F464020

General Info

Members Datasets Scaffolds Average Seq Length
563 287 1126 192

Family's Representative Sequence

Representative Sequence 3300005364|Ga0070673_100778061|Ga0070673_1007780611
Length 208
Sequence MAPPPTTDVSPVIIRHAGRIEGFAIVSEDGMLATADRVMPPSLIFDADKHFFERGLDGVDVVVHGRHSHEQQEHSPQRRRLILTRRVAGLEQHSSNRLALWWNPAGASLSKALAAIGVPDDASIGVIGGADVFALFLDSFDVFHLSRAPNVRLPGGRPVFPDVPERTPEQVLANHGLVPGQVEALDAAQCVTLVSWRRAQNFDRLRGA

Samples

Sample ID Description Type Environment
1 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
2 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
3 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
13 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
14 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
15 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
16 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
17 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
18 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
19 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
20 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
21 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
22 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
23 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
24 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
25 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
26 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
27 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
28 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
29 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
30 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
31 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
32 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
33 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
34 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
35 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
36 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
37 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
38 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
39 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
40 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
41 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
42 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
43 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
44 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
45 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
46 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
47 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
48 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
49 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
50 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
51 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
52 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
53 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
54 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
55 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
56 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
57 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
58 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
59 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
60 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
61 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
62 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
63 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
64 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
65 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
66 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
67 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
68 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
69 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
70 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
71 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
72 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
73 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
74 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
75 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
76 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
77 3300012494 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.yng.030610 Metagenome Rhizosphere
78 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
79 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
80 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
81 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
82 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
83 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
84 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
85 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
86 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
87 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
88 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
89 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
90 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
137 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
138 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
139 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
140 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
141 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
142 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
143 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
144 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
145 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
146 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
147 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
148 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
149 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
150 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
151 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
152 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
153 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
154 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
155 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
156 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
157 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
158 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
159 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
160 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
161 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
162 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
163 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
164 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
165 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
166 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
167 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
168 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
169 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
170 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
171 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
172 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
173 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
174 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
175 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
176 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
177 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
178 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
179 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
180 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
181 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
182 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
183 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
184 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
185 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
186 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
187 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
188 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
189 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
190 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
191 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
192 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
193 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
194 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
195 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
196 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
197 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
198 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
199 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
200 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
201 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
202 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
203 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
204 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
205 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
206 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
207 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
208 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
209 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
210 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
211 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
212 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
213 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
214 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
215 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
216 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
217 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
218 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
219 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
220 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
221 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
222 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
223 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
224 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
225 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
226 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
227 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
228 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
229 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
230 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
231 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
232 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
233 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
234 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
235 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
236 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
237 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
238 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
239 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
240 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
241 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
242 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
243 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
244 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
245 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
246 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
247 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
248 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
249 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
250 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
251 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
252 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
253 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
254 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
255 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
256 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
257 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
258 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
259 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
260 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
261 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
262 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
263 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
264 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
265 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
266 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
267 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
268 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
269 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
270 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
271 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
272 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
273 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
274 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
275 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
276 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
277 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
278 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
279 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
280 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
281 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
282 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
283 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
284 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
285 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
286 3300059628 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 160R_AD_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
287 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.29
Metatranscriptomes 0.71
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.18
Nodule 0
Rhizoplane 4.97
Rhizosphere 93.96
Stem 0
Stem Tuber 0
Unclassified 21.31

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070673_100778061 3300005364 Bacteria 883
2 rootH2_10013874 3300003320 Bacteria 39180
3 Ga0065707_10245934 3300005295 Bacteria 1140
4 Ga0070658_10030303 3300005327 Bacteria 4347
5 Ga0070658_10693226 3300005327 Unclassified 884
6 Ga0070683_100017416 3300005329 Bacteria 6351
7 Ga0070683_100106737 3300005329 Plasmid 2640
8 Ga0070683_100140561 3300005329 Bacteria 2287
9 Ga0070670_100663004 3300005331 Bacteria 936
10 Ga0070666_10013082 3300005335 Bacteria 5257
11 Ga0070680_100099897 3300005336 Unclassified 2408
12 Ga0070682_100097788 3300005337 Bacteria 1932
13 Ga0070660_100019088 3300005339 Bacteria 5018
14 Ga0070689_100706576 3300005340 Bacteria 881
15 Ga0070691_10003138 3300005341 Bacteria 7398
16 Ga0070691_10251402 3300005341 Unclassified 948
17 Ga0070668_101128062 3300005347 Unclassified 708
18 Ga0070671_100113011 3300005355 Unclassified 2282
19 Ga0070673_100046143 3300005364 Unclassified 3383
20 Ga0070688_100027818 3300005365 Unclassified 3369
21 Ga0070659_100093028 3300005366 Unclassified 2419
22 Ga0070659_100601697 3300005366 Bacteria 945
23 Ga0070667_100052943 3300005367 Unclassified 3425
24 Ga0070703_10245992 3300005406 Unclassified 723
25 Ga0070709_10010309 3300005434 Bacteria 5169
26 Ga0070709_10161704 3300005434 Bacteria 1558
27 Ga0070709_10721927 3300005434 Unclassified 777
28 Ga0070714_100019188 3300005435 Bacteria 5565
29 Ga0070714_100019612 3300005435 Bacteria 5513
30 Ga0070714_100091318 3300005435 Bacteria 2668
31 Ga0070713_100001710 3300005436 Bacteria 14129
32 Ga0070713_100041742 3300005436 Bacteria 3740
33 Ga0070713_100044948 3300005436 Bacteria 3617
34 Ga0070713_100079363 3300005436 Bacteria 2796
35 Ga0070713_100146950 3300005436 Unclassified 2093
36 Ga0070713_101200535 3300005436 Unclassified 734
37 Ga0070710_10000518 3300005437 Bacteria 18125
38 Ga0070710_10475600 3300005437 Bacteria 851
39 Ga0070711_100050571 3300005439 Plasmid 2850
40 Ga0070711_100150934 3300005439 Bacteria 1752
41 Ga0070705_100120793 3300005440 Bacteria 1691
42 Ga0070694_100450068 3300005444 Unclassified 1016
43 Ga0070694_100695747 3300005444 Unclassified 826
44 Ga0070663_100053976 3300005455 Bacteria 2871
45 Ga0070663_100542894 3300005455 Unclassified 971
46 Ga0070678_100079231 3300005456 Bacteria 2484
47 Ga0070678_100151800 3300005456 Bacteria 1867
48 Ga0070662_100737962 3300005457 Unclassified 835
49 Ga0070681_10278860 3300005458 Bacteria 1582
50 Ga0068867_100098454 3300005459 Bacteria 2230
51 Ga0070685_10088441 3300005466 Bacteria 1871
52 Ga0070679_100050843 3300005530 Bacteria 4128
53 Ga0070679_100116879 3300005530 Bacteria 2652
54 Ga0070679_100230821 3300005530 Unclassified 1810
55 Ga0070679_100295677 3300005530 Bacteria 1570
56 Ga0070684_100050461 3300005535 Bacteria 3614
57 Ga0070684_100067750 3300005535 Unclassified 3136
58 Ga0068853_100092469 3300005539 Bacteria 2661
59 Ga0068853_100897408 3300005539 Unclassified 851
60 Ga0070672_100370936 3300005543 Bacteria 1223
61 Ga0070686_100003280 3300005544 Bacteria 8856
62 Ga0070686_100196558 3300005544 Bacteria 1443
63 Ga0070695_100145640 3300005545 Unclassified 1647
64 Ga0070696_100105100 3300005546 Bacteria 2028
65 Ga0070696_100115817 3300005546 Unclassified 1935
66 Ga0070696_100878946 3300005546 Viruses 742
67 Ga0070665_100086042 3300005548 Bacteria 3149
68 Ga0070704_100118292 3300005549 Unclassified 2030
69 Ga0070664_100113704 3300005564 Bacteria 2364
70 Ga0068857_100870031 3300005577 Unclassified 863
71 Ga0068854_101514182 3300005578 Unclassified 609
72 Ga0068856_100048473 3300005614 Bacteria 4187
73 Ga0068856_100089378 3300005614 Bacteria 3063
74 Ga0068856_100284311 3300005614 Bacteria 1671
75 Ga0068856_100470384 3300005614 Bacteria 1278
76 Ga0068856_100829148 3300005614 Unclassified 944
77 Ga0070702_100050328 3300005615 Bacteria 2379
78 Ga0068859_100117999 3300005617 Plasmid 2719
79 Ga0068864_100020409 3300005618 Bacteria 5543
80 Ga0068866_10021250 3300005718 Bacteria 2988
81 Ga0068861_100448555 3300005719 Bacteria 1155
82 Ga0068863_100120957 3300005841 Bacteria 2496
83 Ga0068858_100027013 3300005842 Bacteria 5331
84 Ga0068860_100176099 3300005843 Bacteria 2067
85 Ga0070717_10000740 3300006028 Bacteria 21276
86 Ga0070717_10153866 3300006028 Bacteria 1991
87 Ga0070716_100002342 3300006173 Bacteria 8716
88 Ga0070712_100011118 3300006175 Bacteria 5698
89 Ga0070712_100092455 3300006175 Bacteria 2218
90 Ga0070712_100200068 3300006175 Bacteria 1569
91 Ga0097621_100084092 3300006237 Unclassified 2652
92 Ga0068871_100012424 3300006358 Bacteria 6276
93 Ga0068871_100172005 3300006358 Unclassified 1857
94 Ga0075434_100015678 3300006871 Bacteria 7272
95 Ga0075434_100102483 3300006871 Bacteria 2870
96 Ga0075434_100141365 3300006871 Unclassified 2427
97 Ga0075436_100054804 3300006914 Unclassified 2753
98 Ga0075436_100286490 3300006914 Bacteria 1178
99 Ga0097620_100117993 3300006931 Plasmid 2719
100 Ga0075435_100130331 3300007076 Bacteria 2104
101 Ga0075435_100193519 3300007076 Unclassified 1722
102 Ga0075435_100251750 3300007076 Bacteria 1504
103 Ga0105251_10033997 3300009011 Bacteria 2527
104 Ga0105240_10012095 3300009093 Bacteria 11957
105 Ga0105240_10073703 3300009093 Bacteria 4215
106 Ga0105240_10702229 3300009093 Bacteria 1104
107 Ga0111539_10013175 3300009094 Bacteria 10337
108 Ga0105245_10327689 3300009098 Bacteria 1510
109 Ga0105245_10334063 3300009098 Bacteria 1497
110 Ga0105245_10589722 3300009098 Unclassified 1137
111 Ga0105247_10167264 3300009101 Bacteria 1460
112 Ga0114129_10029161 3300009147 Bacteria 7818
113 Ga0105243_10017009 3300009148 Bacteria 5498
114 Ga0105243_10101468 3300009148 Unclassified 2389
115 Ga0105241_10131859 3300009174 Unclassified 2024
116 Ga0105241_10294307 3300009174 Bacteria 1391
117 Ga0105242_10030426 3300009176 Unclassified 4310
118 Ga0105248_10039894 3300009177 Bacteria 5263
119 Ga0105237_10081818 3300009545 Plasmid 3220
120 Ga0105237_10086242 3300009545 Bacteria 3130
121 Ga0105238_10052289 3300009551 Bacteria 4106
122 Ga0105238_10119552 3300009551 Unclassified 2615
123 Ga0105238_10311921 3300009551 Bacteria 1558
124 Ga0105238_10481574 3300009551 Bacteria 1240
125 Ga0105249_10517582 3300009553 Unclassified 1240
126 Ga0105239_10677598 3300010375 Unclassified 1178
127 Ga0105239_11221805 3300010375 Unclassified 866
128 Ga0105246_10222292 3300011119 Bacteria 1481
129 Ga0157341_1002354 3300012494 Bacteria 1241
130 Ga0157370_10002547 3300013104 Bacteria 21885
131 Ga0157370_10020993 3300013104 Bacteria 6512
132 Ga0157370_10116935 3300013104 Bacteria 2491
133 Ga0157370_10922374 3300013104 Unclassified 792
134 Ga0157369_10040317 3300013105 Bacteria 5097
135 Ga0157374_10058989 3300013296 Bacteria 3587
136 Ga0157374_10084039 3300013296 Plasmid 3025
137 Ga0157374_10189002 3300013296 Unclassified 2014
138 Ga0157374_10250566 3300013296 Bacteria 1743
139 Ga0157374_10580830 3300013296 Bacteria 1130
140 Ga0157378_10100861 3300013297 Unclassified 2636
141 Ga0157378_10398320 3300013297 Unclassified 1356
142 Ga0157378_11434248 3300013297 Unclassified 734
143 Ga0163162_10120524 3300013306 Unclassified 2727
144 Ga0163162_10584907 3300013306 Bacteria 1243
145 Ga0157372_10016943 3300013307 Bacteria 7823
146 Ga0157372_10325475 3300013307 Unclassified 1790
147 Ga0157372_10576932 3300013307 Bacteria 1311
148 Ga0157375_10029486 3300013308 Bacteria 5161
149 Ga0157375_10271676 3300013308 Bacteria 1857
150 Ga0163163_10015175 3300014325 Bacteria 7113
151 Ga0163163_10901165 3300014325 Bacteria 948
152 Ga0182008_10147922 3300014497 Unclassified 1178
153 Ga0157379_10086364 3300014968 Plasmid 2813
154 Ga0157379_10679367 3300014968 Bacteria 965
155 Ga0157376_10095605 3300014969 Bacteria 2584
156 Ga0157376_10380810 3300014969 Unclassified 1359
157 Ga0224712_10095780 3300022467 Unclassified 1250
158 Ga0207653_10187811 3300025885 Unclassified 775
159 Ga0207692_10000453 3300025898 Bacteria 14505
160 Ga0207692_10186949 3300025898 Unclassified 1210
161 Ga0207692_10363895 3300025898 Bacteria 894
162 Ga0207692_10400364 3300025898 Bacteria 856
163 Ga0207642_10015865 3300025899 Bacteria 2822
164 Ga0207710_10074832 3300025900 Bacteria 1560
165 Ga0207680_10033092 3300025903 Bacteria 2945
166 Ga0207685_10009664 3300025905 Unclassified 2811
167 Ga0207699_10001366 3300025906 Bacteria 11617
168 Ga0207699_10088149 3300025906 Bacteria 1941
169 Ga0207699_10449611 3300025906 Bacteria 924
170 Ga0207699_10748849 3300025906 Unclassified 717
171 Ga0207645_10055681 3300025907 Bacteria 2525
172 Ga0207705_10000464 3300025909 Bacteria 34704
173 Ga0207654_10167873 3300025911 Bacteria 1423
174 Ga0207654_10185947 3300025911 Unclassified 1358
175 Ga0207695_10009103 3300025913 Bacteria 12329
176 Ga0207671_10073428 3300025914 Bacteria 2555
177 Ga0207671_10725431 3300025914 Unclassified 790
178 Ga0207693_10003992 3300025915 Bacteria 12538
179 Ga0207693_10064108 3300025915 Bacteria 2878
180 Ga0207693_10183932 3300025915 Bacteria 1645
181 Ga0207663_10046289 3300025916 Bacteria 2679
182 Ga0207663_10165895 3300025916 Bacteria 1564
183 Ga0207663_10902316 3300025916 Unclassified 707
184 Ga0207660_10033695 3300025917 Bacteria 3545
185 Ga0207660_10147693 3300025917 Unclassified 1803
186 Ga0207660_10166712 3300025917 Bacteria 1703
187 Ga0207657_10001994 3300025919 Bacteria 22061
188 Ga0207657_10089927 3300025919 Plasmid 2563
189 Ga0207657_10147679 3300025919 Bacteria 1917
190 Ga0207649_10000632 3300025920 Bacteria 23589
191 Ga0207652_10016528 3300025921 Bacteria 6026
192 Ga0207652_10095179 3300025921 Bacteria 2623
193 Ga0207652_10175243 3300025921 Unclassified 1926
194 Ga0207652_10260588 3300025921 Unclassified 1564
195 Ga0207652_10459628 3300025921 Unclassified 1147
196 Ga0207694_10034804 3300025924 Unclassified 3863
197 Ga0207694_10400034 3300025924 Bacteria 1142
198 Ga0207659_10453159 3300025926 Unclassified 1081
199 Ga0207687_10105868 3300025927 Bacteria 2078
200 Ga0207687_10458071 3300025927 Bacteria 1059
201 Ga0207700_10001686 3300025928 Bacteria 12536
202 Ga0207700_10043702 3300025928 Bacteria 3293
203 Ga0207700_10077276 3300025928 Unclassified 2586
204 Ga0207700_10095708 3300025928 Bacteria 2356
205 Ga0207700_10179922 3300025928 Bacteria 1770
206 Ga0207700_10500585 3300025928 Unclassified 1075
207 Ga0207664_10015866 3300025929 Bacteria 5484
208 Ga0207664_10039352 3300025929 Bacteria 3672
209 Ga0207664_10122446 3300025929 Unclassified 2179
210 Ga0207644_10006098 3300025931 Bacteria 7861
211 Ga0207690_10521277 3300025932 Unclassified 963
212 Ga0207690_10533796 3300025932 Bacteria 952
213 Ga0207690_10727399 3300025932 Bacteria 817
214 Ga0207706_10062912 3300025933 Plasmid 3268
215 Ga0207706_10230993 3300025933 Bacteria 1618
216 Ga0207686_10107686 3300025934 Unclassified 1873
217 Ga0207709_10107090 3300025935 Bacteria 1861
218 Ga0207669_10057405 3300025937 Unclassified 2370
219 Ga0207665_10022525 3300025939 Bacteria 4145
220 Ga0207711_10141417 3300025941 Unclassified 2166
221 Ga0207689_10052968 3300025942 Bacteria 3343
222 Ga0207661_10042776 3300025944 Bacteria 3573
223 Ga0207661_10068036 3300025944 Bacteria 2899
224 Ga0207667_10261607 3300025949 Bacteria 1769
225 Ga0207667_10567846 3300025949 Unclassified 1146
226 Ga0207651_10403800 3300025960 Bacteria 1163
227 Ga0207668_10146668 3300025972 Bacteria 1822
228 Ga0207640_10878010 3300025981 Unclassified 782
229 Ga0207640_10969774 3300025981 Unclassified 746
230 Ga0207703_10034316 3300026035 Bacteria 4025
231 Ga0207639_10171175 3300026041 Bacteria 1839
232 Ga0207678_10079551 3300026067 Plasmid 2807
233 Ga0207678_10099692 3300026067 Unclassified 2481
234 Ga0207708_10037493 3300026075 Bacteria 3693
235 Ga0207702_10150155 3300026078 Unclassified 2119
236 Ga0207702_10533692 3300026078 Unclassified 1146
237 Ga0207648_10892907 3300026089 Unclassified 830
238 Ga0207676_10017233 3300026095 Bacteria 5235
239 Ga0207683_10031012 3300026121 Unclassified 4638
240 Ga0207683_10676644 3300026121 Bacteria 956
241 Ga0268266_10013917 3300028379 Bacteria 6926
242 Ga0265334_10150436 3300028573 Bacteria 821
243 Ga0265338_10002034 3300028800 Bacteria 31298
244 Ga0265338_10017299 3300028800 Bacteria 7780
245 Ga0265338_10139866 3300028800 Bacteria 1898
246 Ga0265760_10048126 3300031090 Unclassified 1281
247 Ga0265330_10088943 3300031235 Bacteria 1327
248 Ga0265332_10028145 3300031238 Bacteria 2461
249 Ga0265325_10000018 3300031241 Bacteria 128451
250 Ga0265325_10016982 3300031241 Bacteria 4057
251 Ga0265325_10210507 3300031241 Unclassified 893
252 Ga0265339_10008211 3300031249 Bacteria 6659
253 Ga0265339_10176955 3300031249 Bacteria 1065
254 Ga0265331_10021169 3300031250 Bacteria 3331
255 Ga0265331_10039509 3300031250 Bacteria 2301
256 Ga0265331_10107979 3300031250 Bacteria 1278
257 Ga0265313_10000577 3300031595 Bacteria 38251
258 Ga0265313_10147749 3300031595 Bacteria 1007
259 Ga0265314_10096719 3300031711 Bacteria 1909
260 Ga0265342_10002569 3300031712 Bacteria 15570
261 Ga0265342_10103144 3300031712 Bacteria 1622
262 Ga0373926_0007155 3300035083 Plasmid 3716
263 Ga0373928_0013613 3300035084 Bacteria 1635
264 Ga0373928_0030804 3300035084 Unclassified 1188
265 Ga0373944_0016389 3300035089 Bacteria 2089
266 Ga0373944_0036840 3300035089 Bacteria 1496
267 Ga0373944_0241769 3300035089 Bacteria 664
268 Ga0373923_0031859 3300035111 Bacteria 2127
269 Ga0373923_0059403 3300035111 Bacteria 1621
270 Ga0373932_0007233 3300035112 Plasmid 2640
271 Ga0373936_0020411 3300035113 Bacteria 2574
272 Ga0373939_0013810 3300035114 Bacteria 2084
273 Ga0373945_0091866 3300035116 Bacteria 1176
274 Ga0373953_0023269 3300035117 Bacteria 2344
275 Ga0373954_0063520 3300035118 Bacteria 1745
276 Ga0373954_0091635 3300035118 Bacteria 1460
277 Ga0373956_0011213 3300035119 Bacteria 3691
278 Ga0373956_0080641 3300035119 Bacteria 1493
279 Ga0373956_0109768 3300035119 Bacteria 1284
280 Ga0373956_0252854 3300035119 Unclassified 838
281 Ga0373957_0080856 3300035120 Bacteria 1283
282 Ga0373957_0124637 3300035120 Bacteria 1045
283 Ga0373943_0003477 3300035170 Bacteria 7167
284 Ga0373943_0028485 3300035170 Bacteria 2632
285 Ga0373943_0171029 3300035170 Bacteria 1189
286 Ga0373946_0011940 3300035171 Bacteria 3246
287 Ga0373946_0126027 3300035171 Bacteria 1174
288 Ga0373955_0013193 3300035172 Bacteria 3987
289 Ga0373955_0023927 3300035172 Bacteria 3117
290 Ga0373955_0028366 3300035172 Bacteria 2901
291 Ga0373955_0068462 3300035172 Bacteria 1978
292 Ga0373942_0015539 3300035207 Bacteria 1857
293 Ga0373942_0090959 3300035207 Unclassified 920
294 Ga0373962_0139154 3300035242 Unclassified 787
295 Ga0373962_0217990 3300035242 Unclassified 652
296 Ga0373924_0033710 3300035410 Bacteria 2069
297 Ga0373924_0056656 3300035410 Bacteria 1633
298 Ga0373924_0070455 3300035410 Bacteria 1474
299 Ga0373931_0305730 3300035691 Bacteria 983
300 Ga0373935_0025242 3300035692 Bacteria 3662
301 Ga0373935_0042938 3300035692 Bacteria 2844
302 Ga0373935_0070808 3300035692 Bacteria 2248
303 Ga0373935_0098389 3300035692 Bacteria 1925
304 Ga0373927_0025090 3300035695 Bacteria 3897
305 Ga0373927_0070109 3300035695 Bacteria 2269
306 Ga0373927_0230293 3300035695 Bacteria 1217
307 Ga0373927_0640486 3300035695 Bacteria 702
308 Ga0373933_0010068 3300035724 Bacteria 5176
309 Ga0373933_0050316 3300035724 Bacteria 2487
310 Ga0373933_0126785 3300035724 Bacteria 1602
311 Ga0373933_0366370 3300035724 Bacteria 937
312 Ga0373933_0603838 3300035724 Bacteria 721
313 Ga0373947_0085837 3300035725 Bacteria 1955
314 Ga0373947_0096935 3300035725 Bacteria 1847
315 Ga0373947_0208137 3300035725 Bacteria 1282
316 Ga0373937_0000341 3300036401 Bacteria 44236
317 Ga0373937_0012430 3300036401 Bacteria 7488
318 Ga0373937_0012920 3300036401 Bacteria 7355
319 Ga0373937_0034869 3300036401 Bacteria 4577
320 Ga0373937_0040934 3300036401 Bacteria 4225
321 Ga0373937_0079291 3300036401 Bacteria 3035
322 Ga0373937_0094544 3300036401 Bacteria 2771
323 Ga0373937_0300851 3300036401 Bacteria 1516
324 Ga0373925_0089678 3300037068 Bacteria 2349
325 Ga0373925_0213547 3300037068 Bacteria 1537
326 Ga0373925_0247046 3300037068 Bacteria 1430
327 Ga0373925_0252920 3300037068 Bacteria 1413
328 Ga0373925_0797892 3300037068 Bacteria 778
329 Ga0395900_0349279 3300037418 Unclassified 1453
330 Ga0395900_0620903 3300037418 Unclassified 1020
331 Ga0395898_0486320 3300037466 Unclassified 1174
332 Ga0436364_0695120 3300037853 Bacteria 919
333 Ga0436365_1473399 3300039437 Bacteria 8261
334 Ga0439435_0050831 3300042436 Unclassified 1186
335 Ga0466958_0453923 3300045836 Bacteria 830
336 Ga0466967_0606060 3300045976 Bacteria 1081
337 Ga0495617_045385 3300046452 Bacteria 1465
338 Ga0495592_0055816 3300046454 Bacteria 2920
339 Ga0495592_0094477 3300046454 Bacteria 2140
340 Ga0495592_0175126 3300046454 Bacteria 1466
341 Ga0495592_0194067 3300046454 Bacteria 1375
342 Ga0495592_0308491 3300046454 Bacteria 1026
343 Ga0495603_0037270 3300046455 Bacteria 2918
344 Ga0495591_027525 3300046458 Bacteria 1752
345 Ga0495629_0005306 3300046459 Bacteria 9634
346 Ga0495629_0340129 3300046459 Bacteria 1024
347 Ga0495641_0028388 3300046461 Bacteria 2709
348 Ga0495651_0031010 3300046462 Bacteria 4170
349 Ga0495651_0105360 3300046462 Bacteria 2092
350 Ga0495651_0250097 3300046462 Unclassified 1211
351 Ga0495653_0110541 3300046463 Bacteria 1975
352 Ga0495653_0179153 3300046463 Bacteria 1456
353 Ga0495653_0190986 3300046463 Bacteria 1397
354 Ga0495580_0281872 3300046472 Bacteria 1134
355 Ga0495582_0004859 3300046473 Bacteria 7538
356 Ga0495582_0023656 3300046473 Bacteria 3360
357 Ga0495605_0291500 3300046474 Bacteria 692
358 Ga0495639_0081059 3300046475 Bacteria 1511
359 Ga0495639_0202805 3300046475 Bacteria 971
360 Ga0495639_0255503 3300046475 Unclassified 867
361 Ga0495662_0088620 3300046476 Bacteria 1508
362 Ga0495664_0005637 3300046477 Bacteria 6887
363 Ga0495664_0032667 3300046477 Bacteria 3055
364 Ga0495664_0102146 3300046477 Unclassified 1728
365 Ga0495584_0052788 3300046491 Bacteria 2046
366 Ga0495584_0151975 3300046491 Bacteria 1176
367 Ga0495585_0008810 3300046492 Bacteria 6090
368 Ga0495594_0005500 3300046499 Bacteria 6503
369 Ga0495594_0008591 3300046499 Bacteria 5265
370 Ga0495607_0086759 3300046501 Bacteria 1705
371 Ga0495583_0148865 3300046506 Bacteria 971
372 Ga0495608_0134854 3300046511 Bacteria 1578
373 Ga0495608_0195437 3300046511 Bacteria 1276
374 Ga0495608_0275363 3300046511 Bacteria 1045
375 Ga0495618_0099740 3300046514 Bacteria 1858
376 Ga0495618_0116425 3300046514 Bacteria 1711
377 Ga0495628_0039025 3300046516 Bacteria 3800
378 Ga0495628_0092866 3300046516 Bacteria 2334
379 Ga0495628_0118821 3300046516 Bacteria 2029
380 Ga0495628_0143274 3300046516 Bacteria 1823
381 Ga0495628_0337639 3300046516 Bacteria 1109
382 Ga0495630_0596887 3300046517 Bacteria 846
383 Ga0495644_0003332 3300046523 Bacteria 6354
384 Ga0495663_0055230 3300046525 Bacteria 1238
385 Ga0495666_0004726 3300046526 Bacteria 6888
386 Ga0495652_0078063 3300046529 Bacteria 2742
387 Ga0495652_0096472 3300046529 Bacteria 2407
388 Ga0495665_0071551 3300046531 Bacteria 1826
389 Ga0495665_0320362 3300046531 Unclassified 792
390 Ga0495640_0112986 3300046533 Bacteria 1773
391 Ga0495640_0256510 3300046533 Bacteria 1093
392 Ga0495586_0078002 3300046535 Bacteria 1817
393 Ga0495587_0001615 3300046536 Bacteria 14999
394 Ga0495587_0044065 3300046536 Bacteria 2655
395 Ga0495587_0090468 3300046536 Bacteria 1768
396 Ga0495598_0043500 3300046537 Bacteria 1323
397 Ga0495645_0002339 3300046543 Bacteria 12866
398 Ga0495645_0004418 3300046543 Bacteria 9604
399 Ga0495645_0161048 3300046543 Bacteria 1551
400 Ga0495645_0466858 3300046543 Bacteria 794
401 Ga0495622_0031918 3300046557 Bacteria 2460
402 Ga0495633_0012462 3300046558 Bacteria 4521
403 Ga0495667_0002150 3300046559 Bacteria 13141
404 Ga0495667_0019836 3300046559 Bacteria 4536
405 Ga0495667_0049830 3300046559 Bacteria 2765
406 Ga0495667_0494700 3300046559 Unclassified 766
407 Ga0495656_0002679 3300046615 Bacteria 5945
408 Ga0495634_0028412 3300046642 Bacteria 3882
409 Ga0495634_0100191 3300046642 Bacteria 1872
410 Ga0495611_0011475 3300046648 Bacteria 3757
411 Ga0495635_0010383 3300046663 Bacteria 6513
412 Ga0495635_0171907 3300046663 Bacteria 1473
413 Ga0495635_0258115 3300046663 Bacteria 1174
414 Ga0495635_0340085 3300046663 Bacteria 1002
415 Ga0495659_0021223 3300046664 Bacteria 2187
416 Ga0495659_0256210 3300046664 Bacteria 730
417 Ga0495661_0320333 3300046665 Bacteria 771
418 Ga0495588_0021171 3300046674 Bacteria 3201
419 Ga0495588_0126878 3300046674 Bacteria 1346
420 Ga0495657_0049829 3300046675 Bacteria 2819
421 Ga0495657_0124178 3300046675 Unclassified 1623
422 Ga0495657_0205963 3300046675 Bacteria 1197
423 Ga0495599_0042953 3300046678 Bacteria 2837
424 Ga0495599_0053412 3300046678 Bacteria 2531
425 Ga0495599_0170414 3300046678 Unclassified 1343
426 Ga0495623_0024573 3300046679 Bacteria 3881
427 Ga0495646_0060277 3300046680 Bacteria 2264
428 Ga0495647_0031323 3300046681 Bacteria 1978
429 Ga0495658_0000765 3300046683 Bacteria 17360
430 Ga0495658_0004072 3300046683 Bacteria 7199
431 Ga0495658_0337945 3300046683 Unclassified 956
432 Ga0495669_0074116 3300046684 Bacteria 1556
433 Ga0495613_0316393 3300046689 Bacteria 1078
434 Ga0495613_0367491 3300046689 Bacteria 985
435 Ga0495613_0417334 3300046689 Bacteria 913
436 Ga0495624_0024379 3300046690 Bacteria 3981
437 Ga0495624_0091770 3300046690 Unclassified 1873
438 Ga0495670_0013468 3300046691 Bacteria 4023
439 Ga0495600_0009532 3300046809 Bacteria 6003
440 Ga0495600_0011285 3300046809 Bacteria 5563
441 Ga0495600_0141768 3300046809 Bacteria 1559
442 Ga0495600_0154801 3300046809 Bacteria 1483
443 Ga0495600_0491252 3300046809 Bacteria 755
444 Ga0495581_0031063 3300047315 Bacteria 3094
445 Ga0495581_0050059 3300047315 Bacteria 2413
446 Ga0495581_0107389 3300047315 Unclassified 1622
447 Ga0495604_0032585 3300047317 Bacteria 4129
448 Ga0495604_0033398 3300047317 Bacteria 4074
449 Ga0495604_0106903 3300047317 Bacteria 2046
450 Ga0495604_0164753 3300047317 Bacteria 1564
451 Ga0495674_0011200 3300047319 Bacteria 8469
452 Ga0495674_0064101 3300047319 Bacteria 3195
453 Ga0495674_0079075 3300047319 Bacteria 2824
454 Ga0495674_0215011 3300047319 Bacteria 1591
455 Ga0495674_0239705 3300047319 Bacteria 1495
456 Ga0495674_0498538 3300047319 Unclassified 974
457 Ga0495676_0010444 3300047321 Bacteria 8420
458 Ga0495676_0090053 3300047321 Bacteria 2297
459 Ga0495680_0008546 3300047322 Bacteria 9298
460 Ga0495680_0020020 3300047322 Bacteria 5639
461 Ga0495680_0076235 3300047322 Bacteria 2543
462 Ga0495680_0310142 3300047322 Bacteria 1106
463 Ga0495680_0402789 3300047322 Bacteria 944
464 Ga0495675_0014995 3300047444 Bacteria 4899
465 Ga0495675_0078092 3300047444 Bacteria 2085
466 Ga0495679_028651 3300047446 Bacteria 1825
467 Ga0495684_0018445 3300047471 Bacteria 5376
468 Ga0495684_0147775 3300047471 Bacteria 1759
469 Ga0495684_0354343 3300047471 Bacteria 1041
470 Ga0495593_0014148 3300047673 Bacteria 4540
471 Ga0495593_0054964 3300047673 Bacteria 2097
472 Ga0495593_0196735 3300047673 Bacteria 1013
473 Ga0495602_0005963 3300048088 Bacteria 12791
474 Ga0495602_0017113 3300048088 Bacteria 7273
475 Ga0495602_0085736 3300048088 Bacteria 2631
476 Ga0495602_0254322 3300048088 Bacteria 1307
477 Ga0495602_0353351 3300048088 Bacteria 1060
478 Ga0495602_0661796 3300048088 Bacteria 712
479 Ga0495614_0029747 3300048089 Bacteria 2350
480 Ga0496100_0107778 3300048903 Bacteria 1930
481 Ga0496101_0010260 3300048904 Bacteria 6183
482 Ga0496101_0012519 3300048904 Bacteria 5662
483 Ga0496104_0006908 3300048907 Bacteria 10013
484 Ga0496104_0341400 3300048907 Unclassified 1410
485 Ga0496105_0013212 3300048908 Bacteria 6552
486 Ga0496105_0536793 3300048908 Unclassified 914
487 Ga0496106_0057815 3300048909 Plasmid 2933
488 Ga0496106_0113487 3300048909 Unclassified 2112
489 Ga0496106_0152322 3300048909 Bacteria 1824
490 Ga0496107_0074286 3300048910 Unclassified 2473
491 Ga0496107_0108407 3300048910 Unclassified 2039
492 Ga0496108_0287971 3300048911 Unclassified 1430
493 Ga0496108_0585506 3300048911 Bacteria 973
494 Ga0496109_0220486 3300048912 Bacteria 1783
495 Ga0496109_1056096 3300048912 Unclassified 749
496 Ga0496110_0052453 3300048913 Bacteria 3583
497 Ga0496110_0760181 3300048913 Unclassified 872
498 Ga0496111_0019359 3300048914 Bacteria 4726
499 Ga0496112_0056236 3300048915 Bacteria 3871
500 Ga0496112_0197033 3300048915 Bacteria 1974
501 Ga0496112_0806629 3300048915 Unclassified 863
502 Ga0496113_0086148 3300048916 Unclassified 2413
503 Ga0496114_0351051 3300048917 Unclassified 1304
504 Ga0496114_0887777 3300048917 Unclassified 772
505 Ga0496115_0012480 3300048918 Bacteria 6396
506 Ga0496115_0125787 3300048918 Unclassified 2111
507 Ga0496115_0285281 3300048918 Bacteria 1355
508 Ga0496121_0212087 3300048924 Bacteria 1371
509 Ga0496126_0115562 3300048929 Bacteria 2333
510 Ga0501033_0436318 3300049570 Bacteria 911
511 Ga0501034_0106758 3300049571 Bacteria 2793
512 Ga0501039_0347983 3300049575 Bacteria 1165
513 Ga0501070_0022303 3300049586 Bacteria 5305
514 Ga0501072_1024697 3300049588 Unclassified 643
515 Ga0501073_0767625 3300049589 Unclassified 665
516 Ga0501074_0393150 3300049590 Bacteria 983
517 Ga0501077_0045109 3300049593 Bacteria 2800
518 Ga0501079_0340330 3300049741 Unclassified 1175
519 Ga0501044_0072151 3300049823 Bacteria 3511
520 nmdc:mga05p37_9719_c1 3300050507 Bacteria 11405
521 nmdc:mga09592_9372_c1 3300050508 Bacteria 7962
522 nmdc:mga0qj67_3742_c1 3300050509 Bacteria 10983
523 nmdc:mga06r32_20271_c1 3300050510 Bacteria 6118
524 nmdc:mga08y16_47990_c1 3300050511 Bacteria 4470
525 nmdc:mga0n895_84781_c1 3300050512 Bacteria 3162
526 nmdc:mga0n895_8780_c1 3300050512 Bacteria 8789
527 nmdc:mga0rr50_140318_c1 3300050513 Bacteria 1944
528 nmdc:mga0rr50_179365_c1 3300050513 Unclassified 1730
529 nmdc:mga0rr50_222038_c1 3300050513 Bacteria 1561
530 nmdc:mga0rr50_39700_c1 3300050513 Bacteria 3416
531 nmdc:mga08x19_63045_c1 3300050514 Unclassified 2404
532 nmdc:mga08x19_764228_c1 3300050514 Bacteria 686
533 nmdc:mga0a205_6729_c1 3300050515 Bacteria 10394
534 Ga0495601_0003106 3300053077 Bacteria 9485
535 Ga0495601_0004585 3300053077 Bacteria 7993
536 Ga0495601_0005470 3300053077 Bacteria 7402
537 Ga0495601_0040670 3300053077 Bacteria 2913
538 Ga0495601_0056185 3300053077 Bacteria 2492
539 Ga0495601_0158260 3300053077 Unclassified 1480
540 Ga0495601_0203818 3300053077 Bacteria 1292
541 Ga0495601_0616975 3300053077 Bacteria 695
542 Ga0495612_0018429 3300053078 Bacteria 2796
543 Ga0495612_0019076 3300053078 Bacteria 2746
544 Ga0495612_0020388 3300053078 Bacteria 2657
545 Ga0495612_0022369 3300053078 Bacteria 2534
546 Ga0495612_0069165 3300053078 Bacteria 1470
547 Ga0495595_0001017 3300053084 Bacteria 10794
548 Ga0495595_0002383 3300053084 Bacteria 7332
549 Ga0495595_0003866 3300053084 Bacteria 5973
550 Ga0495595_0021932 3300053084 Bacteria 2797
551 Ga0495595_0044554 3300053084 Bacteria 2038
552 Ga0495595_0224996 3300053084 Bacteria 936
553 Ga0495619_0002124 3300053085 Bacteria 13136
554 Ga0495619_0004993 3300053085 Bacteria 8427
555 Ga0495619_0013926 3300053085 Bacteria 5074
556 Ga0495619_0056823 3300053085 Bacteria 2595
557 Ga0495619_0091506 3300053085 Bacteria 2059
558 Ga0495619_0102510 3300053085 Unclassified 1949
559 Ga0500619_047882 3300053154 Bacteria 1375
560 Ga0501084_0191654 3300054114 Bacteria 1725
561 Ga0587073_0012069 3300059492 Unclassified 1489
562 Ga0587122_000442 3300059628 Bacteria 2187
563 Ga0501082_0084026 3300060353 Bacteria 2746
564 Ga0070673_100778061
565 rootH2_10013874
566 Ga0065707_10245934
567 Ga0070658_10030303
568 Ga0070658_10693226
569 Ga0070683_100017416
570 Ga0070683_100106737
571 Ga0070683_100140561
572 Ga0070670_100663004
573 Ga0070666_10013082
574 Ga0070680_100099897
575 Ga0070682_100097788
576 Ga0070660_100019088
577 Ga0070689_100706576
578 Ga0070691_10003138
579 Ga0070691_10251402
580 Ga0070668_101128062
581 Ga0070671_100113011
582 Ga0070673_100046143
583 Ga0070688_100027818
584 Ga0070659_100093028
585 Ga0070659_100601697
586 Ga0070667_100052943
587 Ga0070703_10245992
588 Ga0070709_10010309
589 Ga0070709_10161704
590 Ga0070709_10721927
591 Ga0070714_100019188
592 Ga0070714_100019612
593 Ga0070714_100091318
594 Ga0070713_100001710
595 Ga0070713_100041742
596 Ga0070713_100044948
597 Ga0070713_100079363
598 Ga0070713_100146950
599 Ga0070713_101200535
600 Ga0070710_10000518
601 Ga0070710_10475600
602 Ga0070711_100050571
603 Ga0070711_100150934
604 Ga0070705_100120793
605 Ga0070694_100450068
606 Ga0070694_100695747
607 Ga0070663_100053976
608 Ga0070663_100542894
609 Ga0070678_100079231
610 Ga0070678_100151800
611 Ga0070662_100737962
612 Ga0070681_10278860
613 Ga0068867_100098454
614 Ga0070685_10088441
615 Ga0070679_100050843
616 Ga0070679_100116879
617 Ga0070679_100230821
618 Ga0070679_100295677
619 Ga0070684_100050461
620 Ga0070684_100067750
621 Ga0068853_100092469
622 Ga0068853_100897408
623 Ga0070672_100370936
624 Ga0070686_100003280
625 Ga0070686_100196558
626 Ga0070695_100145640
627 Ga0070696_100105100
628 Ga0070696_100115817
629 Ga0070696_100878946
630 Ga0070665_100086042
631 Ga0070704_100118292
632 Ga0070664_100113704
633 Ga0068857_100870031
634 Ga0068854_101514182
635 Ga0068856_100048473
636 Ga0068856_100089378
637 Ga0068856_100284311
638 Ga0068856_100470384
639 Ga0068856_100829148
640 Ga0070702_100050328
641 Ga0068859_100117999
642 Ga0068864_100020409
643 Ga0068866_10021250
644 Ga0068861_100448555
645 Ga0068863_100120957
646 Ga0068858_100027013
647 Ga0068860_100176099
648 Ga0070717_10000740
649 Ga0070717_10153866
650 Ga0070716_100002342
651 Ga0070712_100011118
652 Ga0070712_100092455
653 Ga0070712_100200068
654 Ga0097621_100084092
655 Ga0068871_100012424
656 Ga0068871_100172005
657 Ga0075434_100015678
658 Ga0075434_100102483
659 Ga0075434_100141365
660 Ga0075436_100054804
661 Ga0075436_100286490
662 Ga0097620_100117993
663 Ga0075435_100130331
664 Ga0075435_100193519
665 Ga0075435_100251750
666 Ga0105251_10033997
667 Ga0105240_10012095
668 Ga0105240_10073703
669 Ga0105240_10702229
670 Ga0111539_10013175
671 Ga0105245_10327689
672 Ga0105245_10334063
673 Ga0105245_10589722
674 Ga0105247_10167264
675 Ga0114129_10029161
676 Ga0105243_10017009
677 Ga0105243_10101468
678 Ga0105241_10131859
679 Ga0105241_10294307
680 Ga0105242_10030426
681 Ga0105248_10039894
682 Ga0105237_10081818
683 Ga0105237_10086242
684 Ga0105238_10052289
685 Ga0105238_10119552
686 Ga0105238_10311921
687 Ga0105238_10481574
688 Ga0105249_10517582
689 Ga0105239_10677598
690 Ga0105239_11221805
691 Ga0105246_10222292
692 Ga0157341_1002354
693 Ga0157370_10002547
694 Ga0157370_10020993
695 Ga0157370_10116935
696 Ga0157370_10922374
697 Ga0157369_10040317
698 Ga0157374_10058989
699 Ga0157374_10084039
700 Ga0157374_10189002
701 Ga0157374_10250566
702 Ga0157374_10580830
703 Ga0157378_10100861
704 Ga0157378_10398320
705 Ga0157378_11434248
706 Ga0163162_10120524
707 Ga0163162_10584907
708 Ga0157372_10016943
709 Ga0157372_10325475
710 Ga0157372_10576932
711 Ga0157375_10029486
712 Ga0157375_10271676
713 Ga0163163_10015175
714 Ga0163163_10901165
715 Ga0182008_10147922
716 Ga0157379_10086364
717 Ga0157379_10679367
718 Ga0157376_10095605
719 Ga0157376_10380810
720 Ga0224712_10095780
721 Ga0207653_10187811
722 Ga0207692_10000453
723 Ga0207692_10186949
724 Ga0207692_10363895
725 Ga0207692_10400364
726 Ga0207642_10015865
727 Ga0207710_10074832
728 Ga0207680_10033092
729 Ga0207685_10009664
730 Ga0207699_10001366
731 Ga0207699_10088149
732 Ga0207699_10449611
733 Ga0207699_10748849
734 Ga0207645_10055681
735 Ga0207705_10000464
736 Ga0207654_10167873
737 Ga0207654_10185947
738 Ga0207695_10009103
739 Ga0207671_10073428
740 Ga0207671_10725431
741 Ga0207693_10003992
742 Ga0207693_10064108
743 Ga0207693_10183932
744 Ga0207663_10046289
745 Ga0207663_10165895
746 Ga0207663_10902316
747 Ga0207660_10033695
748 Ga0207660_10147693
749 Ga0207660_10166712
750 Ga0207657_10001994
751 Ga0207657_10089927
752 Ga0207657_10147679
753 Ga0207649_10000632
754 Ga0207652_10016528
755 Ga0207652_10095179
756 Ga0207652_10175243
757 Ga0207652_10260588
758 Ga0207652_10459628
759 Ga0207694_10034804
760 Ga0207694_10400034
761 Ga0207659_10453159
762 Ga0207687_10105868
763 Ga0207687_10458071
764 Ga0207700_10001686
765 Ga0207700_10043702
766 Ga0207700_10077276
767 Ga0207700_10095708
768 Ga0207700_10179922
769 Ga0207700_10500585
770 Ga0207664_10015866
771 Ga0207664_10039352
772 Ga0207664_10122446
773 Ga0207644_10006098
774 Ga0207690_10521277
775 Ga0207690_10533796
776 Ga0207690_10727399
777 Ga0207706_10062912
778 Ga0207706_10230993
779 Ga0207686_10107686
780 Ga0207709_10107090
781 Ga0207669_10057405
782 Ga0207665_10022525
783 Ga0207711_10141417
784 Ga0207689_10052968
785 Ga0207661_10042776
786 Ga0207661_10068036
787 Ga0207667_10261607
788 Ga0207667_10567846
789 Ga0207651_10403800
790 Ga0207668_10146668
791 Ga0207640_10878010
792 Ga0207640_10969774
793 Ga0207703_10034316
794 Ga0207639_10171175
795 Ga0207678_10079551
796 Ga0207678_10099692
797 Ga0207708_10037493
798 Ga0207702_10150155
799 Ga0207702_10533692
800 Ga0207648_10892907
801 Ga0207676_10017233
802 Ga0207683_10031012
803 Ga0207683_10676644
804 Ga0268266_10013917
805 Ga0265334_10150436
806 Ga0265338_10002034
807 Ga0265338_10017299
808 Ga0265338_10139866
809 Ga0265760_10048126
810 Ga0265330_10088943
811 Ga0265332_10028145
812 Ga0265325_10000018
813 Ga0265325_10016982
814 Ga0265325_10210507
815 Ga0265339_10008211
816 Ga0265339_10176955
817 Ga0265331_10021169
818 Ga0265331_10039509
819 Ga0265331_10107979
820 Ga0265313_10000577
821 Ga0265313_10147749
822 Ga0265314_10096719
823 Ga0265342_10002569
824 Ga0265342_10103144
825 Ga0373926_0007155
826 Ga0373928_0013613
827 Ga0373928_0030804
828 Ga0373944_0016389
829 Ga0373944_0036840
830 Ga0373944_0241769
831 Ga0373923_0031859
832 Ga0373923_0059403
833 Ga0373932_0007233
834 Ga0373936_0020411
835 Ga0373939_0013810
836 Ga0373945_0091866
837 Ga0373953_0023269
838 Ga0373954_0063520
839 Ga0373954_0091635
840 Ga0373956_0011213
841 Ga0373956_0080641
842 Ga0373956_0109768
843 Ga0373956_0252854
844 Ga0373957_0080856
845 Ga0373957_0124637
846 Ga0373943_0003477
847 Ga0373943_0028485
848 Ga0373943_0171029
849 Ga0373946_0011940
850 Ga0373946_0126027
851 Ga0373955_0013193
852 Ga0373955_0023927
853 Ga0373955_0028366
854 Ga0373955_0068462
855 Ga0373942_0015539
856 Ga0373942_0090959
857 Ga0373962_0139154
858 Ga0373962_0217990
859 Ga0373924_0033710
860 Ga0373924_0056656
861 Ga0373924_0070455
862 Ga0373931_0305730
863 Ga0373935_0025242
864 Ga0373935_0042938
865 Ga0373935_0070808
866 Ga0373935_0098389
867 Ga0373927_0025090
868 Ga0373927_0070109
869 Ga0373927_0230293
870 Ga0373927_0640486
871 Ga0373933_0010068
872 Ga0373933_0050316
873 Ga0373933_0126785
874 Ga0373933_0366370
875 Ga0373933_0603838
876 Ga0373947_0085837
877 Ga0373947_0096935
878 Ga0373947_0208137
879 Ga0373937_0000341
880 Ga0373937_0012430
881 Ga0373937_0012920
882 Ga0373937_0034869
883 Ga0373937_0040934
884 Ga0373937_0079291
885 Ga0373937_0094544
886 Ga0373937_0300851
887 Ga0373925_0089678
888 Ga0373925_0213547
889 Ga0373925_0247046
890 Ga0373925_0252920
891 Ga0373925_0797892
892 Ga0395900_0349279
893 Ga0395900_0620903
894 Ga0395898_0486320
895 Ga0436364_0695120
896 Ga0436365_1473399
897 Ga0439435_0050831
898 Ga0466958_0453923
899 Ga0466967_0606060
900 Ga0495617_045385
901 Ga0495592_0055816
902 Ga0495592_0094477
903 Ga0495592_0175126
904 Ga0495592_0194067
905 Ga0495592_0308491
906 Ga0495603_0037270
907 Ga0495591_027525
908 Ga0495629_0005306
909 Ga0495629_0340129
910 Ga0495641_0028388
911 Ga0495651_0031010
912 Ga0495651_0105360
913 Ga0495651_0250097
914 Ga0495653_0110541
915 Ga0495653_0179153
916 Ga0495653_0190986
917 Ga0495580_0281872
918 Ga0495582_0004859
919 Ga0495582_0023656
920 Ga0495605_0291500
921 Ga0495639_0081059
922 Ga0495639_0202805
923 Ga0495639_0255503
924 Ga0495662_0088620
925 Ga0495664_0005637
926 Ga0495664_0032667
927 Ga0495664_0102146
928 Ga0495584_0052788
929 Ga0495584_0151975
930 Ga0495585_0008810
931 Ga0495594_0005500
932 Ga0495594_0008591
933 Ga0495607_0086759
934 Ga0495583_0148865
935 Ga0495608_0134854
936 Ga0495608_0195437
937 Ga0495608_0275363
938 Ga0495618_0099740
939 Ga0495618_0116425
940 Ga0495628_0039025
941 Ga0495628_0092866
942 Ga0495628_0118821
943 Ga0495628_0143274
944 Ga0495628_0337639
945 Ga0495630_0596887
946 Ga0495644_0003332
947 Ga0495663_0055230
948 Ga0495666_0004726
949 Ga0495652_0078063
950 Ga0495652_0096472
951 Ga0495665_0071551
952 Ga0495665_0320362
953 Ga0495640_0112986
954 Ga0495640_0256510
955 Ga0495586_0078002
956 Ga0495587_0001615
957 Ga0495587_0044065
958 Ga0495587_0090468
959 Ga0495598_0043500
960 Ga0495645_0002339
961 Ga0495645_0004418
962 Ga0495645_0161048
963 Ga0495645_0466858
964 Ga0495622_0031918
965 Ga0495633_0012462
966 Ga0495667_0002150
967 Ga0495667_0019836
968 Ga0495667_0049830
969 Ga0495667_0494700
970 Ga0495656_0002679
971 Ga0495634_0028412
972 Ga0495634_0100191
973 Ga0495611_0011475
974 Ga0495635_0010383
975 Ga0495635_0171907
976 Ga0495635_0258115
977 Ga0495635_0340085
978 Ga0495659_0021223
979 Ga0495659_0256210
980 Ga0495661_0320333
981 Ga0495588_0021171
982 Ga0495588_0126878
983 Ga0495657_0049829
984 Ga0495657_0124178
985 Ga0495657_0205963
986 Ga0495599_0042953
987 Ga0495599_0053412
988 Ga0495599_0170414
989 Ga0495623_0024573
990 Ga0495646_0060277
991 Ga0495647_0031323
992 Ga0495658_0000765
993 Ga0495658_0004072
994 Ga0495658_0337945
995 Ga0495669_0074116
996 Ga0495613_0316393
997 Ga0495613_0367491
998 Ga0495613_0417334
999 Ga0495624_0024379
1000 Ga0495624_0091770
1001 Ga0495670_0013468
1002 Ga0495600_0009532
1003 Ga0495600_0011285
1004 Ga0495600_0141768
1005 Ga0495600_0154801
1006 Ga0495600_0491252
1007 Ga0495581_0031063
1008 Ga0495581_0050059
1009 Ga0495581_0107389
1010 Ga0495604_0032585
1011 Ga0495604_0033398
1012 Ga0495604_0106903
1013 Ga0495604_0164753
1014 Ga0495674_0011200
1015 Ga0495674_0064101
1016 Ga0495674_0079075
1017 Ga0495674_0215011
1018 Ga0495674_0239705
1019 Ga0495674_0498538
1020 Ga0495676_0010444
1021 Ga0495676_0090053
1022 Ga0495680_0008546
1023 Ga0495680_0020020
1024 Ga0495680_0076235
1025 Ga0495680_0310142
1026 Ga0495680_0402789
1027 Ga0495675_0014995
1028 Ga0495675_0078092
1029 Ga0495679_028651
1030 Ga0495684_0018445
1031 Ga0495684_0147775
1032 Ga0495684_0354343
1033 Ga0495593_0014148
1034 Ga0495593_0054964
1035 Ga0495593_0196735
1036 Ga0495602_0005963
1037 Ga0495602_0017113
1038 Ga0495602_0085736
1039 Ga0495602_0254322
1040 Ga0495602_0353351
1041 Ga0495602_0661796
1042 Ga0495614_0029747
1043 Ga0496100_0107778
1044 Ga0496101_0010260
1045 Ga0496101_0012519
1046 Ga0496104_0006908
1047 Ga0496104_0341400
1048 Ga0496105_0013212
1049 Ga0496105_0536793
1050 Ga0496106_0057815
1051 Ga0496106_0113487
1052 Ga0496106_0152322
1053 Ga0496107_0074286
1054 Ga0496107_0108407
1055 Ga0496108_0287971
1056 Ga0496108_0585506
1057 Ga0496109_0220486
1058 Ga0496109_1056096
1059 Ga0496110_0052453
1060 Ga0496110_0760181
1061 Ga0496111_0019359
1062 Ga0496112_0056236
1063 Ga0496112_0197033
1064 Ga0496112_0806629
1065 Ga0496113_0086148
1066 Ga0496114_0351051
1067 Ga0496114_0887777
1068 Ga0496115_0012480
1069 Ga0496115_0125787
1070 Ga0496115_0285281
1071 Ga0496121_0212087
1072 Ga0496126_0115562
1073 Ga0501033_0436318
1074 Ga0501034_0106758
1075 Ga0501039_0347983
1076 Ga0501070_0022303
1077 Ga0501072_1024697
1078 Ga0501073_0767625
1079 Ga0501074_0393150
1080 Ga0501077_0045109
1081 Ga0501079_0340330
1082 Ga0501044_0072151
1083 nmdc:mga05p37_9719_c1
1084 nmdc:mga09592_9372_c1
1085 nmdc:mga0qj67_3742_c1
1086 nmdc:mga06r32_20271_c1
1087 nmdc:mga08y16_47990_c1
1088 nmdc:mga0n895_84781_c1
1089 nmdc:mga0n895_8780_c1
1090 nmdc:mga0rr50_140318_c1
1091 nmdc:mga0rr50_179365_c1
1092 nmdc:mga0rr50_222038_c1
1093 nmdc:mga0rr50_39700_c1
1094 nmdc:mga08x19_63045_c1
1095 nmdc:mga08x19_764228_c1
1096 nmdc:mga0a205_6729_c1
1097 Ga0495601_0003106
1098 Ga0495601_0004585
1099 Ga0495601_0005470
1100 Ga0495601_0040670
1101 Ga0495601_0056185
1102 Ga0495601_0158260
1103 Ga0495601_0203818
1104 Ga0495601_0616975
1105 Ga0495612_0018429
1106 Ga0495612_0019076
1107 Ga0495612_0020388
1108 Ga0495612_0022369
1109 Ga0495612_0069165
1110 Ga0495595_0001017
1111 Ga0495595_0002383
1112 Ga0495595_0003866
1113 Ga0495595_0021932
1114 Ga0495595_0044554
1115 Ga0495595_0224996
1116 Ga0495619_0002124
1117 Ga0495619_0004993
1118 Ga0495619_0013926
1119 Ga0495619_0056823
1120 Ga0495619_0091506
1121 Ga0495619_0102510
1122 Ga0500619_047882
1123 Ga0501084_0191654
1124 Ga0587073_0012069
1125 Ga0587122_000442
1126 Ga0501082_0084026

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
1d1g-assembly1.cif.gz_B dihydrofolate reductase from thermotoga maritima 0.7822 1 179
7rgo-assembly1.cif.gz_B dfra5 complexed with nadph and 4'-chloro-3'-(4-(2,4-diamino-6-ethylpyrimidin-5-yl)but-3-yn-2-yl)-[1,1'-biphenyl]-4-carboxamide (ucp1228) 0.7808 1 180
3tqb-assembly1.cif.gz_A structure of the dihydrofolate reductase (fola) from coxiella burnetii in complex with folate 0.7765 1 180
7rgo-assembly1.cif.gz_B dfra5 complexed with nadph and 4'-chloro-3'-(4-(2,4-diamino-6-ethylpyrimidin-5-yl)but-3-yn-2-yl)-[1,1'-biphenyl]-4-carboxamide (ucp1228) 0.7764 1 180
3tq8-assembly1.cif.gz_A structure of the dihydrofolate reductase (fola) from coxiella burnetii in complex with trimethoprim 0.773 1 182
ID Description Score Start End Superfamily
5ecxB00 Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A 0.7572 1 181 3.40.430.10
4or7A00 Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A 0.7563 3 182 3.40.430.10
1cz3B00 Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A 0.7551 1 182 3.40.430.10
5ecxB00 Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A 0.753 1 181 3.40.430.10
3tqaA00 Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A 0.7521 1 180 3.40.430.10
ID Description Score Start End GO Terms
AF-A0A4V2E9B5-F1-model_v4 Dihydrofolate reductase 0.9423 23 182
AF-Q3SS94-F1-model_v4 Uncharacterized protein 0.9417 1 181
AF-A0A5C5SLV3-F1-model_v4 Dihydrofolate reductase 0.9269 2 182
AF-A0A259MJZ8-F1-model_v4 Dihydrofolate reductase 0.926 2 182
AF-A0A4V2E9B5-F1-model_v4 Dihydrofolate reductase 0.9257 23 182

Map