacteria 782
350 Ga0207648_10166054 3300026089 Unclassified 1951
351 Ga0207648_10568982 3300026089 Bacteria 1042
352 Ga0207674_10001360 3300026116 Bacteria 31646
353 Ga0207674_10034500 3300026116 Bacteria 5287
354 Ga0207674_10037681 3300026116 Bacteria 5025
355 Ga0207674_10061761 3300026116 Bacteria 3785
356 Ga0207698_10239966 3300026142 Bacteria 1651
357 Ga0207698_10314607 3300026142 Bacteria 1463
358 Ga0209982_1019972 3300027552 Bacteria 1028
359 Ga0209974_10136628 3300027876 Bacteria 877
360 Ga0268266_10012734 3300028379 Bacteria 7268
361 Ga0268266_10187526 3300028379 Bacteria 1887
362 Ga0268266_10666707 3300028379 Bacteria 1002
363 Ga0268264_10102265 3300028381 Bacteria 2493
364 Ga0265323_10003557 3300028653 Bacteria 6856
365 Ga0265338_10038888 3300028800 Bacteria 4499
366 Ga0265338_10071461 3300028800 Bacteria 2968
367 Ga0265338_10224345 3300028800 Bacteria 1402
368 Ga0265324_10022740 3300029957 Bacteria 2239
369 Ga0265330_10039533 3300031235 Bacteria 2096
370 Ga0265332_10037525 3300031238 Bacteria 2101
371 Ga0265328_10005577 3300031239 Bacteria 5382
372 Ga0265320_10000699 3300031240 Bacteria 25600
373 Ga0265329_10046769 3300031242 Bacteria 1382
374 Ga0265329_10110176 3300031242 Bacteria 879
375 Ga0265340_10005654 3300031247 Bacteria 6915
376 Ga0265339_10244035 3300031249 Bacteria 871
377 Ga0265331_10001349 3300031250 Bacteria 18084
378 Ga0265331_10014576 3300031250 Bacteria 4178
379 Ga0265331_10253027 3300031250 Bacteria 790
380 Ga0265316_10001254 3300031344 Bacteria 27274
381 Ga0265316_10011374 3300031344 Bacteria 8031
382 Ga0265316_10070131 3300031344 Bacteria 2704
383 Ga0265316_10078477 3300031344 Bacteria 2534
384 Ga0265316_10082065 3300031344 Bacteria 2471
385 Ga0265316_10214988 3300031344 Bacteria 1420
386 Ga0265316_10238864 3300031344 Bacteria 1336
387 Ga0265316_10374289 3300031344 Bacteria 1028
388 Ga0265316_10471127 3300031344 Bacteria 899
389 Ga0265316_10767609 3300031344 Bacteria 677
390 Ga0265314_10007003 3300031711 Bacteria 9857
391 Ga0265314_10016159 3300031711 Bacteria 5909
392 Ga0265314_10017264 3300031711 Bacteria 5670
393 Ga0265342_10035341 3300031712 Bacteria 3060
394 Ga0265342_10242304 3300031712 Unclassified 965
395 Ga0307410_10199507 3300031852 Bacteria 1527
396 Ga0373926_0183397 3300035083 Unclassified 803
397 Ga0373926_0207002 3300035083 Bacteria 756
398 Ga0373934_0025030 3300035086 Unclassified 2309
399 Ga0373934_0182675 3300035086 Bacteria 862
400 Ga0373923_0022264 3300035111 Unclassified 2483
401 Ga0373941_0120053 3300035115 Bacteria 936
402 Ga0373953_0091317 3300035117 Bacteria 1274
403 Ga0373953_0235388 3300035117 Bacteria 794
404 Ga0373954_0000765 3300035118 Bacteria 12406
405 Ga0373954_0084127 3300035118 Bacteria 1523
406 Ga0373943_0018284 3300035170 Bacteria 3218
407 Ga0373955_0021803 3300035172 Unclassified 3240
408 Ga0373955_0059840 3300035172 Bacteria 2099
409 Ga0373924_0159943 3300035410 Unclassified 987
410 Ga0373931_0788762 3300035691 Bacteria 633
411 Ga0373935_0291120 3300035692 Unclassified 1152
412 Ga0373927_0001960 3300035695 Bacteria 15201
413 Ga0373927_0038381 3300035695 Unclassified 3110
414 Ga0373927_0200574 3300035695 Bacteria 1310
415 Ga0373933_0008604 3300035724 Bacteria 5566
416 Ga0373933_0113232 3300035724 Unclassified 1694
417 Ga0373933_0286079 3300035724 Bacteria 1066
418 Ga0373933_0345020 3300035724 Bacteria 967
419 Ga0373947_0017787 3300035725 Bacteria 4089
420 Ga0373937_0011011 3300036401 Bacteria 7927
421 Ga0373937_0086023 3300036401 Unclassified 2909
422 Ga0373937_0195368 3300036401 Bacteria 1902
423 Ga0373937_0376448 3300036401 Bacteria 1346
424 Ga0373937_0640166 3300036401 Unclassified 1008
425 Ga0373937_0822966 3300036401 Bacteria 877
426 Ga0373937_1111634 3300036401 Bacteria 739
427 Ga0316584_0325073 3300036712 Bacteria 1109
428 Ga0373925_0032235 3300037068 Bacteria 3856
429 Ga0373925_0102603 3300037068 Unclassified 2201
430 Ga0373925_0109139 3300037068 Bacteria 2136
431 Ga0373925_0171741 3300037068 Bacteria 1712
432 Ga0373925_0227329 3300037068 Bacteria 1491
433 Ga0373925_1073474 3300037068 Bacteria 663
434 Ga0395898_0243805 3300037466 Bacteria 1714
435 Ga0395898_0526628 3300037466 Bacteria 1123
436 Ga0436364_0468316 3300037853 Bacteria 11922
437 Ga0436364_0504127 3300037853 Bacteria 1149
438 Ga0436364_0528777 3300037853 Bacteria 1813
439 Ga0436364_0588594 3300037853 Bacteria 4322
440 Ga0436364_0667848 3300037853 Bacteria 4084
441 Ga0436364_0870750 3300037853 Bacteria 4065
442 Ga0436365_0719903 3300039437 Bacteria 7620
443 Ga0436365_1501250 3300039437 Bacteria 1560
444 Ga0436365_1554089 3300039437 Bacteria 1190
445 Ga0436365_1793263 3300039437 Bacteria 1959
446 Ga0436360_1167453 3300039438 Bacteria 693
447 Ga0450920_011168 3300042122 Bacteria 1672
448 Ga0450923_002819 3300042125 Bacteria 2549
449 Ga0451576_0215426 3300045051 Bacteria 2005
450 Ga0451576_0694676 3300045051 Unclassified 1069
451 Ga0451576_1192377 3300045051 Unclassified 795
452 Ga0466958_0306975 3300045836 Bacteria 1019
453 Ga0466967_0121772 3300045976 Unclassified 2412
454 Ga0495592_0181863 3300046454 Bacteria 1431
455 Ga0495629_0000001 3300046459 Bacteria 807972
456 Ga0495651_0068252 3300046462 Bacteria 2710
457 Ga0495651_0152627 3300046462 Bacteria 1663
458 Ga0495651_0261647 3300046462 Bacteria 1177
459 Ga0495580_0005635 3300046472 Bacteria 10300
460 Ga0495580_0025183 3300046472 Unclassified 4349
461 Ga0495580_0041470 3300046472 Bacteria 3283
462 Ga0495580_0181945 3300046472 Bacteria 1451
463 Ga0495580_0343162 3300046472 Bacteria 1013
464 Ga0495580_0629608 3300046472 Bacteria 707
465 Ga0495580_0661885 3300046472 Bacteria 686
466 Ga0495582_0018563 3300046473 Bacteria 3803
467 Ga0495582_0121192 3300046473 Bacteria 1474
468 Ga0495582_0389293 3300046473 Bacteria 804
469 Ga0495639_0236888 3300046475 Bacteria 900
470 Ga0495664_0041144 3300046477 Bacteria 2733
471 Ga0495664_0155778 3300046477 Unclassified 1386
472 Ga0495664_0504661 3300046477 Bacteria 722
473 Ga0495608_0071408 3300046511 Bacteria 2265
474 Ga0495618_0230881 3300046514 Bacteria 1165
475 Ga0495618_0281931 3300046514 Unclassified 1036
476 Ga0495628_0114351 3300046516 Bacteria 2073
477 Ga0495630_0068029 3300046517 Bacteria 2678
478 Ga0495630_0074645 3300046517 Bacteria 2554
479 Ga0495630_0220085 3300046517 Unclassified 1449
480 Ga0495630_0378185 3300046517 Bacteria 1085
481 Ga0495652_0120162 3300046529 Bacteria 2097
482 Ga0495665_0100640 3300046531 Bacteria 1517
483 Ga0495665_0313302 3300046531 Bacteria 802
484 Ga0495640_0076001 3300046533 Unclassified 2242
485 Ga0495640_0087764 3300046533 Bacteria 2057
486 Ga0495640_0148406 3300046533 Unclassified 1508
487 Ga0495640_0338544 3300046533 Bacteria 930
488 Ga0495586_0145178 3300046535 Bacteria 1333
489 Ga0495587_0055001 3300046536 Unclassified 2345
490 Ga0495587_0085483 3300046536 Bacteria 1826
491 Ga0495587_0092842 3300046536 Bacteria 1743
492 Ga0495645_0083357 3300046543 Bacteria 2291
493 Ga0495634_0129062 3300046642 Bacteria 1613
494 Ga0495634_0441535 3300046642 Bacteria 769
495 Ga0495635_0000968 3300046663 Bacteria 18922
496 Ga0495635_0053563 3300046663 Bacteria 2780
497 Ga0495635_0098416 3300046663 Bacteria 2000
498 Ga0495635_0364328 3300046663 Unclassified 963
499 Ga0495599_0064936 3300046678 Bacteria 2280
500 Ga0495599_0182985 3300046678 Bacteria 1291
501 Ga0495623_0089576 3300046679 Unclassified 1891
502 Ga0495623_0136464 3300046679 Bacteria 1464
503 Ga0495623_0203660 3300046679 Bacteria 1136
504 Ga0495623_0293063 3300046679 Bacteria 901
505 Ga0495646_0096859 3300046680 Bacteria 1696
506 Ga0495658_0471039 3300046683 Unclassified 803
507 Ga0495613_0047792 3300046689 Bacteria 3161
508 Ga0495613_0264237 3300046689 Bacteria 1198
509 Ga0495624_0051425 3300046690 Bacteria 2607
510 Ga0495600_0004348 3300046809 Bacteria 8477
511 Ga0495600_0071243 3300046809 Bacteria 2271
512 Ga0495600_0393910 3300046809 Unclassified 863
513 Ga0495581_0310406 3300047315 Bacteria 922
514 Ga0495604_0029258 3300047317 Bacteria 4382
515 Ga0495604_0039034 3300047317 Bacteria 3733
516 Ga0495604_0102326 3300047317 Bacteria 2103
517 Ga0495674_0013233 3300047319 Bacteria 7757
518 Ga0495674_0072156 3300047319 Bacteria 2978
519 Ga0495674_0100428 3300047319 Bacteria 2462
520 Ga0495674_0120964 3300047319 Bacteria 2212
521 Ga0495674_0371169 3300047319 Bacteria 1159
522 Ga0495674_0390403 3300047319 Bacteria 1125
523 Ga0495680_0002056 3300047322 Bacteria 20997
524 Ga0495680_0401373 3300047322 Bacteria 946
525 Ga0495680_0473415 3300047322 Bacteria 854
526 Ga0495675_0067888 3300047444 Unclassified 2253
527 Ga0495675_0094899 3300047444 Bacteria 1870
528 Ga0495675_0129801 3300047444 Bacteria 1567
529 Ga0495675_0243908 3300047444 Bacteria 1081
530 Ga0495675_0316929 3300047444 Bacteria 923
531 Ga0495684_0001750 3300047471 Bacteria 17435
532 Ga0495684_0010756 3300047471 Bacteria 7071
533 Ga0495684_0034344 3300047471 Unclassified 3891
534 Ga0495684_0035337 3300047471 Bacteria 3833
535 Ga0495684_0159710 3300047471 Bacteria 1682
536 Ga0495602_0083989 3300048088 Bacteria 2665
537 Ga0495602_0590060 3300048088 Bacteria 765
538 Ga0496106_0668692 3300048909 Bacteria 829
539 Ga0496112_0186259 3300048915 Bacteria 2039
540 Ga0501039_0258539 3300049575 Bacteria 1369
541 Ga0501042_0210948 3300049578 Bacteria 1401
542 Ga0501046_0265247 3300049580 Bacteria 1261
543 Ga0501047_0278948 3300049581 Bacteria 1516
544 Ga0501076_0159376 3300049592 Bacteria 1838
545 Ga0501077_0253061 3300049593 Bacteria 1120
546 Ga0501045_0218656 3300049824 Bacteria 1419
547 nmdc:mga05p37_183651_c1 3300050507 Bacteria 2543
548 nmdc:mga05p37_743757_c1 3300050507 Bacteria 1082
549 nmdc:mga09592_74032_c1 3300050508 Bacteria 2894
550 nmdc:mga0qj67_351298_c1 3300050509 Bacteria 1192
551 nmdc:mga06r32_26665_c1 3300050510 Bacteria 5390
552 nmdc:mga0rr50_321085_c1 3300050513 Bacteria 1298
553 nmdc:mga0rr50_772617_c1 3300050513 Bacteria 820
554 nmdc:mga08x19_3318_c1 3300050514 Bacteria 9623
555 Ga0495601_0025954 3300053077 Bacteria 3615
556 Ga0495601_0159761 3300053077 Bacteria 1473
557 Ga0495612_0018466 3300053078 Bacteria 2793
558 Ga0495612_0097428 3300053078 Unclassified 1250
559 Ga0495619_0114528 3300053085 Bacteria 1845
560 Ga0495619_0250657 3300053085 Bacteria 1227
561 Ga0500566_0013441 3300053094 Bacteria 4819
562 Ga0501082_0001403 3300060353 Bacteria 21228
563 Ga0501082_0198840 3300060353 Bacteria 1744
564 Ga0530510_0096136 3300061734 Bacteria 2165
565 Ga0207691_10057977
566 Ga0070658_10219115
567 Ga0070683_100000003
568 Ga0070683_100010411
569 Ga0070690_100142057
570 Ga0070666_10293193
571 Ga0070680_100046460
572 Ga0070680_100979511
573 Ga0068868_100481667
574 Ga0070660_100064256
575 Ga0070689_100302376
576 Ga0070661_100232763
577 Ga0070671_100000979
578 Ga0070671_100076483
579 Ga0070671_100121530
580 Ga0070674_100006428
581 Ga0070688_100242773
582 Ga0070667_100156307
583 Ga0070667_100791211
584 Ga0070667_100824065
585 Ga0070667_100833495
586 Ga0070709_10154786
587 Ga0070709_10157116
588 Ga0070709_10213171
589 Ga0070709_10528115
590 Ga0070714_100097072
591 Ga0070714_100122103
592 Ga0070713_100077473
593 Ga0070713_101270585
594 Ga0070710_10388069
595 Ga0070710_10595207
596 Ga0070711_100125623
597 Ga0070705_100038356
598 Ga0070708_100790678
599 Ga0070681_10008950
600 Ga0070681_10045451
601 Ga0070681_10053313
602 Ga0070681_10068644
603 Ga0070681_10069265
604 Ga0070681_10226600
605 Ga0068867_100046218
606 Ga0070706_100265914
607 Ga0070698_100326714
608 Ga0070699_100122714
609 Ga0070699_100551850
610 Ga0070679_100019912
611 Ga0070679_100039082
612 Ga0070679_100115410
613 Ga0070679_100273455
614 Ga0070679_100510162
615 Ga0070684_100000014
616 Ga0070684_100074862
617 Ga0070684_100224853
618 Ga0070684_100657709
619 Ga0070697_100036952
620 Ga0070697_100112040
621 Ga0070697_100719787
622 Ga0068853_100054417
623 Ga0068853_100077469
624 Ga0068853_100096953
625 Ga0068853_101084608
626 Ga0070695_100510365
627 Ga0070696_100011381
628 Ga0070665_100010110
629 Ga0070665_100351836
630 Ga0068855_100006924
631 Ga0068855_100018469
632 Ga0068855_100689449
633 Ga0068855_100719828
634 Ga0070664_100523273
635 Ga0068857_100023171
636 Ga0068857_100057260
637 Ga0068857_100077256
638 Ga0068857_100402984
639 Ga0068857_101083589
640 Ga0068856_100022608
641 Ga0068856_100023083
642 Ga0068856_100056854
643 Ga0068856_100492693
644 Ga0070702_100872753
645 Ga0068852_100061359
646 Ga0068852_100122280
647 Ga0068852_100567242
648 Ga0068859_100491072
649 Ga0068859_100950113
650 Ga0068864_100010446
651 Ga0068866_10082256
652 Ga0068863_100047600
653 Ga0068863_100458522
654 Ga0068858_100060382
655 Ga0068858_100093670
656 Ga0068858_100360788
657 Ga0068858_100443130
658 Ga0068858_100629709
659 Ga0070717_10054054
660 Ga0070717_10573160
661 Ga0070716_100344964
662 Ga0070716_100792500
663 Ga0097621_100004895
664 Ga0097621_100128077
665 Ga0097621_100788380
666 Ga0097621_101296334
667 Ga0068871_100056155
668 Ga0068871_100089644
669 Ga0068871_100156888
670 Ga0068871_100280116
671 Ga0068871_100844972
672 Ga0075428_100076984
673 Ga0075428_100563295
674 Ga0075430_100095041
675 Ga0075430_100542844
676 Ga0075430_100816124
677 Ga0075431_100029723
678 Ga0075431_100032058
679 Ga0075434_100773413
680 Ga0068865_100200272
681 Ga0068865_100783673
682 Ga0068865_101102971
683 Ga0075436_100001903
684 Ga0097620_100490986
685 Ga0097620_100950065
686 Ga0075435_100244259
687 Ga0075435_100353300
688 Ga0105240_10002132
689 Ga0105240_10005509
690 Ga0105240_10006740
691 Ga0105240_10138777
692 Ga0105240_10196355
693 Ga0105240_10258367
694 Ga0105240_10282279
695 Ga0105240_10287701
696 Ga0105240_10369795
697 Ga0105240_10483796
698 Ga0105240_10663509
699 Ga0105245_10032993
700 Ga0105245_10071716
701 Ga0105245_10110493
702 Ga0105245_10149779
703 Ga0105245_10255202
704 Ga0105245_10265656
705 Ga0105245_10739452
706 Ga0105247_10112516
707 Ga0105247_10172955
708 Ga0105247_10323715
709 Ga0114129_10875874
710 Ga0114129_10921685
711 Ga0105243_10095253
712 Ga0105241_10046334
713 Ga0105241_10049952
714 Ga0105241_10056037
715 Ga0105241_10058382
716 Ga0105241_10402518
717 Ga0105242_10039092
718 Ga0105242_10042188
719 Ga0105242_10849352
720 Ga0105248_10010342
721 Ga0105248_10158624
722 Ga0105248_10163115
723 Ga0105248_10301589
724 Ga0105248_10411094
725 Ga0105248_10439137
726 Ga0105248_10985337
727 Ga0105237_10048339
728 Ga0105237_10133187
729 Ga0105237_10459285
730 Ga0105237_10527160
731 Ga0105237_10546830
732 Ga0105238_10024088
733 Ga0105238_10029359
734 Ga0105238_10036778
735 Ga0105238_10105210
736 Ga0105238_10169675
737 Ga0105238_10254762
738 Ga0105238_10329126
739 Ga0105238_10433334
740 Ga0105238_10508844
741 Ga0105238_10523521
742 Ga0105249_10004805
743 Ga0105239_10035735
744 Ga0105239_10051805
745 Ga0105239_10156846
746 Ga0105239_10168302
747 Ga0105239_10195280
748 Ga0105239_10400091
749 Ga0105239_11466516
750 Ga0105246_10028169
751 Ga0157371_10167702
752 Ga0157370_10006421
753 Ga0157370_10076614
754 Ga0157370_10085202
755 Ga0157370_10113150
756 Ga0157370_10207497
757 Ga0157370_11190833
758 Ga0157369_10010268
759 Ga0157369_10012948
760 Ga0157369_10112558
761 Ga0157369_10140289
762 Ga0157369_10183057
763 Ga0157369_10319235
764 Ga0157369_10320375
765 Ga0157369_10339288
766 Ga0157369_10567374
767 Ga0157374_10096930
768 Ga0157374_10439983
769 Ga0157374_10715961
770 Ga0157374_10836422
771 Ga0157378_10307775
772 Ga0157378_10422647
773 Ga0157378_10495029
774 Ga0157378_10563519
775 Ga0163162_10603490
776 Ga0157372_10059089
777 Ga0157372_10207867
778 Ga0157372_10783737
779 Ga0157375_10005487
780 Ga0157375_10785664
781 Ga0157375_11235709
782 Ga0157375_11374747
783 Ga0163163_10005820
784 Ga0163163_10053149
785 Ga0163163_10123289
786 Ga0163163_10164780
787 Ga0157380_10086036
788 Ga0157380_10515105
789 Ga0157380_10730675
790 Ga0157379_10275328
791 Ga0157379_10693991
792 Ga0157376_10030654
793 Ga0157376_10764738
794 Ga0213875_10020238
795 Ga0213875_10033008
796 Ga0213875_10122484
797 Ga0213875_10204784
798 Ga0207697_10184549
799 Ga0207680_10012685
800 Ga0207680_10275955
801 Ga0207699_10026119
802 Ga0207699_10253099
803 Ga0207699_10456007
804 Ga0207705_10060937
805 Ga0207705_10073522
806 Ga0207705_10233213
807 Ga0207654_10032216
808 Ga0207654_10041210
809 Ga0207654_10059331
810 Ga0207654_10190593
811 Ga0207654_10214356
812 Ga0207654_10374557
813 Ga0207707_10045673
814 Ga0207707_10055505
815 Ga0207707_10186214
816 Ga0207707_10188531
817 Ga0207707_10200665
818 Ga0207707_10331628
819 Ga0207707_10351058
820 Ga0207695_10007356
821 Ga0207695_10009657
822 Ga0207695_10014863
823 Ga0207695_10021385
824 Ga0207695_10104031
825 Ga0207695_10169081
826 Ga0207695_10248757
827 Ga0207695_10263238
828 Ga0207695_10408794
829 Ga0207695_10431181
830 Ga0207695_10501911
831 Ga0207695_10554395
832 Ga0207671_10036875
833 Ga0207671_10108419
834 Ga0207671_10448228
835 Ga0207671_10471484
836 Ga0207693_10100911
837 Ga0207660_10022296
838 Ga0207660_10090356
839 Ga0207660_10171058
840 Ga0207662_10177928
841 Ga0207657_10060268
842 Ga0207649_10090254
843 Ga0207649_10409316
844 Ga0207649_10791071
845 Ga0207652_10172124
846 Ga0207652_10319504
847 Ga0207652_10334171
848 Ga0207652_10401491
849 Ga0207694_10018153
850 Ga0207694_10054961
851 Ga0207694_10078778
852 Ga0207694_10185011
853 Ga0207694_10346756
854 Ga0207650_11114338
855 Ga0207687_10020395
856 Ga0207687_10048444
857 Ga0207687_10084275
858 Ga0207687_10130517
859 Ga0207687_10219347
860 Ga0207700_10009991
861 Ga0207700_10352428
862 Ga0207700_10422994
863 Ga0207700_10540582
864 Ga0207700_10996690
865 Ga0207644_10075607
866 Ga0207644_10342851
867 Ga0207686_10009485
868 Ga0207686_10056016
869 Ga0207686_10066266
870 Ga0207686_10113643
871 Ga0207709_10077111
872 Ga0207670_10322354
873 Ga0207669_10003333
874 Ga0207704_10073091
875 Ga0207711_10005538
876 Ga0207711_10155179
877 Ga0207711_10241059
878 Ga0207711_10295385
879 Ga0207711_10519662
880 Ga0207711_10710719
881 Ga0207661_10000014
882 Ga0207661_10009339
883 Ga0207661_10036162
884 Ga0207661_10324714
885 Ga0207679_10343011
886 Ga0207667_10028766
887 Ga0207667_10074323
888 Ga0207667_10075027
889 Ga0207667_10096921
890 Ga0207667_10154999
891 Ga0207651_10759642
892 Ga0207712_10008564
893 Ga0207658_10246636
894 Ga0207658_10569568
895 Ga0207658_10869823
896 Ga0207703_10011093
897 Ga0207703_10033391
898 Ga0207703_10051823
899 Ga0207703_10283120
900 Ga0207703_10416216
901 Ga0207703_11101413
902 Ga0207639_10042462
903 Ga0207639_10077840
904 Ga0207702_10053390
905 Ga0207702_10166118
906 Ga0207702_10185144
907 Ga0207702_10535529
908 Ga0207702_10989079
909 Ga0207702_11359563
910 Ga0207641_10130444
911 Ga0207641_10265068
912 Ga0207641_10922480
913 Ga0207641_11130386
914 Ga0207648_10166054
915 Ga0207648_10568982
916 Ga0207674_10001360
917 Ga0207674_10034500
918 Ga0207674_10037681
919 Ga0207674_10061761
920 Ga0207698_10239966
921 Ga0207698_10314607
922 Ga0209982_1019972
923 Ga0209974_10136628
924 Ga0268266_10012734
925 Ga0268266_10187526
926 Ga0268266_10666707
927 Ga0268264_10102265
928 Ga0265323_10003557
929 Ga0265338_10038888
930 Ga0265338_10071461
931 Ga0265338_10224345
932 Ga0265324_10022740
933 Ga0265330_10039533
934 Ga0265332_10037525
935 Ga0265328_10005577
936 Ga0265320_10000699
937 Ga0265329_10046769
938 Ga0265329_10110176
939 Ga0265340_10005654
940 Ga0265339_10244035
941 Ga0265331_10001349
942 Ga0265331_10014576
943 Ga0265331_10253027
944 Ga0265316_10001254
945 Ga0265316_10011374
946 Ga0265316_10070131
947 Ga0265316_10078477
948 Ga0265316_10082065
949 Ga0265316_10214988
950 Ga0265316_10238864
951 Ga0265316_10374289
952 Ga0265316_10471127
953 Ga0265316_10767609
954 Ga0265314_10007003
955 Ga0265314_10016159
956 Ga0265314_10017264
957 Ga0265342_10035341
958 Ga0265342_10242304
959 Ga0307410_10199507
960 Ga0373926_0183397
961 Ga0373926_0207002
962 Ga0373934_0025030
963 Ga0373934_0182675
964 Ga0373923_0022264
965 Ga0373941_0120053
966 Ga0373953_0091317
967 Ga0373953_0235388
968 Ga0373954_0000765
969 Ga0373954_0084127
970 Ga0373943_0018284
971 Ga0373955_0021803
972 Ga0373955_0059840
973 Ga0373924_0159943
974 Ga0373931_0788762
975 Ga0373935_0291120
976 Ga0373927_0001960
977 Ga0373927_0038381
978 Ga0373927_0200574
979 Ga0373933_0008604
980 Ga0373933_0113232
981 Ga0373933_0286079
982 Ga0373933_0345020
983 Ga0373947_0017787
984 Ga0373937_0011011
985 Ga0373937_0086023
986 Ga0373937_0195368
987 Ga0373937_0376448
988 Ga0373937_0640166
989 Ga0373937_0822966
990 Ga0373937_1111634
991 Ga0316584_0325073
992 Ga0373925_0032235
993 Ga0373925_0102603
994 Ga0373925_0109139
995 Ga0373925_0171741
996 Ga0373925_0227329
997 Ga0373925_1073474
998 Ga0395898_0243805
999 Ga0395898_0526628
1000 Ga0436364_0468316
1001 Ga0436364_0504127
1002 Ga0436364_0528777
1003 Ga0436364_0588594
1004 Ga0436364_0667848
1005 Ga0436364_0870750
1006 Ga0436365_0719903
1007 Ga0436365_1501250
1008 Ga0436365_1554089
1009 Ga0436365_1793263
1010 Ga0436360_1167453
1011 Ga0450920_011168
1012 Ga0450923_002819
1013 Ga0451576_0215426
1014 Ga0451576_0694676
1015 Ga0451576_1192377
1016 Ga0466958_0306975
1017 Ga0466967_0121772
1018 Ga0495592_0181863
1019 Ga0495629_0000001
1020 Ga0495651_0068252
1021 Ga0495651_0152627
1022 Ga0495651_0261647
1023 Ga0495580_0005635
1024 Ga0495580_0025183
1025 Ga0495580_0041470
1026 Ga0495580_0181945
1027 Ga0495580_0343162
1028 Ga0495580_0629608
1029 Ga0495580_0661885
1030 Ga0495582_0018563
1031 Ga0495582_0121192
1032 Ga0495582_0389293
1033 Ga0495639_0236888
1034 Ga0495664_0041144
1035 Ga0495664_0155778
1036 Ga0495664_0504661
1037 Ga0495608_0071408
1038 Ga0495618_0230881
1039 Ga0495618_0281931
1040 Ga0495628_0114351
1041 Ga0495630_0068029
1042 Ga0495630_0074645
1043 Ga0495630_0220085
1044 Ga0495630_0378185
1045 Ga0495652_0120162
1046 Ga0495665_0100640
1047 Ga0495665_0313302
1048 Ga0495640_0076001
1049 Ga0495640_0087764
1050 Ga0495640_0148406
1051 Ga0495640_0338544
1052 Ga0495586_0145178
1053 Ga0495587_0055001
1054 Ga0495587_0085483
1055 Ga0495587_0092842
1056 Ga0495645_0083357
1057 Ga0495634_0129062
1058 Ga0495634_0441535
1059 Ga0495635_0000968
1060 Ga0495635_0053563
1061 Ga0495635_0098416
1062 Ga0495635_0364328
1063 Ga0495599_0064936
1064 Ga0495599_0182985
1065 Ga0495623_0089576
1066 Ga0495623_0136464
1067 Ga0495623_0203660
1068 Ga0495623_0293063
1069 Ga0495646_0096859
1070 Ga0495658_0471039
1071 Ga0495613_0047792
1072 Ga0495613_0264237
1073 Ga0495624_0051425
1074 Ga0495600_0004348
1075 Ga0495600_0071243
1076 Ga0495600_0393910
1077 Ga0495581_0310406
1078 Ga0495604_0029258
1079 Ga0495604_0039034
1080 Ga0495604_0102326
1081 Ga0495674_0013233
1082 Ga0495674_0072156
1083 Ga0495674_0100428
1084 Ga0495674_0120964
1085 Ga0495674_0371169
1086 Ga0495674_0390403
1087 Ga0495680_0002056
1088 Ga0495680_0401373
1089 Ga0495680_0473415
1090 Ga0495675_0067888
1091 Ga0495675_0094899
1092 Ga0495675_0129801
1093 Ga0495675_0243908
1094 Ga0495675_0316929
1095 Ga0495684_0001750
1096 Ga0495684_0010756
1097 Ga0495684_0034344
1098 Ga0495684_0035337
1099 Ga0495684_0159710
1100 Ga0495602_0083989
1101 Ga0495602_0590060
1102 Ga0496106_0668692
1103 Ga0496112_0186259
1104 Ga0501039_0258539
1105 Ga0501042_0210948
1106 Ga0501046_0265247
1107 Ga0501047_0278948
1108 Ga0501076_0159376
1109 Ga0501077_0253061
1110 Ga0501045_0218656
1111 nmdc:mga05p37_183651_c1
1112 nmdc:mga05p37_743757_c1
1113 nmdc:mga09592_74032_c1
1114 nmdc:mga0qj67_351298_c1
1115 nmdc:mga06r32_26665_c1
1116 nmdc:mga0rr50_321085_c1
1117 nmdc:mga0rr50_772617_c1
1118 nmdc:mga08x19_3318_c1
1119 Ga0495601_0025954
1120 Ga0495601_0159761
1121 Ga0495612_0018466
1122 Ga0495612_0097428
1123 Ga0495619_0114528
1124 Ga0495619_0250657
1125 Ga0500566_0013441
1126 Ga0501082_0001403
1127 Ga0501082_0198840
1128 Ga0530510_0096136

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF21175

RecR_C

RecR, C-terminal

169

192

0.98

PF21176

RecR_HhH

RecR, helix-hairpin-helix

1

42

0.97

PF02132

RecR_ZnF

RecR, Cys4-zinc finger motif

45

65

0.97

PF13662

Toprim_4

Toprim domain

71

167

0.97

PF01751

Toprim

Toprim domain

72

167

0.8

Structural Annotation

Top 5 Hits

ID Description Score Start End
8a93-assembly1.cif.gz_F complex of recf-recr-dna from thermus thermophilus. 0.9484 82 170
8a93-assembly1.cif.gz_F complex of recf-recr-dna from thermus thermophilus. 0.9087 82 170
8ab0-assembly1.cif.gz_F complex of reco-recr-dna from thermus thermophilus. 0.8842 5 170
8ab0-assembly1.cif.gz_F complex of reco-recr-dna from thermus thermophilus. 0.8789 5 170
3ve5-assembly1.cif.gz_A structure of recombination mediator protein recr16-196 deletion mutant 0.8749 19 199
ID Description Score Start End Superfamily
3ve5A03 Alpha Beta;3-Layer(aba) Sandwich;Dna Topoisomerase Vi A Subunit; Chain: A, domain 2; 0.9754 78 199 3.40.1360.10
3ve5A03 Alpha Beta;3-Layer(aba) Sandwich;Dna Topoisomerase Vi A Subunit; Chain: A, domain 2; 0.9676 78 199 3.40.1360.10
3vdpC01 Mainly Alpha;Orthogonal Bundle;Helicase, Ruva Protein; domain 3;RecR Domain 1 0.9661 4 54 1.10.8.420
3vdpA01 Mainly Alpha;Orthogonal Bundle;Helicase, Ruva Protein; domain 3;RecR Domain 1 0.9593 4 54 1.10.8.420
3vdpB01 Mainly Alpha;Orthogonal Bundle;Helicase, Ruva Protein; domain 3;RecR Domain 1 0.9533 5 54 1.10.8.420
ID Description Score Start End GO Terms
AF-A0A268RH89-F1-model_v4 Recombination protein RecR 0.9868 72 171 GO:0003677
GO:0006281
GO:0006310
GO:0046872
AF-A0A359MVU3-F1-model_v4 Recombination protein RecR 0.9805 1 170 GO:0003677
GO:0006281
GO:0006310
GO:0046872
AF-W1XYN8-F1-model_v4 Recombination protein RecR 0.9738 40 153 GO:0003677
GO:0006281
GO:0006310
GO:0046872
AF-A0A354WR29-F1-model_v4 Recombination protein RecR 0.9692 1 161 GO:0003677
GO:0006281
GO:0006310
GO:0046872
AF-A0A6L5ZJ16-F1-model_v4 Recombination protein RecR 0.9637 4 108 GO:0003677
GO:0006281
GO:0006310
GO:0046872

Map