F464032

General Info

Members Datasets Scaffolds Average Seq Length
563 472 352 282

Family's Representative Sequence

Representative Sequence 3300006042|Ga0075368_10045259|Ga0075368_100452592
Length 336
Sequence MNRDGEVIDSAETTAPQTGLTRRDVLRGGIGLGVVLGLANTRLGSAPIRGEAATPFWESEMSTITTTDGTTIFYKDWGPKDAQPIMFHHGWPLTGDDWDNQMLYFLAKGYRVIAHDRRGHGRSAQVSDGHDMDHYAADAAAVVSHLNLRDTIHVGHSTGGGEATHYVARHGNGRVAKLVIIGAIPPIMLKTATNPGGLPIEVFDNLRKQLAANRSQFYRDLASGPFYGYNRPGAKVSEAVIGNWWRQGMIGGAKAHYDGIKAFSETDLTEDLKIIDVPTLVMHGDDDQIVPIADSAMLSVKLLKKGTLKVYEKLPHGMCTTHPDVVNPDILAFIKS

Samples

Sample ID Description Type Environment
1 2509276021 Rhizobium leguminosarum bv. trifolii WSM597 Isolate Nodule
2 2509276033 Rhizobium leguminosarum bv. trifolii WSM2012 Isolate Nodule
3 2510065019 Rhizobium leguminosarum bv. trifolii WSM1689 Isolate Nodule
4 2510461076 Rhizobium leguminosarum bv. trifolii TA1 Isolate Nodule
5 2511231017 Pseudomonas sp. GM55 Isolate Nodule
6 2511231052 Sinorhizobium meliloti AK58 Isolate Nodule
7 2513237084 Rhizobium leguminosarum bv. viciae UPM1131 Isolate Nodule
8 2513237085 Rhizobium leguminosarum bv. viciae UPM1137 Isolate Nodule
9 2513237093 Rhizobium leguminosarum bv. phaseoli FA23 Isolate Nodule
10 2513237103 Rhizobium leguminosarum bv. viciae VF39 Isolate Nodule
11 2513237162 Rhizobium ruizarguesonis GB30 Isolate Nodule
12 2515075009 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
13 2515154113 Rhizobium ruizarguesonis Vc2 Isolate Nodule
14 2515154114 Rhizobium ruizarguesonis Vh3 Isolate Nodule
15 2515154116 Rhizobium ruizarguesonis Ps8 Isolate Nodule
16 2515154134 Rhizobium gallicum bv. gallicum R602sp Isolate Nodule
17 2516653077 Rhizobium acaciae WSM1481 Isolate Nodule
18 2516653085 Rhizobium leguminosarum bv. phaseoli 4292 Isolate Nodule
19 2517093000 Rhizobium leguminosarum bv. trifolii SRDI943 Isolate Nodule
20 2517287029 Rhizobium leguminosarum bv. trifolii SRDI565 Isolate Nodule
21 2529292951 Rhizobium sp. CCGE 510 Isolate Nodule
22 2551306086 Sinorhizobium meliloti AK11 Isolate Nodule
23 2551306089 Sinorhizobium meliloti 1A42 Isolate Nodule
24 2551306090 Sinorhizobium meliloti A0641M Isolate Nodule
25 2551306092 Sinorhizobium meliloti AK75 Isolate Nodule
26 2585427526 Rhizobium leguminosarum OV152 Isolate Rhizosphere
27 2585427528 Rhizobium leguminosarum CF307 Isolate Rhizosphere
28 2585427593 Rhizobium tropici CF286 Isolate Rhizosphere
29 2615840624 Rhizobium aethiopicum HBR26 Isolate Nodule
30 2643221640 Caulobacter sp. Root342 Isolate Unclassified
31 2643221642 Caulobacter sp. Root343 Isolate Unclassified
32 2643221736 Bosea sp. Root483D1 Isolate Unclassified
33 2718217882 Rhizobium sp. N741 Isolate Nodule
34 2718217927 Rhizobium sp. N324 Isolate Nodule
35 2718217997 Rhizobium phaseoli sv. phaseoli R723 Isolate Nodule
36 2718218009 Rhizobium sp. N561 Isolate Nodule
37 2718218199 Rhizobium phaseoli sv. phaseoli N261 Isolate Nodule
38 2718218232 Rhizobium phaseoli sv. phaseoli N161 Isolate Nodule
39 2718218233 Rhizobium phaseoli sv. phaseoli R744 Isolate Nodule
40 2718218235 Rhizobium phaseoli sv. phaseoli R620 Isolate Nodule
41 2718218269 Rhizobium phaseoli sv. phaseoli N671 Isolate Nodule
42 2718218363 Rhizobium sp. N113 Isolate Nodule
43 2718218365 Rhizobium sp. N731 Isolate Nodule
44 2718218366 Rhizobium sp. N621 Isolate Nodule
45 2718218423 Rhizobium sp. N941 Isolate Nodule
46 2721755514 Rhizobium sp. N6212 Isolate Nodule
47 2721755556 Rhizobium phaseoli sv. phaseoli N931 Isolate Nodule
48 2721755684 Rhizobium phaseoli sv. phaseoli N841 Isolate Nodule
49 2721755685 Rhizobium phaseoli sv. phaseoli R611 Isolate Nodule
50 2721755809 Rhizobium sp. N541 Isolate Nodule
51 2721755810 Rhizobium sp. N871 Isolate Nodule
52 2721755819 Rhizobium phaseoli sv. phaseoli N771 Isolate Nodule
53 2721755822 Rhizobium phaseoli sv. phaseoli R650 Isolate Nodule
54 2721755823 Rhizobium phaseoli sv. phaseoli R630 Isolate Nodule
55 2724679232 Rhizobium leguminosarum Vaf12 Isolate Unclassified
56 2728369352 Rhizobium phaseoli sv. phaseoli N831 Isolate Nodule
57 2728369365 Rhizobium sp. N1341 Isolate Nodule
58 2728369397 Rhizobium sp. N1314 Isolate Nodule
59 2738541333 Rhizobium sophoriradicis CCBAU 03470 Isolate Unclassified
60 2765235942 Rhizobium sp. WYCCWR10014 Isolate Nodule
61 2791355256 Rhizobium sp. M10 Isolate Nodule
62 2791355259 Rhizobium hidalgonense FH14 Isolate Nodule
63 2791355260 Rhizobium sp. L9 Isolate Nodule
64 2791355261 Rhizobium sp. J15 Isolate Nodule
65 2791355262 Rhizobium sp. M1 Isolate Nodule
66 2791355263 Rhizobium chutanense C5 Isolate Nodule
67 2791355264 Rhizobium sp. S9 Isolate Nodule
68 2791355265 Rhizobium sp. H4 Isolate Nodule
69 2791355266 Rhizobium sp. L43 Isolate Nodule
70 2791355267 Rhizobium sp. L18 Isolate Nodule
71 2802429605 Rhizobium sophoriradicis L101 Isolate Nodule
72 2802429606 Rhizobium sophoriradicis JJW1 Isolate Nodule
73 2802429633 Rhizobium anhuiense J3 Isolate Nodule
74 2802429634 Rhizobium anhuiense S10 Isolate Nodule
75 2802429635 Rhizobium anhuiense Y27 Isolate Nodule
76 2802429636 Rhizobium anhuiense JX3 Isolate Nodule
77 2802429637 Rhizobium anhuiense C15 Isolate Nodule
78 2838016132 Rhizobium phaseoli SEMIA 4071 Isolate Nodule
79 2838022645 Rhizobium aethiopicum SEMIA 4074 Isolate Nodule
80 2838042994 Rhizobium esperanzae SEMIA 4089 Isolate Nodule
81 2838048938 Rhizobium pisi 27/80 Isolate Nodule
82 2838061910 Rhizobium phaseoli L15 Isolate Nodule
83 2838068647 Rhizobium esperanzae VC28 Isolate Nodule
84 2838668709 Rhizobium sophoriradicis SEMIA 403 Isolate Nodule
85 2838680041 Rhizobium leguminosarum SEMIA 415 Isolate Nodule
86 2838686498 Rhizobium leguminosarum SEMIA 416 Isolate Nodule
87 2838694306 Rhizobium leguminosarum SEMIA 421 Isolate Nodule
88 2838701080 Rhizobium aethiopicum SEMIA 428 Isolate Nodule
89 2838707686 Rhizobium leguminosarum SEMIA 430 Isolate Nodule
90 2838729681 Rhizobium leguminosarum SEMIA 445 Isolate Nodule
91 2838742623 Rhizobium leguminosarum SEMIA 449 Isolate Nodule
92 2841851746 Rhizobium leguminosarum SEMIA 498 Isolate Nodule
93 2841864319 Rhizobium leguminosarum SEMIA 4052 Isolate Nodule
94 2842077413 Rhizobium leguminosarum SEMIA 422 Isolate Nodule
95 2842110456 Rhizobium esperanzae SEMIA 414 Isolate Nodule
96 2842118031 Rhizobium esperanzae SEMIA 420 Isolate Nodule
97 2842146304 Rhizobium sophoriradicis SEMIA 454 Isolate Nodule
98 2842156927 Rhizobium leguminosarum SEMIA 459 Isolate Nodule
99 2842163707 Rhizobium leguminosarum SEMIA 460 Isolate Nodule
100 2842180545 Rhizobium leguminosarum SEMIA 463 Isolate Nodule
101 2842192696 Rhizobium esperanzae SEMIA 468 Isolate Nodule
102 2842198810 Rhizobium aethiopicum SEMIA 470 Isolate Nodule
103 2842205361 Rhizobium etli SEMIA 471 Isolate Nodule
104 2842217011 Rhizobium leguminosarum SEMIA 475 Isolate Nodule
105 2842229732 Rhizobium leguminosarum SEMIA 481 Isolate Nodule
106 2842237096 Rhizobium leguminosarum SEMIA 482 Isolate Nodule
107 2842243621 Rhizobium leguminosarum SEMIA 483 Isolate Nodule
108 2842250916 Rhizobium etli SEMIA 484 Isolate Nodule
109 2842257432 Rhizobium leguminosarum SEMIA 485 Isolate Nodule
110 2842264693 Rhizobium phaseoli SEMIA 487 Isolate Nodule
111 2842271015 Rhizobium leguminosarum SEMIA 488 Isolate Nodule
112 2842278818 Rhizobium etli SEMIA 489 Isolate Nodule
113 2842285085 Rhizobium lentis SEMIA 490 Isolate Nodule
114 2842291075 Rhizobium leguminosarum SEMIA 491 Isolate Nodule
115 2842304105 Rhizobium leguminosarum SEMIA 499 Isolate Nodule
116 2842311132 Rhizobium phaseoli SEMIA 4002 Isolate Nodule
117 2842317721 Rhizobium etli SEMIA 4004 Isolate Nodule
118 2842341865 Rhizobium leguminosarum SEMIA 4011 Isolate Nodule
119 2842363717 Rhizobium leguminosarum SEMIA 4016 Isolate Nodule
120 2842370503 Rhizobium leguminosarum SEMIA 4022 Isolate Nodule
121 2842377471 Rhizobium leguminosarum SEMIA 4024 Isolate Nodule
122 2842384541 Rhizobium leguminosarum SEMIA 4025 Isolate Nodule
123 2842395702 Rhizobium ecuadorense SEMIA 4029 Isolate Nodule
124 2842402390 Rhizobium lentis SEMIA 4033 Isolate Nodule
125 2842409023 Rhizobium lentis SEMIA 4034 Isolate Nodule
126 2842415677 Rhizobium lentis SEMIA 4036 Isolate Nodule
127 2842422224 Rhizobium esperanzae SEMIA 4042 Isolate Nodule
128 2842428310 Rhizobium phaseoli SEMIA 4050 Isolate Nodule
129 2842434925 Rhizobium esperanzae SEMIA 4051 Isolate Nodule
130 2842441272 Rhizobium esperanzae SEMIA 4053 Isolate Nodule
131 2842447887 Rhizobium esperanzae SEMIA 4055 Isolate Nodule
132 2842462802 Rhizobium phaseoli SEMIA 4057 Isolate Nodule
133 2842469257 Rhizobium phaseoli SEMIA 4058 Isolate Nodule
134 2842489311 Rhizobium sophoriradicis SEMIA 4061 Isolate Nodule
135 2842495871 Rhizobium etli SEMIA 4062 Isolate Nodule
136 2844454524 Rhizobium leguminosarum bv. viciae BIHB 1217 Isolate Nodule
137 2855825444 Sinorhizobium meliloti CXM1-105 Isolate Nodule
138 2857516855 Rhizobium sp. R-72456 Isolate Unclassified
139 2884960567 Caulobacter sp. 602-1 Isolate Rhizosphere
140 2916007675 Sinorhizobium meliloti USDA1289 Isolate Nodule
141 2916014648 Sinorhizobium meliloti USDA1583 Isolate Nodule
142 2921237296 Sinorhizobium meliloti USDA1508 Isolate Nodule
143 2921296804 Sinorhizobium meliloti USDA1200 Isolate Nodule
144 2924158325 Sinorhizobium meliloti USDA1146 Isolate Nodule
145 2924179722 Sinorhizobium meliloti USDA1280 Isolate Nodule
146 2928531327 Caulobacter sp. 1776 Isolate Rhizosphere
147 2933570622 Rhizobium leguminosarum SEMIA 409 Isolate Nodule
148 2933586486 Rhizobium leguminosarum SEMIA 4039 Isolate Nodule
149 2933599457 Rhizobium phaseoli M3 Isolate Nodule
150 2935894831 Rhizobium leguminosarum SEMIA 419 Isolate Nodule
151 2935901341 Rhizobium leguminosarum SEMIA 4082 Isolate Nodule
152 2936367885 Rhizobium changzhiense WYCCWR 11290 Isolate Nodule
153 2936375103 Rhizobium changzhiense WYCCWR 11317 Isolate Nodule
154 2936381700 Rhizobium chutanense C16 Isolate Unclassified
155 2937002841 Sinorhizobium meliloti USDA1006 Isolate Nodule
156 2937063883 Sinorhizobium meliloti USDA1808 Isolate Nodule
157 2937098957 Sinorhizobium meliloti USDA1519 Isolate Nodule
158 2946787523 Sphingomonas faeni W4I17 Isolate Rhizosphere
159 2957388812 Sinorhizobium meliloti USDA1195 Isolate Nodule
160 2957430029 Sinorhizobium meliloti USDA1590 Isolate Nodule
161 2957471148 Sinorhizobium meliloti USDA1204 Isolate Nodule
162 2957498199 Sinorhizobium meliloti USDA1561 Isolate Nodule
163 2960603979 Sinorhizobium meliloti USDA1580 Isolate Nodule
164 2960624210 Sinorhizobium meliloti USDA1415 Isolate Nodule
165 2964628898 Sinorhizobium meliloti USDA1191 Isolate Nodule
166 2964678106 Sinorhizobium meliloti USDA1210 Isolate Nodule
167 2967678726 Sinorhizobium meliloti USDA1467 Isolate Nodule
168 2967693043 Sinorhizobium meliloti USDA1183 Isolate Nodule
169 2967762386 Sinorhizobium meliloti USDA1397 Isolate Nodule
170 2970019648 Sinorhizobium meliloti USDA1603 Isolate Nodule
171 2970047711 Sinorhizobium meliloti USDA1793 Isolate Nodule
172 2970061556 Sinorhizobium meliloti USDA1810 Isolate Nodule
173 2970095765 Sinorhizobium meliloti USDA1225 Isolate Nodule
174 2970109326 Sinorhizobium meliloti USDA1186 Isolate Nodule
175 2970129317 Sinorhizobium meliloti USDA1008 Isolate Nodule
176 2970149975 Sinorhizobium meliloti USDA1215 Isolate Nodule
177 2970170962 Sinorhizobium meliloti USDA1571 Isolate Nodule
178 2977537788 Sinorhizobium meliloti USDA1184 Isolate Nodule
179 2977551784 Sinorhizobium meliloti USDA1035 Isolate Nodule
180 2977572785 Sinorhizobium meliloti USDA1767 Isolate Nodule
181 2996893221 Rhizobium sp. R635 Isolate Nodule
182 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
183 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
184 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
185 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
186 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
187 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
188 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
189 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
190 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
191 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
192 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
193 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
194 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
195 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
196 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
197 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
198 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
199 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
200 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
201 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
202 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
203 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
204 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
205 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
206 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
207 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
208 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
209 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
210 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
211 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
212 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
213 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
214 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
215 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
216 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
217 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
218 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
219 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
220 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
221 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
222 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
223 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
224 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
225 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
226 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
227 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
228 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
229 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
230 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
231 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
232 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
233 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
234 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
235 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
236 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
237 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
238 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
239 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
240 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
241 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
242 3300009765 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule Metagenome Nodule
243 3300009766 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule Metagenome Nodule
244 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
245 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
246 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
247 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
248 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
249 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
250 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
251 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
252 3300015687 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 002.1_G08 Metagenome Rhizosphere
253 3300015689 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A02 Metagenome Rhizosphere
254 3300015690 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 Metagenome Rhizosphere
255 3300022739 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - brown nodules Metagenome Nodule
256 3300022740 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - pink nodules Metagenome Nodule
257 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
258 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
259 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
260 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
261 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
262 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
263 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
264 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
265 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
266 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
267 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
268 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
269 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
270 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
271 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
272 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
273 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
274 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
275 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
276 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
277 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
278 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
279 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
280 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
281 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
282 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
283 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
284 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
285 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
286 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
287 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
288 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
289 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
290 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
291 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
292 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
293 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
294 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
295 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
296 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
297 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
298 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
299 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
300 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
301 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
302 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
303 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
304 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
305 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
306 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
307 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
308 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
309 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
310 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
311 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
312 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
313 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
314 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
315 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
316 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
317 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
318 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
319 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
320 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
321 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
322 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
323 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
324 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
325 3300041462 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_8 MetaG Metagenome Rhizoplane
326 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
327 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
328 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
329 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
330 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
331 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
332 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
333 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
334 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
335 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
336 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
337 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
338 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
339 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
340 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
341 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
342 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
343 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
344 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
345 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
346 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
347 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
348 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
349 3300042533 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 Metagenome Rhizosphere
350 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
351 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
352 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
353 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
354 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
355 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
356 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
357 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
358 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
359 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
360 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
361 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
362 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
363 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
364 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
365 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
366 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
367 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
368 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
369 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
370 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
371 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
372 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
373 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
374 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
375 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
376 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
377 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
378 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
379 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
380 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
381 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
382 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
383 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
384 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
385 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
386 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
387 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
388 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
389 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
390 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
391 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
392 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
393 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
394 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
395 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
396 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
397 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
398 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
399 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
400 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
401 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
402 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
403 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
404 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
405 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
406 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
407 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
408 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
409 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
410 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
411 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
412 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
413 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
414 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
415 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
416 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
417 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
418 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
419 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
420 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
421 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
422 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
423 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
424 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
425 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
426 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
427 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
428 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
429 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
430 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
431 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
432 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
433 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
434 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
435 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
436 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
437 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
438 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
439 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
440 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
441 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
442 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
443 639633055 Rhizobium leguminosarum bv. viciae 3841 Isolate Unclassified
444 8005275841 Rhizobium sp. N4311 Isolate Nodule
445 8005282627 Rhizobium phaseoli NC1 Isolate Nodule
446 8005289223 Rhizobium bangladeshense 1002 Isolate Nodule
447 8005301065 Rhizobium bangladeshense 1017 Isolate Nodule
448 8005307578 Rhizobium leguminosarum bv. phaseoli LCS0306 Isolate Unclassified
449 8005376324 Rhizobium changzhiense WYCCWR 11279 Isolate Nodule
450 8005382845 Rhizobium sp. R634 Isolate Nodule
451 8005395548 Rhizobium sp. R339 Isolate Nodule
452 8005430974 Rhizobium phaseoli Y20 Isolate Nodule
453 8005460587 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
454 8005497431 Rhizobium phaseoli CCGM8 Isolate Unclassified
455 8005556819 Rhizobium sp. WYCCWR 11128 Isolate Nodule
456 8005563573 Rhizobium sp. WYCCWR 11152 Isolate Nodule
457 8005570704 Rhizobium anhuiense bv. trifolii WYCCWR10015 Isolate Nodule
458 8005619151 Rhizobium phaseoli CCGM2 Isolate Unclassified
459 8005626139 Rhizobium phaseoli Y18 Isolate Nodule
460 8005668836 Rhizobium phaseoli CCGM9 Isolate Unclassified
461 8005688590 Rhizobium bangladeshense 1024 Isolate Nodule
462 8005695170 Rhizobium sp. RMa-01 Isolate Unclassified
463 8018127388 Rhizobium aegyptiacum 950 Isolate Nodule
464 8018163183 Rhizobium sp. WYCCWR 11146 Isolate Nodule
465 8018176218 Rhizobium sp. N122 Isolate Nodule
466 8023680758 Rhizobium leguminosarum SARCC-132 Isolate Nodule
467 8024479707 Rhizobium leguminosarum Tri-43 Isolate Nodule
468 8024501048 Rhizobium sp. H4 Isolate Nodule
469 8046767195 Rhizobium calliandrae CCGE524 Isolate Unclassified
470 8056375014 Rhizobium redzepovicii 18T Isolate Nodule
471 8056382006 Rhizobium croatiense 13T Isolate Nodule
472 8057874678 Rhizobium acaciae 1AS12 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 62.17
Metatranscriptomes 0.36
Isolates 37.48

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 15.28
Nodule 34.99
Rhizoplane 1.78
Rhizosphere 40.5
Stem 0
Stem Tuber 0
Unclassified 7.46

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24735J21928_10000432 3300002067 Bacteria 14659
2 JGI25152J39213_1000546 3300002773 Bacteria 20714
3 JGI25151J46595_10003368 3300003187 Bacteria 8851
4 JGI25153J46596_10009788 3300003215 Bacteria 4406
5 JGI25153J46596_10020726 3300003215 Bacteria 2476
6 JGI25153J46596_10024070 3300003215 Bacteria 2202
7 JGI25160J50197_1029341 3300003354 Bacteria 1457
8 JGI25161J50226_1008342 3300003374 Bacteria 1607
9 JGI25404J52841_10000657 3300003659 Bacteria 5270
10 Ga0055533_1000826 3300003756 Bacteria 9539
11 Ga0055524_1032680 3300003775 Bacteria 1470
12 Ga0055524_1046466 3300003775 Bacteria 1032
13 Ga0055536_1010719 3300003781 Bacteria 3598
14 Ga0055528_1000114 3300003790 Bacteria 64549
15 Ga0055528_1000167 3300003790 Bacteria 55317
16 Ga0055528_1015534 3300003790 Bacteria 2745
17 Ga0055528_1020507 3300003790 Bacteria 2143
18 Ga0055530_10000177 3300003791 Bacteria 58191
19 Ga0055540_1000169 3300003792 Bacteria 64875
20 Ga0055531_10000305 3300003794 Bacteria 48655
21 Ga0065165_1002117 3300005262 Bacteria 18094
22 Ga0065714_10064907 3300005288 Bacteria 15754
23 Ga0068869_100046101 3300005334 Bacteria 3142
24 Ga0070675_100087485 3300005354 Bacteria 2605
25 Ga0070675_100436592 3300005354 Bacteria 1173
26 Ga0070673_100221899 3300005364 Bacteria 1636
27 Ga0070688_100091418 3300005365 Bacteria 1989
28 Ga0070700_100016498 3300005441 Bacteria 4208
29 Ga0070694_100032347 3300005444 Bacteria 3435
30 Ga0070708_100052322 3300005445 Bacteria 3621
31 Ga0070706_100003164 3300005467 Bacteria 16264
32 Ga0070706_100022313 3300005467 Bacteria 5828
33 Ga0070707_100033262 3300005468 Bacteria 4916
34 Ga0070698_100001031 3300005471 Bacteria 30624
35 Ga0070698_100018421 3300005471 Bacteria 7352
36 Ga0070698_100047220 3300005471 Bacteria 4401
37 Ga0070698_100262982 3300005471 Bacteria 1657
38 Ga0070699_100017215 3300005518 Bacteria 6207
39 Ga0070699_100084131 3300005518 Bacteria 2776
40 Ga0070697_100016196 3300005536 Bacteria 5863
41 Ga0070697_100078159 3300005536 Bacteria 2722
42 Ga0068853_100132259 3300005539 Bacteria 2235
43 Ga0070704_100031807 3300005549 Bacteria 3552
44 Ga0068859_100366627 3300005617 Bacteria 1536
45 Ga0068870_10093394 3300005840 Bacteria 1687
46 Ga0068862_100006343 3300005844 Bacteria 9832
47 Ga0081455_10000881 3300005937 Bacteria 38864
48 Ga0081539_10009656 3300005985 Bacteria 7999
49 Ga0070717_10041448 3300006028 Bacteria 3753
50 Ga0075365_10051574 3300006038 Bacteria 2718
51 Ga0075368_10045259 3300006042 Bacteria 1738
52 Ga0075363_100028382 3300006048 Bacteria 2878
53 Ga0075363_100092777 3300006048 Bacteria 1663
54 Ga0075364_10175597 3300006051 Bacteria 1449
55 Ga0075362_10002333 3300006177 Bacteria 6349
56 Ga0075362_10026185 3300006177 Bacteria 2489
57 Ga0075367_10003748 3300006178 Bacteria 7317
58 Ga0075367_10019831 3300006178 Bacteria 3734
59 Ga0075369_10033302 3300006186 Bacteria 2183
60 Ga0075369_10035994 3300006186 Bacteria 2105
61 Ga0075366_10017393 3300006195 Bacteria 4137
62 Ga0075366_10036487 3300006195 Bacteria 2898
63 Ga0075366_10048010 3300006195 Bacteria 2531
64 Ga0075370_10049883 3300006353 Bacteria 2373
65 Ga0075370_10178352 3300006353 Bacteria 1250
66 Ga0075428_100596584 3300006844 Bacteria 1180
67 Ga0075430_100055604 3300006846 Bacteria 3328
68 Ga0075430_100265950 3300006846 Bacteria 1420
69 Ga0075431_100035919 3300006847 Bacteria 5103
70 Ga0075431_100315667 3300006847 Bacteria 1577
71 Ga0075433_10323692 3300006852 Bacteria 1364
72 Ga0075434_100450806 3300006871 Bacteria 1308
73 Ga0075436_100025527 3300006914 Bacteria 4067
74 Ga0097620_100366580 3300006931 Bacteria 1536
75 Ga0079104_1007009 3300006946 Bacteria 4155
76 Ga0105250_10016774 3300009092 Bacteria 2981
77 Ga0105240_10331732 3300009093 Bacteria 1731
78 Ga0105247_10202073 3300009101 Bacteria 1336
79 Ga0114129_10623266 3300009147 Bacteria 1395
80 Ga0105242_10078460 3300009176 Bacteria 2757
81 Ga0105237_10520469 3300009545 Bacteria 1196
82 Ga0105249_10677431 3300009553 Bacteria 1090
83 Ga0123341_1000013 3300009765 Bacteria 97696
84 Ga0123342_1024412 3300009766 Bacteria 3787
85 Ga0105239_10290111 3300010375 Bacteria 1842
86 Ga0157370_10001147 3300013104 Bacteria 33013
87 Ga0157369_10253398 3300013105 Bacteria 1837
88 Ga0157378_10589075 3300013297 Bacteria 1122
89 Ga0163162_10177895 3300013306 Bacteria 2253
90 Ga0157372_10252025 3300013307 Bacteria 2049
91 Ga0163163_10659514 3300014325 Bacteria 1110
92 Ga0157376_10487834 3300014969 Bacteria 1209
93 Ga0183368_1004 3300015687 Bacteria 1211761
94 Ga0183360_10555 3300015689 Bacteria 1081
95 Ga0183363_1029 3300015690 Bacteria 50632
96 Ga0228711_1005756 3300022739 Bacteria 18764
97 Ga0228710_1005951 3300022740 Bacteria 18765
98 Ga0209129_1000250 3300025258 Bacteria 56427
99 Ga0209129_1002082 3300025258 Bacteria 10276
100 Ga0209673_1000013 3300025273 Bacteria 571633
101 Ga0209673_1000385 3300025273 Bacteria 79491
102 Ga0209673_1000522 3300025273 Bacteria 62876
103 Ga0209675_1000097 3300025291 Bacteria 131546
104 Ga0209676_1000175 3300025292 Bacteria 153258
105 Ga0209676_1038801 3300025292 Bacteria 1359
106 Ga0209025_1000172 3300025294 Bacteria 160407
107 Ga0209025_1001166 3300025294 Bacteria 37252
108 Ga0209025_1017908 3300025294 Bacteria 4057
109 Ga0209564_1000118 3300025295 Bacteria 205431
110 Ga0209564_1000264 3300025295 Bacteria 111404
111 Ga0209564_1016816 3300025295 Bacteria 2888
112 Ga0209758_1000005 3300025297 Bacteria 1368918
113 Ga0209758_1003856 3300025297 Bacteria 13150
114 Ga0209758_1012304 3300025297 Bacteria 4803
115 Ga0209050_1000492 3300025298 Bacteria 67914
116 Ga0209050_1002815 3300025298 Bacteria 13889
117 Ga0209256_1000160 3300025299 Bacteria 138781
118 Ga0209256_1000369 3300025299 Bacteria 72557
119 Ga0207426_1000039 3300025302 Bacteria 439937
120 Ga0207426_1000479 3300025302 Bacteria 60939
121 Ga0209051_1000418 3300025303 Bacteria 58817
122 Ga0209051_1000602 3300025303 Bacteria 42068
123 Ga0209051_1009776 3300025303 Bacteria 4913
124 Ga0209051_1009869 3300025303 Bacteria 4882
125 Ga0209257_1000583 3300025304 Bacteria 61032
126 Ga0209257_1002124 3300025304 Bacteria 20695
127 Ga0209257_1004886 3300025304 Bacteria 9898
128 Ga0207688_10231610 3300025901 Bacteria 1115
129 Ga0207647_10028858 3300025904 Bacteria 3598
130 Ga0207645_10196780 3300025907 Bacteria 1325
131 Ga0207684_10002722 3300025910 Bacteria 17629
132 Ga0207684_10004018 3300025910 Bacteria 14061
133 Ga0207684_10008101 3300025910 Bacteria 9368
134 Ga0207684_10216347 3300025910 Bacteria 1653
135 Ga0207663_10018162 3300025916 Bacteria 3935
136 Ga0207663_10040981 3300025916 Bacteria 2819
137 Ga0207660_10280408 3300025917 Bacteria 1322
138 Ga0207652_10022321 3300025921 Bacteria 5235
139 Ga0207646_10024829 3300025922 Bacteria 5486
140 Ga0207681_10171367 3300025923 Bacteria 1645
141 Ga0207650_10075962 3300025925 Bacteria 2537
142 Ga0207659_10037178 3300025926 Bacteria 3378
143 Ga0207700_10226662 3300025928 Bacteria 1587
144 Ga0207700_10503048 3300025928 Bacteria 1072
145 Ga0207706_10074257 3300025933 Bacteria 2990
146 Ga0207709_10424867 3300025935 Bacteria 1022
147 Ga0207691_10055656 3300025940 Bacteria 3604
148 Ga0207668_10216025 3300025972 Bacteria 1536
149 Ga0207708_10029295 3300026075 Bacteria 4172
150 Ga0207675_100021889 3300026118 Bacteria 5951
151 Ga0207683_10400696 3300026121 Bacteria 1262
152 Ga0209281_1006860 3300027111 Bacteria 2909
153 Ga0209969_1002720 3300027360 Bacteria 2449
154 Ga0209999_1005976 3300027543 Bacteria 2187
155 Ga0209971_1000012 3300027682 Bacteria 74016
156 Ga0209966_1002561 3300027695 Bacteria 3035
157 Ga0209998_10000459 3300027717 Bacteria 11310
158 Ga0268265_10004471 3300028380 Bacteria 9688
159 Ga0268265_10366481 3300028380 Bacteria 1321
160 Ga0265319_1037721 3300028563 Bacteria 1646
161 Ga0265338_10002633 3300028800 Bacteria 26474
162 Ga0265338_10003473 3300028800 Bacteria 22157
163 Ga0265762_1001193 3300030760 Bacteria 4717
164 Ga0265760_10017357 3300031090 Bacteria 2067
165 Ga0265328_10033545 3300031239 Bacteria 1903
166 Ga0265320_10002805 3300031240 Bacteria 11997
167 Ga0265325_10113815 3300031241 Bacteria 1312
168 Ga0265339_10003904 3300031249 Bacteria 10329
169 Ga0265339_10006350 3300031249 Bacteria 7768
170 Ga0265331_10042089 3300031250 Bacteria 2217
171 Ga0265316_10009807 3300031344 Bacteria 8792
172 Ga0265314_10001670 3300031711 Bacteria 24168
173 Ga0265342_10001811 3300031712 Bacteria 19437
174 Ga0265342_10176413 3300031712 Bacteria 1172
175 Ga0307516_10191012 3300031730 Bacteria 1774
176 Ga0307413_10036223 3300031824 Bacteria 2839
177 Ga0307413_10293215 3300031824 Bacteria 1230
178 Ga0307410_10020065 3300031852 Bacteria 4080
179 Ga0307407_10291642 3300031903 Bacteria 1134
180 Ga0307412_10059117 3300031911 Bacteria 2568
181 Ga0307409_100013124 3300031995 Bacteria 5316
182 Ga0307411_10013600 3300032005 Bacteria 4497
183 Ga0373937_0548113 3300036401 Bacteria 1098
184 Ga0395905_0005888 3300037471 Bacteria 12444
185 Ga0395905_0180846 3300037471 Bacteria 1980
186 Ga0436360_0304671 3300039438 Bacteria 8371
187 Ga0436363_0735710 3300039450 Bacteria 1271
188 Ga0439436_0004180 3300041404 Bacteria 4423
189 Ga0439438_004488 3300041405 Bacteria 5338
190 Ga0439447_001409 3300041407 Bacteria 8809
191 Ga0439453_0000926 3300041408 Bacteria 3526
192 Ga0439466_0000602 3300041411 Bacteria 13489
193 Ga0439465_0009084 3300041413 Bacteria 3134
194 Ga0451791_1195474 3300041451 Bacteria 923
195 Ga0451806_115708 3300041462 Bacteria 2826
196 Ga0451807_2030052 3300041486 Bacteria 1518
197 Ga0451833_0218675 3300041491 Bacteria 4345
198 Ga0451833_1111154 3300041491 Bacteria 1270
199 Ga0451835_1123733 3300041492 Bacteria 2588
200 Ga0451837_1649472 3300041494 Bacteria 1399
201 Ga0451839_0147971 3300041496 Bacteria 3881
202 Ga0451841_0388975 3300041498 Bacteria 2258
203 Ga0451841_1258288 3300041498 Bacteria 1715
204 Ga0451845_0247088 3300041501 Bacteria 1383
205 Ga0451847_0031488 3300041503 Bacteria 1186
206 Ga0451847_0518925 3300041503 Bacteria 3489
207 Ga0451849_0224329 3300041505 Bacteria 4025
208 Ga0451849_1342573 3300041505 Bacteria 1664
209 Ga0451851_1205647 3300041507 Bacteria 5846
210 Ga0451843_0121327 3300041509 Bacteria 1405
211 Ga0451843_1740549 3300041509 Bacteria 2054
212 Ga0451855_0495296 3300041511 Bacteria 5127
213 Ga0451853_0630583 3300041512 Bacteria 5151
214 Ga0439448_0016210 3300042005 Bacteria 2266
215 Ga0439448_0087372 3300042005 Bacteria 1051
216 Ga0439432_040417 3300042006 Bacteria 1479
217 Ga0439451_024771 3300042009 Bacteria 1209
218 Ga0439452_002248 3300042010 Bacteria 7244
219 Ga0439454_005559 3300042011 Bacteria 1510
220 Ga0439456_040666 3300042013 Bacteria 1007
221 Ga0439463_014991 3300042016 Bacteria 1915
222 Ga0439446_0006738 3300042156 Bacteria 3005
223 Ga0439464_0013264 3300042439 Bacteria 2204
224 Ga0439460_0009613 3300042461 Bacteria 2457
225 Ga0450901_003585 3300042533 Bacteria 1616
226 Ga0451577_0252852 3300042876 Bacteria 1595
227 Ga0453683_0027937 3300044673 Bacteria 3575
228 Ga0453684_0293125 3300044712 Bacteria 1852
229 Ga0451576_0053954 3300045051 Bacteria 4209
230 Ga0451576_0061600 3300045051 Bacteria 3912
231 Ga0495617_000221 3300046452 Bacteria 34624
232 Ga0495627_027808 3300046453 Bacteria 1811
233 Ga0495603_0028359 3300046455 Bacteria 3376
234 Ga0495638_0000073 3300046460 Bacteria 164378
235 Ga0495638_0030838 3300046460 Bacteria 3448
236 Ga0495638_0074734 3300046460 Bacteria 2066
237 Ga0495580_0075093 3300046472 Bacteria 2359
238 Ga0495605_0058383 3300046474 Bacteria 1855
239 Ga0495639_0056935 3300046475 Bacteria 1786
240 Ga0495584_0135989 3300046491 Bacteria 1248
241 Ga0495585_0018099 3300046492 Bacteria 4065
242 Ga0495594_0001181 3300046499 Bacteria 13668
243 Ga0495583_0000087 3300046506 Bacteria 164974
244 Ga0495583_0076325 3300046506 Bacteria 1464
245 Ga0495606_0006993 3300046507 Bacteria 10245
246 Ga0495610_0070744 3300046512 Bacteria 1628
247 Ga0495620_0014886 3300046515 Bacteria 3942
248 Ga0495632_0000270 3300046519 Bacteria 51498
249 Ga0495648_0000049 3300046524 Bacteria 164366
250 Ga0495648_0000642 3300046524 Bacteria 37256
251 Ga0495642_0125797 3300046528 Bacteria 1102
252 Ga0495654_0001044 3300046530 Bacteria 20280
253 Ga0495654_0019127 3300046530 Bacteria 3582
254 Ga0495622_0006217 3300046557 Bacteria 5544
255 Ga0495633_0036746 3300046558 Bacteria 2345
256 Ga0495668_0013295 3300046616 Bacteria 4861
257 Ga0495611_0016243 3300046648 Bacteria 3182
258 Ga0495625_0019775 3300046660 Bacteria 5211
259 Ga0495625_0025002 3300046660 Bacteria 4535
260 Ga0495625_0080670 3300046660 Bacteria 2265
261 Ga0495625_0120028 3300046660 Bacteria 1790
262 Ga0495670_0004850 3300046691 Bacteria 6601
263 Ga0495671_0000042 3300046692 Bacteria 165201
264 Ga0495671_0073469 3300046692 Bacteria 1678
265 Ga0495660_0003279 3300046810 Bacteria 10043
266 Ga0495636_0043904 3300047318 Bacteria 1861
267 Ga0495672_0005190 3300047320 Bacteria 10381
268 Ga0495683_0023726 3300047323 Bacteria 3152
269 Ga0495687_000222 3300047443 Bacteria 80818
270 Ga0495687_000377 3300047443 Bacteria 55506
271 Ga0495687_009383 3300047443 Bacteria 5472
272 Ga0495687_066982 3300047443 Bacteria 1455
273 Ga0495685_057461 3300047447 Bacteria 1314
274 Ga0495673_0000111 3300047469 Bacteria 164974
275 Ga0495673_0070554 3300047469 Bacteria 1471
276 Ga0495686_0008763 3300047472 Bacteria 7375
277 Ga0496102_0181347 3300048905 Bacteria 1984
278 Ga0496103_0175269 3300048906 Bacteria 1378
279 Ga0496104_0820360 3300048907 Bacteria 836
280 Ga0496112_0141642 3300048915 Bacteria 2374
281 Ga0496113_0065925 3300048916 Bacteria 2741
282 Ga0496115_0000040 3300048918 Bacteria 122975
283 Ga0496115_0141545 3300048918 Bacteria 1985
284 Ga0496116_0121026 3300048919 Bacteria 1515
285 Ga0496117_0133832 3300048920 Bacteria 1497
286 Ga0496118_0004322 3300048921 Bacteria 16944
287 Ga0496121_0053365 3300048924 Bacteria 3387
288 Ga0496122_0011912 3300048925 Bacteria 8732
289 Ga0496123_0114493 3300048926 Bacteria 1533
290 Ga0496124_0042423 3300048927 Bacteria 3918
291 Ga0496124_0217674 3300048927 Bacteria 1439
292 Ga0496124_0264346 3300048927 Bacteria 1264
293 Ga0495678_024131 3300049459 Bacteria 2631
294 Ga0495682_0003159 3300049460 Bacteria 7427
295 Ga0495682_0008879 3300049460 Bacteria 3946
296 Ga0501031_0175349 3300049568 Bacteria 1400
297 Ga0501032_0084778 3300049569 Bacteria 2106
298 Ga0501033_0005016 3300049570 Bacteria 10534
299 Ga0501033_0203796 3300049570 Bacteria 1412
300 Ga0501034_0001197 3300049571 Bacteria 35694
301 Ga0501037_0187700 3300049573 Bacteria 1464
302 Ga0501038_0028910 3300049574 Bacteria 4919
303 Ga0501042_0014740 3300049578 Bacteria 5337
304 Ga0501043_0014211 3300049579 Bacteria 6229
305 Ga0501043_0067493 3300049579 Bacteria 2808
306 Ga0501046_0041742 3300049580 Bacteria 3659
307 Ga0501047_0071947 3300049581 Bacteria 3328
308 Ga0501067_0029252 3300049583 Bacteria 3053
309 Ga0501067_0063209 3300049583 Bacteria 2050
310 Ga0501070_0277967 3300049586 Bacteria 1366
311 Ga0501071_0191904 3300049587 Bacteria 1532
312 Ga0501073_0203333 3300049589 Bacteria 1369
313 Ga0501076_0256577 3300049592 Bacteria 1431
314 Ga0501080_0137269 3300049742 Bacteria 2262
315 Ga0501083_0205151 3300049744 Bacteria 1285
316 Ga0501035_0186998 3300049822 Bacteria 1782
317 Ga0501035_0233547 3300049822 Bacteria 1566
318 Ga0501044_0026836 3300049823 Bacteria 6096
319 nmdc:mga03683_20419_c1 3300050489 Bacteria 2541
320 nmdc:mga03683_31349_c1 3300050489 Bacteria 2132
321 nmdc:mga0k408_49080_c1 3300050493 Bacteria 2443
322 nmdc:mga0k408_7226_c1 3300050493 Bacteria 5934
323 nmdc:mga06z11_19277_c1 3300050494 Bacteria 3133
324 nmdc:mga06z11_66028_c1 3300050494 Bacteria 1900
325 nmdc:mga06z11_8609_c1 3300050494 Bacteria 4265
326 nmdc:mga07m45_73469_c1 3300050496 Bacteria 1947
327 nmdc:mga05p37_325930_c1 3300050507 Bacteria 1816
328 nmdc:mga05p37_96659_c1 3300050507 Bacteria 3639
329 nmdc:mga09592_326920_c1 3300050508 Bacteria 1328
330 nmdc:mga0qj67_30630_c1 3300050509 Bacteria 4189
331 nmdc:mga0qj67_32867_c1 3300050509 Bacteria 4047
332 nmdc:mga0qj67_404815_c1 3300050509 Bacteria 1101
333 nmdc:mga06r32_106665_c1 3300050510 Bacteria 2753
334 nmdc:mga06r32_235614_c1 3300050510 Bacteria 1818
335 nmdc:mga06r32_3041_c1 3300050510 Bacteria 15019
336 nmdc:mga06r32_60536_c1 3300050510 Bacteria 3644
337 nmdc:mga0n895_489046_c1 3300050512 Bacteria 1240
338 nmdc:mga0sz30_156623_c1 3300050516 Bacteria 1009
339 nmdc:mga0sz30_20933_c2 3300050516 Bacteria 2152
340 Ga0500578_0132191 3300053086 Bacteria 1564
341 Ga0500583_0047987 3300053092 Bacteria 1969
342 Ga0500569_008517 3300053109 Bacteria 2348
343 Ga0500642_0012171 3300053130 Bacteria 3109
344 Ga0500658_0000577 3300053134 Bacteria 15447
345 Ga0500559_0008682 3300053136 Bacteria 4440
346 Ga0500559_0035897 3300053136 Bacteria 2142
347 Ga0500604_0017147 3300053151 Bacteria 2000
348 Ga0500616_0016033 3300053153 Bacteria 4275
349 Ga0500634_0016841 3300053161 Bacteria 3906
350 Ga0500609_000561 3300053731 Bacteria 5614
351 Ga0501082_0483337 3300060353 Bacteria 1082
352 Ga0530510_0099525 3300061734 Bacteria 2126

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048907 Ga0496104_0820360 Ga0496104_0820360_25_777 250
2 3300031090 Ga0265760_10017357 Ga0265760_100173572 255
3 iso_pu_bacteria 8005497431 8005500575 258
4 iso_pu_bacteria 8005668836 8005671993 258
5 3300042533 Ga0450901_003585 Ga0450901_003585_232_1212 260
6 iso_pu_bacteria 2509276021 2509392382 269
7 iso_pu_bacteria 2509276033 2509446682 269
8 iso_pu_bacteria 2510065019 2510133614 269
9 iso_pu_bacteria 2510461076 2510895017 269
10 iso_pu_bacteria 2511231052 2511503632 269
11 iso_pu_bacteria 2513237084 2513573872 269
12 iso_pu_bacteria 2513237085 2513577588 269
13 iso_pu_bacteria 2513237093 2513629767 269
14 iso_pu_bacteria 2513237103 2513708406 269
15 iso_pu_bacteria 2513237162 2514022457 269
16 iso_pu_bacteria 2515075009 2515112608 269
17 iso_pu_bacteria 2515154113 2515634227 269
18 iso_pu_bacteria 2515154114 2515640101 269
19 iso_pu_bacteria 2515154116 2515655704 269
20 iso_pu_bacteria 2515154134 2515740154 269
21 iso_pu_bacteria 2516653077 2517036341 269
22 iso_pu_bacteria 2516653085 2517076719 269
23 iso_pu_bacteria 2517093000 2517095473 269
24 iso_pu_bacteria 2517287029 2517407057 269
25 iso_pu_bacteria 2529292951 2530645789 269
26 iso_pu_bacteria 2551306086 2551696334 269
27 iso_pu_bacteria 2551306089 2551711976 269
28 iso_pu_bacteria 2551306090 2551719058 269
29 iso_pu_bacteria 2551306092 2551732886 269
30 iso_pu_bacteria 2585427526 2585527095 269
31 iso_pu_bacteria 2585427528 2585537844 269
32 iso_pu_bacteria 2585427593 2585835793 269
33 iso_pu_bacteria 2615840624 2616292234 269
34 iso_pu_bacteria 2643221736 2644747837 269
35 iso_pu_bacteria 2718217882 2719181517 269
36 iso_pu_bacteria 2718217927 2719386028 269
37 iso_pu_bacteria 2718217997 2719665841 269
38 iso_pu_bacteria 2718218009 2719732181 269
39 iso_pu_bacteria 2718218199 2720492261 269
40 iso_pu_bacteria 2718218232 2720613616 269
41 iso_pu_bacteria 2718218233 2720620399 269
42 iso_pu_bacteria 2718218235 2720631824 269
43 iso_pu_bacteria 2718218269 2720775552 269
44 iso_pu_bacteria 2718218363 2721147609 269
45 iso_pu_bacteria 2718218365 2721159053 269
46 iso_pu_bacteria 2718218366 2721164444 269
47 iso_pu_bacteria 2718218423 2721399808 269
48 iso_pu_bacteria 2721755514 2722840614 269
49 iso_pu_bacteria 2721755556 2723027169 269
50 iso_pu_bacteria 2721755684 2723560781 269
51 iso_pu_bacteria 2721755685 2723567371 269
52 iso_pu_bacteria 2721755809 2724038621 269
53 iso_pu_bacteria 2721755810 2724044937 269
54 iso_pu_bacteria 2721755819 2724090159 269
55 iso_pu_bacteria 2721755822 2724104636 269
56 iso_pu_bacteria 2721755823 2724110448 269
57 iso_pu_bacteria 2724679232 2725947981 269
58 iso_pu_bacteria 2728369352 2730108105 269
59 iso_pu_bacteria 2728369365 2730164752 269
60 iso_pu_bacteria 2728369397 2730298685 269
61 iso_pu_bacteria 2738541333 2739032500 269
62 iso_pu_bacteria 2765235942 2766066823 269
63 iso_pu_bacteria 2791355256 2793294927 269
64 iso_pu_bacteria 2791355259 2793312507 269
65 iso_pu_bacteria 2791355260 2793323041 269
66 iso_pu_bacteria 2791355261 2793329048 269
67 iso_pu_bacteria 2791355262 2793337253 269
68 iso_pu_bacteria 2791355263 2793344074 269
69 iso_pu_bacteria 2791355264 2793349874 269
70 iso_pu_bacteria 2791355265 2793357067 269
71 iso_pu_bacteria 2791355266 2793360658 269
72 iso_pu_bacteria 2791355267 2793367034 269
73 iso_pu_bacteria 2802429605 2805925943 269
74 iso_pu_bacteria 2802429606 2805938290 269
75 iso_pu_bacteria 2802429633 2806043475 269
76 iso_pu_bacteria 2802429634 2806050593 269
77 iso_pu_bacteria 2802429635 2806057410 269
78 iso_pu_bacteria 2802429636 2806064789 269
79 iso_pu_bacteria 2802429637 2806072056 269
80 iso_pu_bacteria 2838016132 2838017966 269
81 iso_pu_bacteria 2838022645 2838026172 269
82 iso_pu_bacteria 2838042994 2838043681 269
83 iso_pu_bacteria 2838048938 2838051731 269
84 iso_pu_bacteria 2838061910 2838066156 269
85 iso_pu_bacteria 2838068647 2838074449 269
86 iso_pu_bacteria 2838668709 2838673611 269
87 iso_pu_bacteria 2838680041 2838681927 269
88 iso_pu_bacteria 2838686498 2838687407 269
89 iso_pu_bacteria 2838694306 2838696497 269
90 iso_pu_bacteria 2838701080 2838706007 269
91 iso_pu_bacteria 2838707686 2838710262 269
92 iso_pu_bacteria 2838729681 2838736197 269
93 iso_pu_bacteria 2838742623 2838749016 269
94 iso_pu_bacteria 2841851746 2841858660 269
95 iso_pu_bacteria 2841864319 2841870708 269
96 iso_pu_bacteria 2842077413 2842078437 269
97 iso_pu_bacteria 2842110456 2842114091 269
98 iso_pu_bacteria 2842118031 2842119054 269
99 iso_pu_bacteria 2842146304 2842150859 269
100 iso_pu_bacteria 2842156927 2842157109 269
101 iso_pu_bacteria 2842163707 2842167766 269
102 iso_pu_bacteria 2842180545 2842181307 269
103 iso_pu_bacteria 2842192696 2842194262 269
104 iso_pu_bacteria 2842198810 2842201895 269
105 iso_pu_bacteria 2842205361 2842205787 269
106 iso_pu_bacteria 2842217011 2842217565 269
107 iso_pu_bacteria 2842229732 2842230641 269
108 iso_pu_bacteria 2842237096 2842239674 269
109 iso_pu_bacteria 2842243621 2842249919 269
110 iso_pu_bacteria 2842250916 2842255821 269
111 iso_pu_bacteria 2842257432 2842263926 269
112 iso_pu_bacteria 2842264693 2842265802 269
113 iso_pu_bacteria 2842271015 2842271054 269
114 iso_pu_bacteria 2842278818 2842279244 269
115 iso_pu_bacteria 2842285085 2842285889 269
116 iso_pu_bacteria 2842291075 2842292099 269
117 iso_pu_bacteria 2842304105 2842304684 269
118 iso_pu_bacteria 2842311132 2842314491 269
119 iso_pu_bacteria 2842317721 2842322936 269
120 iso_pu_bacteria 2842341865 2842345376 269
121 iso_pu_bacteria 2842363717 2842364830 269
122 iso_pu_bacteria 2842370503 2842372492 269
123 iso_pu_bacteria 2842377471 2842378495 269
124 iso_pu_bacteria 2842384541 2842385564 269
125 iso_pu_bacteria 2842395702 2842398944 269
126 iso_pu_bacteria 2842402390 2842403248 269
127 iso_pu_bacteria 2842409023 2842409379 269
128 iso_pu_bacteria 2842415677 2842416032 269
129 iso_pu_bacteria 2842422224 2842428174 269
130 iso_pu_bacteria 2842428310 2842429561 269
131 iso_pu_bacteria 2842434925 2842436174 269
132 iso_pu_bacteria 2842441272 2842442521 269
133 iso_pu_bacteria 2842447887 2842454352 269
134 iso_pu_bacteria 2842462802 2842463982 269
135 iso_pu_bacteria 2842469257 2842470503 269
136 iso_pu_bacteria 2842489311 2842490274 269
137 iso_pu_bacteria 2842495871 2842495930 269
138 iso_pu_bacteria 2844454524 2844458777 269
139 iso_pu_bacteria 2855825444 2855831147 269
140 iso_pu_bacteria 2857516855 2857520088 269
141 iso_pu_bacteria 2916007675 2916009132 269
142 iso_pu_bacteria 2916014648 2916015862 269
143 iso_pu_bacteria 2921237296 2921238305 269
144 iso_pu_bacteria 2921296804 2921303938 269
145 iso_pu_bacteria 2924158325 2924165195 269
146 iso_pu_bacteria 2924179722 2924186162 269
147 iso_pu_bacteria 2933570622 2933571957 269
148 iso_pu_bacteria 2933586486 2933590187 269
149 iso_pu_bacteria 2933599457 2933604905 269
150 iso_pu_bacteria 2935894831 2935897646 269
151 iso_pu_bacteria 2935901341 2935905375 269
152 iso_pu_bacteria 2936367885 2936372408 269
153 iso_pu_bacteria 2936375103 2936380790 269
154 iso_pu_bacteria 2936381700 2936387555 269
155 iso_pu_bacteria 2937002841 2937003478 269
156 iso_pu_bacteria 2937063883 2937065565 269
157 iso_pu_bacteria 2937098957 2937099783 269
158 iso_pu_bacteria 2957388812 2957394630 269
159 iso_pu_bacteria 2957430029 2957430418 269
160 iso_pu_bacteria 2957471148 2957472528 269
161 iso_pu_bacteria 2957498199 2957499293 269
162 iso_pu_bacteria 2960603979 2960604987 269
163 iso_pu_bacteria 2960624210 2960625421 269
164 iso_pu_bacteria 2964628898 2964630206 269
165 iso_pu_bacteria 2964678106 2964679965 269
166 iso_pu_bacteria 2967678726 2967679733 269
167 iso_pu_bacteria 2967693043 2967699477 269
168 iso_pu_bacteria 2967762386 2967763341 269
169 iso_pu_bacteria 2970019648 2970020689 269
170 iso_pu_bacteria 2970047711 2970048579 269
171 iso_pu_bacteria 2970061556 2970062856 269
172 iso_pu_bacteria 2970095765 2970096640 269
173 iso_pu_bacteria 2970109326 2970116232 269
174 iso_pu_bacteria 2970129317 2970135540 269
175 iso_pu_bacteria 2970149975 2970156779 269
176 iso_pu_bacteria 2970170962 2970171670 269
177 iso_pu_bacteria 2977537788 2977544284 269
178 iso_pu_bacteria 2977551784 2977558612 269
179 iso_pu_bacteria 2977572785 2977579553 269
180 iso_pu_bacteria 2996893221 2996898521 269
181 iso_pu_bacteria 639633055 639648845 269
182 iso_pu_bacteria 8005275841 8005280813 269
183 iso_pu_bacteria 8005282627 8005286534 269
184 iso_pu_bacteria 8005289223 8005293334 269
185 iso_pu_bacteria 8005301065 8005302806 269
186 iso_pu_bacteria 8005307578 8005312475 269
187 iso_pu_bacteria 8005376324 8005379515 269
188 iso_pu_bacteria 8005382845 8005385596 269
189 iso_pu_bacteria 8005395548 8005396491 269
190 iso_pu_bacteria 8005430974 8005431670 269
191 iso_pu_bacteria 8005460587 8005463281 269
192 iso_pu_bacteria 8005556819 8005557394 269
193 iso_pu_bacteria 8005563573 8005566069 269
194 iso_pu_bacteria 8005570704 8005574557 269
195 iso_pu_bacteria 8005619151 8005621955 269
196 iso_pu_bacteria 8005626139 8005627191 269
197 iso_pu_bacteria 8005688590 8005689990 269
198 iso_pu_bacteria 8005695170 8005696591 269
199 iso_pu_bacteria 8018127388 8018130163 269
200 iso_pu_bacteria 8018163183 8018166478 269
201 iso_pu_bacteria 8018176218 8018178772 269
202 iso_pu_bacteria 8023680758 8023685075 269
203 iso_pu_bacteria 8024479707 8024483235 269
204 iso_pu_bacteria 8024501048 8024501390 269
205 iso_pu_bacteria 8056375014 8056376871 269
206 iso_pu_bacteria 8056382006 8056388095 269
207 iso_pu_bacteria 8057874678 8057874727 269
208 3300025910 Ga0207684_10216347 Ga0207684_102163473 271
209 3300031824 Ga0307413_10293215 Ga0307413_102932152 271
210 3300005844 Ga0068862_100006343 Ga0068862_10000634311 272
211 3300006195 Ga0075366_10036487 Ga0075366_100364871 272
212 3300013297 Ga0157378_10589075 Ga0157378_105890751 272
213 3300025297 Ga0209758_1000005 Ga0209758_10000051194 272
214 3300025916 Ga0207663_10040981 Ga0207663_100409811 272
215 3300028380 Ga0268265_10004471 Ga0268265_100044711 272
216 3300037471 Ga0395905_0005888 Ga0395905_0005888_2342_3172 272
217 3300041462 Ga0451806_115708 Ga0451806_115708_1030_1860 272
218 3300041486 Ga0451807_2030052 Ga0451807_2030052_630_1460 272
219 3300045051 Ga0451576_0061600 Ga0451576_0061600_514_1341 272
220 3300046460 Ga0495638_0030838 Ga0495638_0030838_1466_2440 272
221 3300046472 Ga0495580_0075093 Ga0495580_0075093_1216_2037 272
222 3300046660 Ga0495625_0019775 Ga0495625_0019775_1629_2612 272
223 3300048927 Ga0496124_0264346 Ga0496124_0264346_68_898 272
224 3300053130 Ga0500642_0012171 Ga0500642_0012171_2171_3001 272
225 3300053151 Ga0500604_0017147 Ga0500604_0017147_58_888 272
226 3300053731 Ga0500609_000561 Ga0500609_000561_2897_3727 272
227 iso_pu_bacteria 2643221640 2644227550 272
228 iso_pu_bacteria 2643221642 2644236932 272
229 iso_pu_bacteria 2884960567 2884964730 272
230 iso_pu_bacteria 2928531327 2928531736 272
231 3300002067 JGI24735J21928_10000432 JGI24735J21928_100004321 273
232 3300002773 JGI25152J39213_1000546 JGI25152J39213_100054616 273
233 3300003187 JGI25151J46595_10003368 JGI25151J46595_100033687 273
234 3300003215 JGI25153J46596_10009788 JGI25153J46596_100097883 273
235 3300003215 JGI25153J46596_10020726 JGI25153J46596_100207262 273
236 3300003215 JGI25153J46596_10024070 JGI25153J46596_100240703 273
237 3300003354 JGI25160J50197_1029341 JGI25160J50197_10293412 273
238 3300003374 JGI25161J50226_1008342 JGI25161J50226_10083422 273
239 3300003659 JGI25404J52841_10000657 JGI25404J52841_100006575 273
240 3300003756 Ga0055533_1000826 Ga0055533_10008267 273
241 3300003775 Ga0055524_1032680 Ga0055524_10326802 273
242 3300003775 Ga0055524_1046466 Ga0055524_10464661 273
243 3300003781 Ga0055536_1010719 Ga0055536_10107193 273
244 3300003790 Ga0055528_1000114 Ga0055528_100011495 273
245 3300003790 Ga0055528_1000167 Ga0055528_100016725 273
246 3300003790 Ga0055528_1015534 Ga0055528_10155341 273
247 3300003790 Ga0055528_1020507 Ga0055528_10205073 273
248 3300003791 Ga0055530_10000177 Ga0055530_100001777 273
249 3300003792 Ga0055540_1000169 Ga0055540_100016974 273
250 3300003794 Ga0055531_10000305 Ga0055531_100003052 273
251 3300005262 Ga0065165_1002117 Ga0065165_10021179 273
252 3300005288 Ga0065714_10064907 Ga0065714_1006490710 273
253 3300005334 Ga0068869_100046101 Ga0068869_1000461012 273
254 3300005354 Ga0070675_100087485 Ga0070675_1000874852 273
255 3300005354 Ga0070675_100436592 Ga0070675_1004365921 273
256 3300005364 Ga0070673_100221899 Ga0070673_1002218992 273
257 3300005365 Ga0070688_100091418 Ga0070688_1000914183 273
258 3300005441 Ga0070700_100016498 Ga0070700_1000164983 273
259 3300005444 Ga0070694_100032347 Ga0070694_1000323473 273
260 3300005445 Ga0070708_100052322 Ga0070708_1000523222 273
261 3300005467 Ga0070706_100003164 Ga0070706_1000031647 273
262 3300005467 Ga0070706_100022313 Ga0070706_1000223139 273
263 3300005468 Ga0070707_100033262 Ga0070707_1000332623 273
264 3300005471 Ga0070698_100001031 Ga0070698_10000103117 273
265 3300005471 Ga0070698_100018421 Ga0070698_1000184215 273
266 3300005471 Ga0070698_100047220 Ga0070698_1000472202 273
267 3300005471 Ga0070698_100262982 Ga0070698_1002629822 273
268 3300005518 Ga0070699_100017215 Ga0070699_1000172155 273
269 3300005518 Ga0070699_100084131 Ga0070699_1000841312 273
270 3300005536 Ga0070697_100016196 Ga0070697_1000161965 273
271 3300005536 Ga0070697_100078159 Ga0070697_1000781593 273
272 3300005539 Ga0068853_100132259 Ga0068853_1001322593 273
273 3300005549 Ga0070704_100031807 Ga0070704_1000318072 273
274 3300005617 Ga0068859_100366627 Ga0068859_1003666272 273
275 3300005840 Ga0068870_10093394 Ga0068870_100933941 273
276 3300005937 Ga0081455_10000881 Ga0081455_1000088110 273
277 3300005985 Ga0081539_10009656 Ga0081539_100096565 273
278 3300006028 Ga0070717_10041448 Ga0070717_100414484 273
279 3300006038 Ga0075365_10051574 Ga0075365_100515745 273
280 3300006042 Ga0075368_10045259 Ga0075368_100452592 273
281 3300006048 Ga0075363_100028382 Ga0075363_1000283822 273
282 3300006048 Ga0075363_100092777 Ga0075363_1000927772 273
283 3300006051 Ga0075364_10175597 Ga0075364_101755972 273
284 3300006177 Ga0075362_10002333 Ga0075362_100023332 273
285 3300006177 Ga0075362_10026185 Ga0075362_100261852 273
286 3300006178 Ga0075367_10003748 Ga0075367_100037485 273
287 3300006178 Ga0075367_10019831 Ga0075367_100198314 273
288 3300006186 Ga0075369_10033302 Ga0075369_100333022 273
289 3300006186 Ga0075369_10035994 Ga0075369_100359941 273
290 3300006195 Ga0075366_10017393 Ga0075366_100173932 273
291 3300006195 Ga0075366_10048010 Ga0075366_100480103 273
292 3300006353 Ga0075370_10049883 Ga0075370_100498831 273
293 3300006353 Ga0075370_10178352 Ga0075370_101783522 273
294 3300006844 Ga0075428_100596584 Ga0075428_1005965842 273
295 3300006846 Ga0075430_100055604 Ga0075430_1000556042 273
296 3300006846 Ga0075430_100265950 Ga0075430_1002659502 273
297 3300006847 Ga0075431_100035919 Ga0075431_1000359194 273
298 3300006847 Ga0075431_100315667 Ga0075431_1003156671 273
299 3300006852 Ga0075433_10323692 Ga0075433_103236922 273
300 3300006871 Ga0075434_100450806 Ga0075434_1004508061 273
301 3300006914 Ga0075436_100025527 Ga0075436_1000255273 273
302 3300006931 Ga0097620_100366580 Ga0097620_1003665802 273
303 3300006946 Ga0079104_1007009 Ga0079104_10070094 273
304 3300009092 Ga0105250_10016774 Ga0105250_100167743 273
305 3300009093 Ga0105240_10331732 Ga0105240_103317322 273
306 3300009101 Ga0105247_10202073 Ga0105247_102020731 273
307 3300009147 Ga0114129_10623266 Ga0114129_106232662 273
308 3300009176 Ga0105242_10078460 Ga0105242_100784604 273
309 3300009545 Ga0105237_10520469 Ga0105237_105204691 273
310 3300009553 Ga0105249_10677431 Ga0105249_106774311 273
311 3300009765 Ga0123341_1000013 Ga0123341_10000139 273
312 3300009766 Ga0123342_1024412 Ga0123342_10244124 273
313 3300010375 Ga0105239_10290111 Ga0105239_102901112 273
314 3300013104 Ga0157370_10001147 Ga0157370_1000114725 273
315 3300013105 Ga0157369_10253398 Ga0157369_102533982 273
316 3300013306 Ga0163162_10177895 Ga0163162_101778952 273
317 3300013307 Ga0157372_10252025 Ga0157372_102520252 273
318 3300014325 Ga0163163_10659514 Ga0163163_106595141 273
319 3300014969 Ga0157376_10487834 Ga0157376_104878341 273
320 3300015687 Ga0183368_1004 Ga0183368_1004807 273
321 3300015689 Ga0183360_10555 Ga0183360_105551 273
322 3300015690 Ga0183363_1029 Ga0183363_102922 273
323 3300022739 Ga0228711_1005756 Ga0228711_100575618 273
324 3300022740 Ga0228710_1005951 Ga0228710_10059518 273
325 3300025258 Ga0209129_1000250 Ga0209129_100025051 273
326 3300025258 Ga0209129_1002082 Ga0209129_10020823 273
327 3300025273 Ga0209673_1000013 Ga0209673_1000013135 273
328 3300025273 Ga0209673_1000385 Ga0209673_10003853 273
329 3300025273 Ga0209673_1000522 Ga0209673_10005229 273
330 3300025291 Ga0209675_1000097 Ga0209675_1000097126 273
331 3300025292 Ga0209676_1000175 Ga0209676_100017559 273
332 3300025292 Ga0209676_1038801 Ga0209676_10388011 273
333 3300025294 Ga0209025_1000172 Ga0209025_100017249 273
334 3300025294 Ga0209025_1001166 Ga0209025_100116611 273
335 3300025294 Ga0209025_1017908 Ga0209025_10179083 273
336 3300025295 Ga0209564_1000118 Ga0209564_100011897 273
337 3300025295 Ga0209564_1000264 Ga0209564_100026426 273
338 3300025295 Ga0209564_1016816 Ga0209564_10168162 273
339 3300025297 Ga0209758_1003856 Ga0209758_10038567 273
340 3300025297 Ga0209758_1012304 Ga0209758_10123045 273
341 3300025298 Ga0209050_1000492 Ga0209050_100049210 273
342 3300025298 Ga0209050_1002815 Ga0209050_10028158 273
343 3300025299 Ga0209256_1000160 Ga0209256_1000160146 273
344 3300025299 Ga0209256_1000369 Ga0209256_100036972 273
345 3300025302 Ga0207426_1000039 Ga0207426_1000039427 273
346 3300025302 Ga0207426_1000479 Ga0207426_100047912 273
347 3300025303 Ga0209051_1000418 Ga0209051_10004184 273
348 3300025303 Ga0209051_1000602 Ga0209051_10006024 273
349 3300025303 Ga0209051_1009776 Ga0209051_10097766 273
350 3300025303 Ga0209051_1009869 Ga0209051_10098696 273
351 3300025304 Ga0209257_1000583 Ga0209257_100058348 273
352 3300025304 Ga0209257_1002124 Ga0209257_10021247 273
353 3300025304 Ga0209257_1004886 Ga0209257_10048864 273
354 3300025901 Ga0207688_10231610 Ga0207688_102316101 273
355 3300025904 Ga0207647_10028858 Ga0207647_100288582 273
356 3300025907 Ga0207645_10196780 Ga0207645_101967802 273
357 3300025910 Ga0207684_10002722 Ga0207684_100027225 273
358 3300025910 Ga0207684_10004018 Ga0207684_100040186 273
359 3300025910 Ga0207684_10008101 Ga0207684_100081012 273
360 3300025916 Ga0207663_10018162 Ga0207663_100181621 273
361 3300025917 Ga0207660_10280408 Ga0207660_102804082 273
362 3300025921 Ga0207652_10022321 Ga0207652_100223214 273
363 3300025922 Ga0207646_10024829 Ga0207646_100248294 273
364 3300025923 Ga0207681_10171367 Ga0207681_101713671 273
365 3300025925 Ga0207650_10075962 Ga0207650_100759622 273
366 3300025926 Ga0207659_10037178 Ga0207659_100371783 273
367 3300025928 Ga0207700_10226662 Ga0207700_102266623 273
368 3300025928 Ga0207700_10503048 Ga0207700_105030482 273
369 3300025933 Ga0207706_10074257 Ga0207706_100742574 273
370 3300025935 Ga0207709_10424867 Ga0207709_104248671 273
371 3300025940 Ga0207691_10055656 Ga0207691_100556564 273
372 3300025972 Ga0207668_10216025 Ga0207668_102160252 273
373 3300026075 Ga0207708_10029295 Ga0207708_100292953 273
374 3300026118 Ga0207675_100021889 Ga0207675_1000218897 273
375 3300026121 Ga0207683_10400696 Ga0207683_104006962 273
376 3300027111 Ga0209281_1006860 Ga0209281_10068602 273
377 3300027360 Ga0209969_1002720 Ga0209969_10027201 273
378 3300027543 Ga0209999_1005976 Ga0209999_10059763 273
379 3300027682 Ga0209971_1000012 Ga0209971_100001213 273
380 3300027695 Ga0209966_1002561 Ga0209966_10025611 273
381 3300027717 Ga0209998_10000459 Ga0209998_100004592 273
382 3300028380 Ga0268265_10366481 Ga0268265_103664812 273
383 3300028563 Ga0265319_1037721 Ga0265319_10377212 273
384 3300028800 Ga0265338_10002633 Ga0265338_1000263312 273
385 3300028800 Ga0265338_10003473 Ga0265338_1000347315 273
386 3300030760 Ga0265762_1001193 Ga0265762_10011932 273
387 3300031239 Ga0265328_10033545 Ga0265328_100335451 273
388 3300031240 Ga0265320_10002805 Ga0265320_1000280510 273
389 3300031241 Ga0265325_10113815 Ga0265325_101138152 273
390 3300031249 Ga0265339_10003904 Ga0265339_100039047 273
391 3300031249 Ga0265339_10006350 Ga0265339_100063501 273
392 3300031250 Ga0265331_10042089 Ga0265331_100420892 273
393 3300031344 Ga0265316_10009807 Ga0265316_100098075 273
394 3300031711 Ga0265314_10001670 Ga0265314_100016706 273
395 3300031712 Ga0265342_10001811 Ga0265342_1000181112 273
396 3300031712 Ga0265342_10176413 Ga0265342_101764131 273
397 3300031730 Ga0307516_10191012 Ga0307516_101910121 273
398 3300031824 Ga0307413_10036223 Ga0307413_100362232 273
399 3300031852 Ga0307410_10020065 Ga0307410_100200653 273
400 3300031903 Ga0307407_10291642 Ga0307407_102916421 273
401 3300031911 Ga0307412_10059117 Ga0307412_100591171 273
402 3300031995 Ga0307409_100013124 Ga0307409_1000131244 273
403 3300032005 Ga0307411_10013600 Ga0307411_100136003 273
404 3300036401 Ga0373937_0548113 Ga0373937_0548113_208_1032 273
405 3300037471 Ga0395905_0180846 Ga0395905_0180846_486_1322 273
406 3300039438 Ga0436360_0304671 Ga0436360_0304671_3229_4128 273
407 3300039450 Ga0436363_0735710 Ga0436363_0735710_184_1122 273
408 3300041404 Ga0439436_0004180 Ga0439436_0004180_1668_2660 273
409 3300041405 Ga0439438_004488 Ga0439438_004488_2054_3046 273
410 3300041407 Ga0439447_001409 Ga0439447_001409_6182_7174 273
411 3300041408 Ga0439453_0000926 Ga0439453_0000926_2227_3057 273
412 3300041411 Ga0439466_0000602 Ga0439466_0000602_2122_3114 273
413 3300041413 Ga0439465_0009084 Ga0439465_0009084_260_1096 273
414 3300041451 Ga0451791_1195474 Ga0451791_1195474_69_905 273
415 3300041491 Ga0451833_0218675 Ga0451833_0218675_409_1245 273
416 3300041491 Ga0451833_1111154 Ga0451833_1111154_378_1214 273
417 3300041492 Ga0451835_1123733 Ga0451835_1123733_1543_2379 273
418 3300041494 Ga0451837_1649472 Ga0451837_1649472_348_1184 273
419 3300041496 Ga0451839_0147971 Ga0451839_0147971_162_998 273
420 3300041498 Ga0451841_0388975 Ga0451841_0388975_11_847 273
421 3300041498 Ga0451841_1258288 Ga0451841_1258288_608_1444 273
422 3300041501 Ga0451845_0247088 Ga0451845_0247088_391_1227 273
423 3300041503 Ga0451847_0031488 Ga0451847_0031488_14_850 273
424 3300041503 Ga0451847_0518925 Ga0451847_0518925_1107_1943 273
425 3300041505 Ga0451849_0224329 Ga0451849_0224329_2231_3202 273
426 3300041505 Ga0451849_1342573 Ga0451849_1342573_591_1427 273
427 3300041507 Ga0451851_1205647 Ga0451851_1205647_2982_3818 273
428 3300041509 Ga0451843_0121327 Ga0451843_0121327_479_1336 273
429 3300041509 Ga0451843_1740549 Ga0451843_1740549_959_1795 273
430 3300041511 Ga0451855_0495296 Ga0451855_0495296_3034_3870 273
431 3300041512 Ga0451853_0630583 Ga0451853_0630583_1786_2622 273
432 3300042005 Ga0439448_0016210 Ga0439448_0016210_591_1412 273
433 3300042005 Ga0439448_0087372 Ga0439448_0087372_184_1008 273
434 3300042006 Ga0439432_040417 Ga0439432_040417_531_1373 273
435 3300042009 Ga0439451_024771 Ga0439451_024771_46_870 273
436 3300042010 Ga0439452_002248 Ga0439452_002248_3508_4500 273
437 3300042011 Ga0439454_005559 Ga0439454_005559_622_1446 273
438 3300042013 Ga0439456_040666 Ga0439456_040666_129_965 273
439 3300042016 Ga0439463_014991 Ga0439463_014991_761_1585 273
440 3300042156 Ga0439446_0006738 Ga0439446_0006738_941_1933 273
441 3300042439 Ga0439464_0013264 Ga0439464_0013264_1038_1862 273
442 3300042461 Ga0439460_0009613 Ga0439460_0009613_1187_2011 273
443 3300042876 Ga0451577_0252852 Ga0451577_0252852_166_996 273
444 3300044673 Ga0453683_0027937 Ga0453683_0027937_235_1065 273
445 3300044712 Ga0453684_0293125 Ga0453684_0293125_132_959 273
446 3300045051 Ga0451576_0053954 Ga0451576_0053954_548_1378 273
447 3300046452 Ga0495617_000221 Ga0495617_000221_30219_31211 273
448 3300046453 Ga0495627_027808 Ga0495627_027808_97_1089 273
449 3300046455 Ga0495603_0028359 Ga0495603_0028359_268_1260 273
450 3300046460 Ga0495638_0000073 Ga0495638_0000073_155786_156622 273
451 3300046460 Ga0495638_0074734 Ga0495638_0074734_62_892 273
452 3300046474 Ga0495605_0058383 Ga0495605_0058383_445_1281 273
453 3300046475 Ga0495639_0056935 Ga0495639_0056935_795_1724 273
454 3300046491 Ga0495584_0135989 Ga0495584_0135989_18_848 273
455 3300046492 Ga0495585_0018099 Ga0495585_0018099_2972_3808 273
456 3300046499 Ga0495594_0001181 Ga0495594_0001181_11698_12690 273
457 3300046506 Ga0495583_0000087 Ga0495583_0000087_156461_157297 273
458 3300046506 Ga0495583_0076325 Ga0495583_0076325_172_1008 273
459 3300046507 Ga0495606_0006993 Ga0495606_0006993_4207_5043 273
460 3300046512 Ga0495610_0070744 Ga0495610_0070744_730_1566 273
461 3300046515 Ga0495620_0014886 Ga0495620_0014886_1070_1906 273
462 3300046519 Ga0495632_0000270 Ga0495632_0000270_42906_43742 273
463 3300046524 Ga0495648_0000049 Ga0495648_0000049_155786_156622 273
464 3300046524 Ga0495648_0000642 Ga0495648_0000642_2463_3455 273
465 3300046528 Ga0495642_0125797 Ga0495642_0125797_33_863 273
466 3300046530 Ga0495654_0001044 Ga0495654_0001044_9048_10040 273
467 3300046530 Ga0495654_0019127 Ga0495654_0019127_1262_2254 273
468 3300046557 Ga0495622_0006217 Ga0495622_0006217_2557_3555 273
469 3300046558 Ga0495633_0036746 Ga0495633_0036746_207_1043 273
470 3300046616 Ga0495668_0013295 Ga0495668_0013295_27_863 273
471 3300046648 Ga0495611_0016243 Ga0495611_0016243_1345_2175 273
472 3300046660 Ga0495625_0025002 Ga0495625_0025002_2417_3253 273
473 3300046660 Ga0495625_0080670 Ga0495625_0080670_1409_2245 273
474 3300046660 Ga0495625_0120028 Ga0495625_0120028_109_1101 273
475 3300046691 Ga0495670_0004850 Ga0495670_0004850_3324_4316 273
476 3300046692 Ga0495671_0000042 Ga0495671_0000042_156688_157524 273
477 3300046692 Ga0495671_0073469 Ga0495671_0073469_68_910 273
478 3300046810 Ga0495660_0003279 Ga0495660_0003279_2329_3321 273
479 3300047318 Ga0495636_0043904 Ga0495636_0043904_774_1610 273
480 3300047320 Ga0495672_0005190 Ga0495672_0005190_8427_9419 273
481 3300047323 Ga0495683_0023726 Ga0495683_0023726_170_1162 273
482 3300047443 Ga0495687_000222 Ga0495687_000222_3110_4102 273
483 3300047443 Ga0495687_000377 Ga0495687_000377_23588_24580 273
484 3300047443 Ga0495687_009383 Ga0495687_009383_4513_5418 273
485 3300047443 Ga0495687_066982 Ga0495687_066982_354_1190 273
486 3300047447 Ga0495685_057461 Ga0495685_057461_349_1185 273
487 3300047469 Ga0495673_0000111 Ga0495673_0000111_7678_8514 273
488 3300047469 Ga0495673_0070554 Ga0495673_0070554_458_1450 273
489 3300047472 Ga0495686_0008763 Ga0495686_0008763_1466_2302 273
490 3300048905 Ga0496102_0181347 Ga0496102_0181347_443_1273 273
491 3300048906 Ga0496103_0175269 Ga0496103_0175269_435_1265 273
492 3300048915 Ga0496112_0141642 Ga0496112_0141642_1297_2118 273
493 3300048916 Ga0496113_0065925 Ga0496113_0065925_179_1000 273
494 3300048918 Ga0496115_0000040 Ga0496115_0000040_88770_89591 273
495 3300048918 Ga0496115_0141545 Ga0496115_0141545_532_1371 273
496 3300048919 Ga0496116_0121026 Ga0496116_0121026_91_927 273
497 3300048920 Ga0496117_0133832 Ga0496117_0133832_50_886 273
498 3300048921 Ga0496118_0004322 Ga0496118_0004322_1334_2170 273
499 3300048924 Ga0496121_0053365 Ga0496121_0053365_405_1235 273
500 3300048925 Ga0496122_0011912 Ga0496122_0011912_4604_5476 273
501 3300048926 Ga0496123_0114493 Ga0496123_0114493_331_1203 273
502 3300048927 Ga0496124_0042423 Ga0496124_0042423_1158_1988 273
503 3300048927 Ga0496124_0217674 Ga0496124_0217674_221_1057 273
504 3300049459 Ga0495678_024131 Ga0495678_024131_477_1454 273
505 3300049460 Ga0495682_0003159 Ga0495682_0003159_3520_4512 273
506 3300049460 Ga0495682_0008879 Ga0495682_0008879_66_1058 273
507 3300049568 Ga0501031_0175349 Ga0501031_0175349_209_1132 273
508 3300049569 Ga0501032_0084778 Ga0501032_0084778_638_1561 273
509 3300049570 Ga0501033_0005016 Ga0501033_0005016_9287_10138 273
510 3300049570 Ga0501033_0203796 Ga0501033_0203796_243_1166 273
511 3300049571 Ga0501034_0001197 Ga0501034_0001197_34632_35555 273
512 3300049573 Ga0501037_0187700 Ga0501037_0187700_181_1104 273
513 3300049574 Ga0501038_0028910 Ga0501038_0028910_481_1332 273
514 3300049578 Ga0501042_0014740 Ga0501042_0014740_4208_5131 273
515 3300049579 Ga0501043_0014211 Ga0501043_0014211_3137_3988 273
516 3300049579 Ga0501043_0067493 Ga0501043_0067493_319_1242 273
517 3300049580 Ga0501046_0041742 Ga0501046_0041742_2650_3501 273
518 3300049581 Ga0501047_0071947 Ga0501047_0071947_1935_2858 273
519 3300049583 Ga0501067_0029252 Ga0501067_0029252_713_1564 273
520 3300049583 Ga0501067_0063209 Ga0501067_0063209_389_1219 273
521 3300049586 Ga0501070_0277967 Ga0501070_0277967_385_1236 273
522 3300049587 Ga0501071_0191904 Ga0501071_0191904_211_1062 273
523 3300049589 Ga0501073_0203333 Ga0501073_0203333_289_1212 273
524 3300049592 Ga0501076_0256577 Ga0501076_0256577_485_1336 273
525 3300049742 Ga0501080_0137269 Ga0501080_0137269_360_1211 273
526 3300049744 Ga0501083_0205151 Ga0501083_0205151_204_1127 273
527 3300049822 Ga0501035_0186998 Ga0501035_0186998_543_1466 273
528 3300049822 Ga0501035_0233547 Ga0501035_0233547_674_1525 273
529 3300049823 Ga0501044_0026836 Ga0501044_0026836_3001_3924 273
530 3300050489 nmdc:mga03683_20419_c1 nmdc:mga03683_20419_c1_644_1636 273
531 3300050489 nmdc:mga03683_31349_c1 nmdc:mga03683_31349_c1_290_1126 273
532 3300050493 nmdc:mga0k408_49080_c1 nmdc:mga0k408_49080_c1_779_1789 273
533 3300050493 nmdc:mga0k408_7226_c1 nmdc:mga0k408_7226_c1_3193_4029 273
534 3300050494 nmdc:mga06z11_19277_c1 nmdc:mga06z11_19277_c1_1604_2614 273
535 3300050494 nmdc:mga06z11_66028_c1 nmdc:mga06z11_66028_c1_750_1586 273
536 3300050494 nmdc:mga06z11_8609_c1 nmdc:mga06z11_8609_c1_460_1296 273
537 3300050496 nmdc:mga07m45_73469_c1 nmdc:mga07m45_73469_c1_500_1336 273
538 3300050507 nmdc:mga05p37_325930_c1 nmdc:mga05p37_325930_c1_683_1519 273
539 3300050507 nmdc:mga05p37_96659_c1 nmdc:mga05p37_96659_c1_1266_2099 273
540 3300050508 nmdc:mga09592_326920_c1 nmdc:mga09592_326920_c1_342_1172 273
541 3300050509 nmdc:mga0qj67_30630_c1 nmdc:mga0qj67_30630_c1_2477_3307 273
542 3300050509 nmdc:mga0qj67_32867_c1 nmdc:mga0qj67_32867_c1_2492_3328 273
543 3300050509 nmdc:mga0qj67_404815_c1 nmdc:mga0qj67_404815_c1_53_883 273
544 3300050510 nmdc:mga06r32_106665_c1 nmdc:mga06r32_106665_c1_721_1557 273
545 3300050510 nmdc:mga06r32_235614_c1 nmdc:mga06r32_235614_c1_218_1042 273
546 3300050510 nmdc:mga06r32_3041_c1 nmdc:mga06r32_3041_c1_13096_13932 273
547 3300050510 nmdc:mga06r32_60536_c1 nmdc:mga06r32_60536_c1_1464_2294 273
548 3300050512 nmdc:mga0n895_489046_c1 nmdc:mga0n895_489046_c1_164_994 273
549 3300050516 nmdc:mga0sz30_156623_c1 nmdc:mga0sz30_156623_c1_130_966 273
550 3300050516 nmdc:mga0sz30_20933_c2 nmdc:mga0sz30_20933_c2_416_1408 273
551 3300053086 Ga0500578_0132191 Ga0500578_0132191_342_1178 273
552 3300053092 Ga0500583_0047987 Ga0500583_0047987_747_1577 273
553 3300053109 Ga0500569_008517 Ga0500569_008517_1192_2028 273
554 3300053134 Ga0500658_0000577 Ga0500658_0000577_13435_14271 273
555 3300053136 Ga0500559_0008682 Ga0500559_0008682_1260_2096 273
556 3300053136 Ga0500559_0035897 Ga0500559_0035897_486_1433 273
557 3300053153 Ga0500616_0016033 Ga0500616_0016033_585_1421 273
558 3300053161 Ga0500634_0016841 Ga0500634_0016841_2213_3043 273
559 3300060353 Ga0501082_0483337 Ga0501082_0483337_23_874 273
560 3300061734 Ga0530510_0099525 Ga0530510_0099525_947_1777 273
561 iso_pu_bacteria 2511231017 2511332915 273
562 iso_pu_bacteria 2946787523 2946790732 273
563 iso_pu_bacteria 8046767195 8046773028 273

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00561

Abhydrolase_1

alpha/beta hydrolase fold

83

323

0.87

PF12146

Hydrolase_4

Serine aminopeptidase, S33

79

224

0.82

PF12697

Abhydrolase_6

Alpha/beta hydrolase family

85

329

0.61

Structural Annotation

Top 5 Hits

ID Description Score Start End
3hea-assembly1.cif.gz_A the l29p/l124i mutation of pseudomonas fluorescens esterase 0.9863 2 273
3hi4-assembly2.cif.gz_D switching catalysis from hydrolysis to perhydrolysis in p. fluorescens esterase 0.9858 2 273
8pi1-assembly1.cif.gz_B bicyclic incypro pseudomonas fluorescens esterase 0.9853 2 273
3ia2-assembly2.cif.gz_D pseudomonas fluorescens esterase complexed to the r-enantiomer of a sulfonate transition state analog 0.9852 2 273
3t4u-assembly1.cif.gz_A l29i mutation in an aryl esterase from pseudomonas fluorescens leads to unique peptide flip and increased activity 0.9852 2 273
ID Description Score Start End Superfamily
1va4B00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9848 2 273 3.40.50.1820
4dgqB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9817 3 273 3.40.50.1820
1va4B00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9813 2 273 3.40.50.1820
1a8qA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9747 2 273 3.40.50.1820
4dgqB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.9711 3 273 3.40.50.1820
ID Description Score Start End GO Terms
AF-A0A087NKY4-F1-model_v4 deleted 0.9902 1 273
AF-E6PXJ0-F1-model_v4 Putative peroxidase/hydrolase 0.9888 1 273 GO:0004601
GO:0016787
AF-A2WIK9-F1-model_v4 deleted 0.9865 1 273
AF-A0A098U7Z1-F1-model_v4 deleted 0.9864 3 273
AF-A0A7U7EG57-F1-model_v4 deleted 0.9863 3 273

Feature Viewer

pLDDT pTM Quality
95.9 0.94 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map