F463867

General Info

Members Datasets Scaffolds Average Seq Length
561 332 485 126

Family's Representative Sequence

Representative Sequence 3300048927|Ga0496124_0006343|Ga0496124_0006343_7778_8200
Length 140
Sequence MNIHGAYPVWEHRSMIDHLDHIVLTCTDPEATTHFYVDVLRMKKETFRGDRVAFVFGNQKINLHVKGHEFEPKAHLPVPGALDLCFMASIPLDEVIAHLNASMWPIVEGPVERTGATQKIRSVYVRDPDLNLIEISEPIV

Samples

Sample ID Description Type Environment
1 2501025501 Paraburkholderia silvatlantica PVA5 Isolate Unclassified
2 2501025502 Paraburkholderia unamae MTI-641 Isolate Rhizosphere
3 2501025504 Paraburkholderia silvatlantica SRMrh-20 Isolate Unclassified
4 2510065053 Pseudomonas sp. MOIL14HWK12:I1 Isolate Rhizosphere
5 2510065055 Pseudomonas sp. MOIL14HWK12:I2 Isolate Rhizosphere
6 2510065058 Pseudomonas oleovorans MOIL14HWK12 Isolate Rhizosphere
7 2510917013 Paraburkholderia unamae MTI-641 Isolate Rhizosphere
8 2510917014 Paraburkholderia silvatlantica SRMrh-20 Isolate Unclassified
9 2510917015 Paraburkholderia silvatlantica PVA5 Isolate Unclassified
10 2513237150 Cupriavidus taiwanensis STM6018 Isolate Nodule
11 2515154189 Paraburkholderia nodosa DSM 21604 Isolate Unclassified
12 2562617112 Burkholderia sp. BT03 Isolate Rhizosphere
13 2599185185 Pseudomonas sp. NFPP07 Isolate Rhizoplane
14 2599185214 Variovorax sp. NFACC26 Isolate Rhizoplane
15 2599185226 Variovorax sp. NFACC27 Isolate Rhizoplane
16 2599185227 Variovorax sp. NFACC28 Isolate Rhizoplane
17 2599185229 Variovorax sp. NFACC29 Isolate Endosphere
18 2599185239 Burkholderia sp. NFACC38-1 Isolate Rhizoplane
19 2599185240 Burkholderia sp. NFPP32 Isolate Rhizoplane
20 2599185355 Burkholderia sp. NFACC33-1 Isolate Rhizoplane
21 2643221628 Variovorax sp. Root318D1 Isolate Unclassified
22 2643221658 Variovorax sp. Root411 Isolate Unclassified
23 2675903129 Burkholderia pyrrocinia NFIX32 Isolate Rhizoplane
24 2711768613 Burkholderia sp. BT03 Isolate Rhizosphere
25 2721755763 Pandoraea thiooxydans ATSB16 Isolate Rhizosphere
26 2765235841 Pseudomonas putida AA7 Isolate Unclassified
27 2773857672 Pseudomonas sp. 1766 Isolate Unclassified
28 2791355137 Paraburkholderia piptadeniae STM7183 Isolate Unclassified
29 2808606384 Burkholderia sp. SJZ089 Isolate Rhizosphere
30 2808606390 Burkholderia sp. SJZ115 Isolate Rhizosphere
31 2808606391 Burkholderia sp. SJZ091 Isolate Rhizosphere
32 2818991446 Variovorax sp. 1180 Isolate Unclassified
33 2818991452 Burkholderia cepacia 561 Isolate Unclassified
34 2831265667 Variovorax guangxiensis DSM 27352 Isolate Rhizosphere
35 2842914999 Luteibacter sp. R-72151 Isolate Unclassified
36 2856287931 Paraburkholderia bannensis BE22 Isolate Rhizosphere
37 2857357740 Paraburkholderia tropica BE15 Isolate Rhizosphere
38 2863421361 Burkholderia cenocepacia CACua-24 Isolate Rhizosphere
39 2870068957 Burkholderia sp. JP2-270 Isolate Unclassified
40 2883087390 Paraburkholderia guartelaensis CNPSo 3008 Isolate Unclassified
41 2885198086 Variovorax sp. 679 Isolate Unclassified
42 2885211737 Variovorax sp. 553 Isolate Unclassified
43 2904449895 Variovorax sp. 1763 Isolate Rhizosphere
44 2904456579 Variovorax sp. 2002 Isolate Unclassified
45 2904564687 Burkholderia sp. 571 Isolate Unclassified
46 2904571731 Burkholderia cenocepacia 574 Isolate Unclassified
47 2928037797 Variovorax sp. 1126 Isolate Unclassified
48 2928044640 Variovorax sp. 1128 Isolate Unclassified
49 2928051484 Variovorax sp. 1133 Isolate Unclassified
50 2928064002 Variovorax sp. 1140 Isolate Rhizosphere
51 2928070936 Variovorax gossypii 1167 Isolate Unclassified
52 2928084124 Variovorax paradoxus 1218 Isolate Unclassified
53 2928157003 Burkholderia ambifaria 566 Isolate Unclassified
54 2928163908 Burkholderia sp. 567 Isolate Unclassified
55 2928170801 Burkholderia sp. 572 Isolate Unclassified
56 2928536128 Burkholderia sola 565 Isolate Unclassified
57 2929520902 Variovorax beijingensis 502 Isolate Unclassified
58 2939573065 Citrobacter sp. 506 Isolate Rhizosphere
59 2945909444 Variovorax sp. CRF3-Va-1 W1I1 Isolate Rhizosphere
60 2945972063 Variovorax paradoxus W2I8 Isolate Rhizosphere
61 2945984333 Variovorax sp. W2I14 Isolate Rhizosphere
62 2954767861 Variovorax sp. TBS-050B Isolate Rhizosphere
63 2974298342 Pseudomonas sp. SORGH_AS 211 Isolate Unclassified
64 2981990288 Burkholderia sp. PvR073 Isolate Rhizosphere
65 2984499530 Pseudomonas sp. SORGH_AS199 Isolate Aerial Root
66 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
67 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
68 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
69 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
70 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
71 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
72 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
73 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
74 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
75 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
76 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
77 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
78 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
79 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
80 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
81 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
82 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
83 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
84 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
85 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
86 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
87 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
88 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
89 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
90 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
91 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
92 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
93 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
94 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
95 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
96 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
97 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
98 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
99 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
100 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
101 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
102 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
103 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
104 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
105 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
106 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
107 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
108 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
109 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
110 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
111 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
112 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
113 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
114 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
115 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
116 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
117 3300012502 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610 Metagenome Rhizosphere
118 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
119 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
120 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
121 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
122 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
123 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
124 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
125 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
126 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
127 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
128 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
129 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
130 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
131 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
132 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
133 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
134 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
135 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
136 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
137 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
138 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
139 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
140 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
141 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
142 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
143 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
144 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
145 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
146 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
147 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
148 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
171 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
172 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
174 3300030083 Coralloid root microbial communities from Jiquipilas, Chiapas, Mexico - JPPOOL-T1 Metagenome Unclassified
175 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
176 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
177 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
178 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
179 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
180 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
181 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
182 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
183 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
184 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
185 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
186 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
187 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
188 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
189 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
190 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
191 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
192 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
193 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
194 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
195 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
196 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
197 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
198 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
199 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
200 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
201 3300042121 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 Metagenome Rhizosphere
202 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
203 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
204 3300042135 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 Metagenome Rhizosphere
205 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
206 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
207 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
208 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
209 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
210 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
211 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
212 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
213 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
214 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
215 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
216 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
217 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
218 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
219 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
220 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
221 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
222 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
223 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
224 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
225 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
226 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
227 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
228 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
229 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
230 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
231 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
232 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
233 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
234 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
235 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
236 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
237 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
238 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
239 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
240 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
241 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
242 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
243 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
244 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
245 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
246 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
247 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
248 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
249 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
250 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
251 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
252 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
253 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
254 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
255 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
256 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
257 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
258 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
259 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
260 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
261 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
262 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
263 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
264 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
265 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
266 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
267 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
268 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
269 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
270 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
271 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
272 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
273 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
274 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
275 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
276 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
277 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
278 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
279 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
280 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
281 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
282 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
283 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
284 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
285 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
286 3300048986 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1E Metagenome Unclassified
287 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
288 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
289 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
290 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
291 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
292 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
293 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
294 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
295 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
296 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
297 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
298 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
299 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
300 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
301 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
302 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
303 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
304 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
305 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
306 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
307 3300053110 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 endosphere Metagenome Endosphere
308 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
309 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
310 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
311 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
312 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
313 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
314 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
315 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
316 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
317 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
318 3300053141 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere Metagenome Endosphere
319 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
320 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
321 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
322 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
323 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
324 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
325 641736154 Burkholderia ambifaria IOP40-10 Isolate Rhizosphere
326 644736347 Cupriavidus taiwanensis LMG 19424 Isolate Nodule
327 8020938398 Burkholderia sp. BE12 Isolate Rhizosphere
328 8020945358 Burkholderia sp. BE17 Isolate Rhizosphere
329 8020953355 Burkholderia sp. BE24 Isolate Rhizosphere
330 8021120328 Burkholderia sp. LS-044 Isolate Rhizosphere
331 8039098773 Burkholderia multivorans MSMB612WGS Isolate Unclassified
332 8054929484 Pseudomonas vlassakiae RW4S1 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 86.27
Metatranscriptomes 0.18
Isolates 13.55

Biome Distribution

Category Percentage (%)
Aerial Root 0.18
Bulb 0
Endosphere 19.79
Nodule 0.71
Rhizoplane 3.03
Rhizosphere 63.81
Stem 0
Stem Tuber 0
Unclassified 12.48

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24739J22299_10032598 3300001989 Bacteria 1791
2 JGI25156J39149_1000406 3300002705 Bacteria 26975
3 rootH2_10090600 3300003320 Bacteria 1133
4 Ga0006562J51391_1069169 3300003578 Bacteria 800
5 Ga0055532_1000529 3300003758 Bacteria 16669
6 Ga0055532_1024655 3300003758 Bacteria 598
7 Ga0055527_1000291 3300003760 Bacteria 29060
8 Ga0055527_1017507 3300003760 Bacteria 768
9 Ga0055535_1000215 3300003761 Bacteria 61211
10 Ga0055535_1000506 3300003761 Bacteria 34557
11 Ga0055542_1000004 3300003762 Bacteria 553532
12 Ga0055542_1000502 3300003762 Bacteria 35790
13 Ga0055529_1000495 3300003763 Bacteria 35799
14 Ga0055536_1000532 3300003781 Bacteria 26166
15 Ga0055536_1006662 3300003781 Bacteria 5320
16 Ga0055536_1011569 3300003781 Bacteria 3365
17 Ga0055534_1000024 3300003784 Bacteria 131674
18 Ga0055534_1011908 3300003784 Bacteria 1745
19 Ga0055528_1001110 3300003790 Bacteria 17660
20 Ga0055530_10000502 3300003791 Bacteria 33938
21 Ga0055530_10005458 3300003791 Bacteria 6033
22 Ga0055540_1004114 3300003792 Bacteria 6728
23 Ga0055540_1005189 3300003792 Bacteria 5588
24 Ga0055540_1005483 3300003792 Bacteria 5320
25 Ga0055531_10000983 3300003794 Bacteria 22683
26 Ga0055531_10008665 3300003794 Bacteria 5320
27 Ga0055531_10053606 3300003794 Bacteria 1040
28 Ga0065704_10076870 3300005289 Bacteria 4945
29 Ga0068869_100694438 3300005334 Bacteria 867
30 Ga0070660_100001233 3300005339 Bacteria 17366
31 Ga0070659_100000055 3300005366 Bacteria 88573
32 Ga0070700_100216837 3300005441 Bacteria 1353
33 Ga0070663_100335726 3300005455 Bacteria 1219
34 Ga0070662_100051555 3300005457 Bacteria 2972
35 Ga0068853_100491687 3300005539 Bacteria 1157
36 Ga0070686_100653966 3300005544 Bacteria 834
37 Ga0070695_100116339 3300005545 Bacteria 1823
38 Ga0070695_100339818 3300005545 Bacteria 1122
39 Ga0070665_102404286 3300005548 Bacteria 529
40 Ga0068855_100001016 3300005563 Bacteria 34948
41 Ga0068855_100686995 3300005563 Bacteria 1096
42 Ga0070664_100208222 3300005564 Bacteria 1747
43 Ga0070664_100458663 3300005564 Bacteria 1171
44 Ga0068857_100343154 3300005577 Bacteria 1382
45 Ga0068852_100013927 3300005616 Bacteria 6168
46 Ga0068852_100046537 3300005616 Bacteria 3697
47 Ga0075365_10036928 3300006038 Bacteria 3169
48 Ga0075363_100066376 3300006048 Bacteria 1953
49 Ga0075363_100137151 3300006048 Bacteria 1375
50 Ga0075364_10052783 3300006051 Bacteria 2657
51 Ga0075364_10415919 3300006051 Bacteria 918
52 Ga0075432_10110808 3300006058 Bacteria 1022
53 Ga0075362_10005546 3300006177 Bacteria 4629
54 Ga0075367_10060239 3300006178 Bacteria 2263
55 Ga0075369_10117873 3300006186 Bacteria 1200
56 Ga0075366_10018935 3300006195 Bacteria 3979
57 Ga0075366_10438519 3300006195 Bacteria 805
58 Ga0075370_10001129 3300006353 Bacteria 11193
59 Ga0075370_10001606 3300006353 Bacteria 9973
60 Ga0075370_10244375 3300006353 Bacteria 1063
61 Ga0075430_100058327 3300006846 Bacteria 3245
62 Ga0079104_1027975 3300006946 Bacteria 1438
63 Ga0105251_10034433 3300009011 Bacteria 2507
64 Ga0105251_10129851 3300009011 Bacteria 1142
65 Ga0105244_10005627 3300009036 Bacteria 8277
66 Ga0105244_10006016 3300009036 Bacteria 7948
67 Ga0105244_10242859 3300009036 Bacteria 841
68 Ga0105250_10000117 3300009092 Bacteria 71574
69 Ga0105240_10007671 3300009093 Bacteria 15623
70 Ga0105240_10018272 3300009093 Bacteria 9425
71 Ga0105243_10002802 3300009148 Bacteria 14476
72 Ga0105243_10202552 3300009148 Bacteria 1742
73 Ga0105243_10577967 3300009148 Bacteria 1078
74 Ga0105242_11060362 3300009176 Bacteria 822
75 Ga0105237_10097776 3300009545 Bacteria 2926
76 Ga0105237_11028572 3300009545 Bacteria 831
77 Ga0105238_10088529 3300009551 Bacteria 3082
78 Ga0105239_10007284 3300010375 Bacteria 12699
79 Ga0105239_10028949 3300010375 Bacteria 6089
80 Ga0105239_11328507 3300010375 Bacteria 829
81 Ga0105246_10088164 3300011119 Bacteria 2228
82 Ga0105246_10265379 3300011119 Bacteria 1370
83 Ga0157347_1019701 3300012502 Bacteria 781
84 Ga0157373_10052060 3300013100 Bacteria 2914
85 Ga0157371_10004655 3300013102 Bacteria 11878
86 Ga0157371_10019307 3300013102 Bacteria 5028
87 Ga0157370_10000372 3300013104 Bacteria 56499
88 Ga0157370_10070692 3300013104 Bacteria 3294
89 Ga0157370_10123118 3300013104 Bacteria 2421
90 Ga0157370_10210915 3300013104 Bacteria 1800
91 Ga0157370_11552258 3300013104 Bacteria 595
92 Ga0157369_10001379 3300013105 Bacteria 29905
93 Ga0157369_10255698 3300013105 Bacteria 1827
94 Ga0157369_10897441 3300013105 Bacteria 909
95 Ga0157374_11535429 3300013296 Bacteria 689
96 Ga0157372_10783696 3300013307 Bacteria 1108
97 Ga0157380_10451895 3300014326 Bacteria 1234
98 Ga0182008_10001492 3300014497 Bacteria 15633
99 Ga0182008_10023787 3300014497 Bacteria 3123
100 Ga0182006_1001173 3300015261 Bacteria 16469
101 Ga0182006_1048631 3300015261 Bacteria 1639
102 Ga0182006_1160007 3300015261 Bacteria 759
103 Ga0182007_10000583 3300015262 Bacteria 21488
104 Ga0182007_10000924 3300015262 Bacteria 16214
105 Ga0182005_1064955 3300015265 Bacteria 998
106 Ga0163161_10000463 3300017792 Bacteria 33681
107 Ga0163161_10010048 3300017792 Bacteria 6553
108 Ga0209566_100258 3300025225 Bacteria 50542
109 Ga0209672_100080 3300025228 Bacteria 143481
110 Ga0209672_108431 3300025228 Bacteria 1526
111 Ga0209147_100071 3300025229 Bacteria 215861
112 Ga0209147_100091 3300025229 Bacteria 168353
113 Ga0209147_102312 3300025229 Bacteria 4915
114 Ga0209258_100022 3300025242 Bacteria 553584
115 Ga0209258_100082 3300025242 Bacteria 247739
116 Ga0207425_1010775 3300025245 Bacteria 2211
117 Ga0209148_1000034 3300025254 Bacteria 553584
118 Ga0209148_1000195 3300025254 Bacteria 109654
119 Ga0209759_1000236 3300025256 Bacteria 82430
120 Ga0209565_1000040 3300025263 Bacteria 266543
121 Ga0209455_1000172 3300025272 Bacteria 109654
122 Ga0209673_1000076 3300025273 Bacteria 230907
123 Ga0209673_1000109 3300025273 Bacteria 183000
124 Ga0209673_1048682 3300025273 Bacteria 1139
125 Ga0209675_1000024 3300025291 Bacteria 312615
126 Ga0209675_1033765 3300025291 Bacteria 1182
127 Ga0209676_1000005 3300025292 Bacteria 1076001
128 Ga0209676_1000478 3300025292 Bacteria 65984
129 Ga0209676_1044454 3300025292 Bacteria 1218
130 Ga0209676_1061001 3300025292 Bacteria 939
131 Ga0209025_1007853 3300025294 Bacteria 7832
132 Ga0209564_1092679 3300025295 Bacteria 548
133 Ga0209050_1000007 3300025298 Bacteria 1187891
134 Ga0209050_1000146 3300025298 Bacteria 166930
135 Ga0209050_1031392 3300025298 Bacteria 1656
136 Ga0207426_1149324 3300025302 Bacteria 547
137 Ga0209051_1000009 3300025303 Bacteria 706778
138 Ga0209051_1000092 3300025303 Bacteria 170056
139 Ga0209051_1000598 3300025303 Bacteria 42554
140 Ga0209257_1000011 3300025304 Bacteria 1112630
141 Ga0209257_1000576 3300025304 Bacteria 61751
142 Ga0209257_1004039 3300025304 Bacteria 11796
143 Ga0207696_1000170 3300025711 Bacteria 102852
144 Ga0207655_1005449 3300025728 Bacteria 8647
145 Ga0207655_1008571 3300025728 Bacteria 6471
146 Ga0207655_1075039 3300025728 Bacteria 1242
147 Ga0207713_1000366 3300025735 Bacteria 49069
148 Ga0207713_1146222 3300025735 Bacteria 767
149 Ga0207647_10001075 3300025904 Bacteria 21061
150 Ga0207705_10454097 3300025909 Bacteria 994
151 Ga0207695_10000268 3300025913 Bacteria 130752
152 Ga0207695_10021004 3300025913 Bacteria 7457
153 Ga0207671_10028223 3300025914 Bacteria 4195
154 Ga0207671_10065539 3300025914 Bacteria 2702
155 Ga0207671_11482307 3300025914 Bacteria 524
156 Ga0207657_10000087 3300025919 Bacteria 88335
157 Ga0207694_10075553 3300025924 Bacteria 2637
158 Ga0207650_10073315 3300025925 Bacteria 2578
159 Ga0207690_10000071 3300025932 Bacteria 88665
160 Ga0207706_10015493 3300025933 Bacteria 6889
161 Ga0207706_10467588 3300025933 Bacteria 1090
162 Ga0207709_10000233 3300025935 Bacteria 70451
163 Ga0207709_10000813 3300025935 Bacteria 24175
164 Ga0207709_10010216 3300025935 Bacteria 5170
165 Ga0207670_10703795 3300025936 Bacteria 836
166 Ga0207711_10056667 3300025941 Bacteria 3368
167 Ga0207679_10426340 3300025945 Bacteria 1172
168 Ga0207679_10620183 3300025945 Bacteria 976
169 Ga0207667_10000040 3300025949 Bacteria 275827
170 Ga0207667_10058539 3300025949 Bacteria 4040
171 Ga0207667_10214911 3300025949 Bacteria 1970
172 Ga0207639_10074372 3300026041 Bacteria 2668
173 Ga0207708_10095980 3300026075 Bacteria 2290
174 Ga0207702_10387413 3300026078 Bacteria 1345
175 Ga0207674_10067087 3300026116 Bacteria 3613
176 Ga0207698_10009359 3300026142 Bacteria 6244
177 Ga0207698_10995973 3300026142 Bacteria 849
178 Ga0209281_1020575 3300027111 Bacteria 1287
179 Ga0209371_1000713 3300027312 Bacteria 28089
180 Ga0268264_10175879 3300028381 Unclassified 1940
181 Ga0265338_10000191 3300028800 Bacteria 115408
182 Ga0237817_14244 3300030083 Bacteria 546
183 Ga0268256_1000608 3300030500 Bacteria 28089
184 Ga0316177_1015375 3300030731 Bacteria 873
185 Ga0314311_1224032 3300030733 Bacteria 2939
186 Ga0316183_1118103 3300030742 Bacteria 2320
187 Ga0316181_1001035 3300030744 Bacteria 871
188 Ga0316181_1255510 3300030744 Bacteria 1271
189 Ga0265340_10069789 3300031247 Bacteria 1667
190 Ga0307408_100026404 3300031548 Bacteria 3989
191 Ga0307408_100060441 3300031548 Bacteria 2762
192 Ga0307408_100291317 3300031548 Bacteria 1363
193 Ga0307408_100393226 3300031548 Bacteria 1188
194 Ga0307408_100471126 3300031548 Bacteria 1093
195 Ga0307408_100683966 3300031548 Bacteria 920
196 Ga0307408_100848614 3300031548 Bacteria 832
197 Ga0307514_10034964 3300031649 Bacteria 4002
198 Ga0307405_10014618 3300031731 Bacteria 4227
199 Ga0307405_10025215 3300031731 Bacteria 3409
200 Ga0307405_10114750 3300031731 Bacteria 1831
201 Ga0307405_11719944 3300031731 Bacteria 556
202 Ga0307413_10408734 3300031824 Bacteria 1066
203 Ga0307406_10000519 3300031901 Bacteria 22118
204 Ga0307406_10301505 3300031901 Bacteria 1231
205 Ga0307406_10847918 3300031901 Bacteria 774
206 Ga0307406_11948251 3300031901 Bacteria 524
207 Ga0307412_10003407 3300031911 Bacteria 8831
208 Ga0307412_10023191 3300031911 Bacteria 3815
209 Ga0307412_10143792 3300031911 Bacteria 1750
210 Ga0307412_10370971 3300031911 Bacteria 1155
211 Ga0307412_11195905 3300031911 Bacteria 680
212 Ga0307412_11890962 3300031911 Bacteria 550
213 Ga0307416_100289303 3300032002 Bacteria 1621
214 Ga0307416_100402699 3300032002 Bacteria 1406
215 Ga0307416_101967494 3300032002 Bacteria 687
216 Ga0307416_102691274 3300032002 Bacteria 594
217 Ga0307414_10004871 3300032004 Bacteria 7334
218 Ga0307414_10078007 3300032004 Bacteria 2413
219 Ga0307414_10205866 3300032004 Bacteria 1604
220 Ga0307414_10493591 3300032004 Bacteria 1082
221 Ga0307414_12323245 3300032004 Bacteria 501
222 Ga0307411_10127515 3300032005 Bacteria 1853
223 Ga0307411_10445228 3300032005 Bacteria 1082
224 Ga0307411_10969389 3300032005 Bacteria 759
225 Ga0307510_10089335 3300033180 Bacteria 2934
226 Ga0395898_0209753 3300037466 Bacteria 1858
227 Ga0439436_0001827 3300041404 Bacteria 6272
228 Ga0439466_0049950 3300041411 Bacteria 1372
229 Ga0439442_030159 3300042002 Bacteria 1132
230 Ga0439442_046508 3300042002 Bacteria 914
231 Ga0439432_001720 3300042006 Bacteria 8193
232 Ga0439449_0013591 3300042007 Bacteria 3063
233 Ga0439452_023182 3300042010 Bacteria 1599
234 Ga0439454_067965 3300042011 Bacteria 628
235 Ga0439462_0001315 3300042015 Bacteria 5469
236 Ga0439463_000012 3300042016 Bacteria 37568
237 Ga0439463_000222 3300042016 Bacteria 15649
238 Ga0450919_008504 3300042121 Bacteria 1186
239 Ga0450923_041812 3300042125 Bacteria 965
240 Ga0450898_040524 3300042134 Bacteria 880
241 Ga0450899_032795 3300042135 Bacteria 635
242 Ga0450906_042136 3300042145 Bacteria 806
243 Ga0450907_044396 3300042146 Bacteria 762
244 Ga0450910_000794 3300042147 Bacteria 3805
245 Ga0439446_0111104 3300042156 Bacteria 874
246 Ga0450908_031759 3300042184 Bacteria 917
247 Ga0450909_008810 3300042185 Bacteria 1469
248 Ga0450893_0008581 3300042532 Bacteria 1664
249 Ga0439440_0019607 3300042993 Bacteria 1510
250 Ga0466961_0168972 3300044693 Bacteria 1360
251 Ga0466970_0084980 3300044765 Bacteria 1714
252 Ga0466957_0072122 3300044842 Bacteria 2137
253 Ga0466959_0552902 3300045049 Bacteria 776
254 Ga0495617_082426 3300046452 Bacteria 1053
255 Ga0495627_006765 3300046453 Bacteria 4460
256 Ga0495627_031761 3300046453 Bacteria 1665
257 Ga0495590_0097735 3300046457 Bacteria 1042
258 Ga0495591_000009 3300046458 Bacteria 331626
259 Ga0495591_000137 3300046458 Bacteria 79532
260 Ga0495591_001356 3300046458 Bacteria 15361
261 Ga0495591_002627 3300046458 Bacteria 9852
262 Ga0495591_018493 3300046458 Bacteria 2361
263 Ga0495629_0340940 3300046459 Bacteria 1023
264 Ga0495629_0469847 3300046459 Bacteria 850
265 Ga0495638_0009525 3300046460 Bacteria 6810
266 Ga0495650_0018878 3300046471 Bacteria 3414
267 Ga0495580_0002292 3300046472 Bacteria 16704
268 Ga0495605_0000007 3300046474 Bacteria 358289
269 Ga0495605_0000075 3300046474 Bacteria 128702
270 Ga0495605_0000404 3300046474 Bacteria 39626
271 Ga0495605_0008009 3300046474 Bacteria 5982
272 Ga0495605_0123854 3300046474 Bacteria 1170
273 Ga0495605_0208814 3300046474 Bacteria 848
274 Ga0495584_0006944 3300046491 Bacteria 5914
275 Ga0495585_0029842 3300046492 Bacteria 3102
276 Ga0495594_0076408 3300046499 Bacteria 1867
277 Ga0495596_0074665 3300046500 Bacteria 1316
278 Ga0495607_0000051 3300046501 Bacteria 119303
279 Ga0495607_0000206 3300046501 Bacteria 62802
280 Ga0495607_0000525 3300046501 Bacteria 37706
281 Ga0495607_0002273 3300046501 Bacteria 15821
282 Ga0495607_0041545 3300046501 Bacteria 2730
283 Ga0495583_0000007 3300046506 Bacteria 434661
284 Ga0495583_0001550 3300046506 Bacteria 22768
285 Ga0495583_0003154 3300046506 Bacteria 13000
286 Ga0495583_0005107 3300046506 Bacteria 9042
287 Ga0495583_0251850 3300046506 Bacteria 708
288 Ga0495606_0000360 3300046507 Bacteria 77832
289 Ga0495606_0006185 3300046507 Bacteria 11140
290 Ga0495606_0270085 3300046507 Bacteria 934
291 Ga0495610_0004042 3300046512 Bacteria 11036
292 Ga0495610_0006856 3300046512 Bacteria 7722
293 Ga0495610_0052116 3300046512 Bacteria 1987
294 Ga0495616_0006074 3300046513 Bacteria 7358
295 Ga0495616_0127605 3300046513 Bacteria 1168
296 Ga0495616_0204806 3300046513 Bacteria 865
297 Ga0495620_0000103 3300046515 Bacteria 67830
298 Ga0495620_0000399 3300046515 Bacteria 29177
299 Ga0495620_0048087 3300046515 Bacteria 1832
300 Ga0495631_0001287 3300046518 Bacteria 15402
301 Ga0495631_0003741 3300046518 Bacteria 8286
302 Ga0495631_0007776 3300046518 Bacteria 5438
303 Ga0495631_0021365 3300046518 Bacteria 3014
304 Ga0495632_0007675 3300046519 Bacteria 6736
305 Ga0495632_0063563 3300046519 Bacteria 1786
306 Ga0495637_0000063 3300046520 Bacteria 93270
307 Ga0495637_0001128 3300046520 Bacteria 16357
308 Ga0495637_0019129 3300046520 Bacteria 3168
309 Ga0495637_0022657 3300046520 Bacteria 2862
310 Ga0495637_0033147 3300046520 Bacteria 2271
311 Ga0495643_0004968 3300046522 Bacteria 9125
312 Ga0495643_0168510 3300046522 Bacteria 1072
313 Ga0495643_0458733 3300046522 Bacteria 553
314 Ga0495644_0002845 3300046523 Bacteria 6856
315 Ga0495648_0000255 3300046524 Bacteria 60610
316 Ga0495648_0003240 3300046524 Bacteria 14433
317 Ga0495648_0004197 3300046524 Bacteria 12375
318 Ga0495654_0004712 3300046530 Bacteria 8035
319 Ga0495654_0008660 3300046530 Bacteria 5607
320 Ga0495654_0016276 3300046530 Bacteria 3935
321 Ga0495654_0021036 3300046530 Bacteria 3397
322 Ga0495654_0021850 3300046530 Bacteria 3328
323 Ga0495654_0100863 3300046530 Bacteria 1329
324 Ga0495609_0000004 3300046538 Bacteria 697346
325 Ga0495609_0002514 3300046538 Bacteria 11252
326 Ga0495609_0055191 3300046538 Bacteria 1763
327 Ga0495621_0015286 3300046539 Bacteria 2445
328 Ga0495597_0000057 3300046542 Bacteria 93902
329 Ga0495597_0033869 3300046542 Bacteria 2310
330 Ga0495622_0013650 3300046557 Bacteria 3767
331 Ga0495622_0258083 3300046557 Bacteria 765
332 Ga0495633_0000020 3300046558 Bacteria 227180
333 Ga0495633_0000426 3300046558 Bacteria 43843
334 Ga0495633_0091302 3300046558 Bacteria 1416
335 Ga0495633_0273544 3300046558 Bacteria 769
336 Ga0495668_0004469 3300046616 Bacteria 9916
337 Ga0495668_0021572 3300046616 Bacteria 3691
338 Ga0495668_0021986 3300046616 Bacteria 3649
339 Ga0495668_0041105 3300046616 Bacteria 2577
340 Ga0495611_0006050 3300046648 Bacteria 5161
341 Ga0495611_0016690 3300046648 Bacteria 3138
342 Ga0495611_0024399 3300046648 Bacteria 2630
343 Ga0495625_0000004 3300046660 Bacteria 611314
344 Ga0495625_0000624 3300046660 Bacteria 51214
345 Ga0495625_0161055 3300046660 Bacteria 1503
346 Ga0495635_0072452 3300046663 Bacteria 2360
347 Ga0495661_0000006 3300046665 Bacteria 427288
348 Ga0495661_0000009 3300046665 Bacteria 291327
349 Ga0495661_0041112 3300046665 Bacteria 2863
350 Ga0495661_0144133 3300046665 Bacteria 1293
351 Ga0495588_0009342 3300046674 Bacteria 4529
352 Ga0495588_0025816 3300046674 Bacteria 2930
353 Ga0495588_0081384 3300046674 Bacteria 1690
354 Ga0495658_0009072 3300046683 Bacteria 4946
355 Ga0495670_0003007 3300046691 Bacteria 8314
356 Ga0495671_0001461 3300046692 Bacteria 15856
357 Ga0495671_0001571 3300046692 Bacteria 15129
358 Ga0495671_0018352 3300046692 Bacteria 3714
359 Ga0495671_0025678 3300046692 Bacteria 3058
360 Ga0495649_0099266 3300046694 Bacteria 1548
361 Ga0495589_0009149 3300046794 Bacteria 5151
362 Ga0495660_0001968 3300046810 Bacteria 13361
363 Ga0495660_0001969 3300046810 Bacteria 13356
364 Ga0495660_0005239 3300046810 Bacteria 7778
365 Ga0495660_0014756 3300046810 Bacteria 4518
366 Ga0495660_0269151 3300046810 Bacteria 783
367 Ga0495660_0296982 3300046810 Bacteria 733
368 Ga0495660_0459430 3300046810 Bacteria 549
369 Ga0495672_0024061 3300047320 Bacteria 3931
370 Ga0495672_0026368 3300047320 Bacteria 3709
371 Ga0495672_0046189 3300047320 Bacteria 2599
372 Ga0495672_0071765 3300047320 Bacteria 1958
373 Ga0495676_0006320 3300047321 Bacteria 10905
374 Ga0495676_0007228 3300047321 Bacteria 10184
375 Ga0495683_0000003 3300047323 Bacteria 383992
376 Ga0495683_0003277 3300047323 Bacteria 9463
377 Ga0495683_0103674 3300047323 Bacteria 1365
378 Ga0495679_000066 3300047446 Bacteria 100641
379 Ga0495679_001956 3300047446 Bacteria 10998
380 Ga0495679_130050 3300047446 Bacteria 683
381 Ga0495673_0000846 3300047469 Bacteria 28434
382 Ga0495673_0002601 3300047469 Bacteria 12557
383 Ga0495673_0008081 3300047469 Bacteria 5961
384 Ga0495673_0015974 3300047469 Bacteria 3850
385 Ga0495673_0028944 3300047469 Bacteria 2618
386 Ga0495681_0006555 3300047470 Bacteria 7627
387 Ga0495681_0020372 3300047470 Bacteria 3600
388 Ga0495681_0148150 3300047470 Bacteria 986
389 Ga0495681_0205473 3300047470 Bacteria 797
390 Ga0495686_0052314 3300047472 Bacteria 2561
391 Ga0495686_0283200 3300047472 Bacteria 920
392 Ga0495593_0016457 3300047673 Bacteria 4170
393 Ga0495614_0155401 3300048089 Bacteria 1021
394 Ga0495626_0003278 3300048091 Bacteria 10449
395 Ga0496101_0685048 3300048904 Bacteria 809
396 Ga0496102_0786985 3300048905 Bacteria 874
397 Ga0496102_1265770 3300048905 Bacteria 657
398 Ga0496102_1317976 3300048905 Bacteria 641
399 Ga0496104_0884538 3300048907 Bacteria 798
400 Ga0496104_0951144 3300048907 Bacteria 763
401 Ga0496109_0462773 3300048912 Bacteria 1198
402 Ga0496111_0625790 3300048914 Bacteria 787
403 Ga0496113_1437345 3300048916 Bacteria 533
404 Ga0496116_0232549 3300048919 Bacteria 933
405 Ga0496117_0080737 3300048920 Bacteria 2137
406 Ga0496117_0315654 3300048920 Bacteria 821
407 Ga0496117_0505264 3300048920 Bacteria 585
408 Ga0496117_0623653 3300048920 Bacteria 501
409 Ga0496118_0023686 3300048921 Bacteria 5324
410 Ga0496118_0035743 3300048921 Bacteria 4027
411 Ga0496118_0047685 3300048921 Bacteria 3318
412 Ga0496118_0129965 3300048921 Bacteria 1620
413 Ga0496118_0344714 3300048921 Bacteria 796
414 Ga0496120_0410442 3300048923 Bacteria 596
415 Ga0496121_0078267 3300048924 Bacteria 2629
416 Ga0496121_0093760 3300048924 Bacteria 2336
417 Ga0496122_0006710 3300048925 Bacteria 13098
418 Ga0496122_0040955 3300048925 Bacteria 3672
419 Ga0496122_0045503 3300048925 Bacteria 3410
420 Ga0496122_0276394 3300048925 Bacteria 921
421 Ga0496123_0005642 3300048926 Bacteria 12493
422 Ga0496123_0030273 3300048926 Bacteria 3964
423 Ga0496123_0102542 3300048926 Bacteria 1660
424 Ga0496124_0005009 3300048927 Bacteria 15150
425 Ga0496124_0006343 3300048927 Bacteria 12912
426 Ga0496124_0007422 3300048927 Bacteria 11656
427 Ga0496124_0047139 3300048927 Bacteria 3688
428 Ga0496124_0128712 3300048927 Bacteria 2014
429 Ga0496124_0168972 3300048927 Bacteria 1696
430 Ga0496125_0000055 3300048928 Bacteria 278140
431 Ga0496125_0024163 3300048928 Bacteria 5592
432 Ga0496125_0041637 3300048928 Bacteria 3924
433 Ga0496126_0074043 3300048929 Bacteria 3025
434 Ga0466983_0488659 3300048986 Bacteria 853
435 Ga0495678_000007 3300049459 Bacteria 448039
436 Ga0495678_000043 3300049459 Bacteria 172593
437 Ga0495678_051234 3300049459 Bacteria 1596
438 Ga0495678_124868 3300049459 Bacteria 859
439 Ga0495682_0000982 3300049460 Bacteria 17072
440 Ga0501249_001947 3300049679 Bacteria 4201
441 Ga0501225_0006911 3300049705 Bacteria 3307
442 Ga0501241_050264 3300049758 Bacteria 823
443 Ga0501262_000355 3300049759 Bacteria 5548
444 nmdc:mga03683_22114_c1 3300050489 Bacteria 2462
445 nmdc:mga03683_23539_c1 3300050489 Bacteria 2400
446 nmdc:mga03683_64856_c1 3300050489 Bacteria 1551
447 nmdc:mga03n38_145570_c1 3300050490 Bacteria 1188
448 nmdc:mga03n38_153649_c1 3300050490 Bacteria 1160
449 nmdc:mga03n38_55134_c1 3300050490 Bacteria 1790
450 nmdc:mga00v17_44307_c1 3300050491 Bacteria 2683
451 nmdc:mga00v17_517219_c1 3300050491 Bacteria 773
452 nmdc:mga00v17_978_c1 3300050491 Bacteria 15304
453 nmdc:mga0yw44_185578_c1 3300050492 Bacteria 1370
454 nmdc:mga0yw44_71309_c1 3300050492 Bacteria 2157
455 nmdc:mga0k408_50879_c1 3300050493 Bacteria 2399
456 nmdc:mga06z11_73906_c1 3300050494 Bacteria 1811
457 nmdc:mga07m45_488_c1 3300050496 Bacteria 16759
458 nmdc:mga07m45_84669_c1 3300050496 Bacteria 1813
459 nmdc:mga0qj67_31033_c1 3300050509 Bacteria 4161
460 nmdc:mga0sz30_62240_c1 3300050516 Bacteria 1596
461 Ga0500610_0004702 3300053079 Bacteria 5473
462 Ga0500651_0000052 3300053093 Bacteria 76301
463 Ga0500566_0291107 3300053094 Bacteria 773
464 Ga0500560_052353 3300053107 Bacteria 1313
465 Ga0500562_179051 3300053108 Bacteria 576
466 Ga0500571_000118 3300053110 Bacteria 25948
467 Ga0500592_008047 3300053116 Bacteria 1672
468 Ga0500593_000306 3300053117 Bacteria 19926
469 Ga0500594_0001446 3300053118 Bacteria 5155
470 Ga0500607_001189 3300053121 Bacteria 23935
471 Ga0500608_005072 3300053122 Bacteria 5182
472 Ga0500655_000281 3300053133 Bacteria 11746
473 Ga0500658_0000033 3300053134 Bacteria 89738
474 Ga0500658_0000040 3300053134 Bacteria 79293
475 Ga0500559_0019480 3300053136 Bacteria 2867
476 Ga0500564_098966 3300053138 Bacteria 1291
477 Ga0500568_0008134 3300053139 Bacteria 5082
478 Ga0500574_000532 3300053141 Bacteria 4892
479 Ga0500616_0050524 3300053153 Bacteria 2195
480 Ga0500627_0000079 3300053158 Bacteria 35871
481 Ga0500634_0014576 3300053161 Bacteria 4148
482 Ga0500634_0047084 3300053161 Bacteria 2329
483 Ga0500638_006107 3300053162 Bacteria 4891
484 Ga0500636_0075606 3300053177 Bacteria 1948
485 Ga0466962_0047799 3300061719 Bacteria 2045

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048926 Ga0496123_0102542 Ga0496123_0102542_1293_1649 117
2 iso_pu_bacteria 2513237150 2513954670 121
3 iso_pu_bacteria 2599185214 2599625931 121
4 iso_pu_bacteria 2599185226 2599674987 121
5 iso_pu_bacteria 2599185227 2599683881 121
6 iso_pu_bacteria 2599185229 2599695516 121
7 iso_pu_bacteria 2643221628 2644162956 121
8 iso_pu_bacteria 2643221658 2644329556 121
9 iso_pu_bacteria 2721755763 2723876078 121
10 iso_pu_bacteria 2765235841 2765584459 121
11 iso_pu_bacteria 2818991446 2819596217 121
12 iso_pu_bacteria 2831265667 2831270442 121
13 iso_pu_bacteria 2842914999 2842915890 121
14 iso_pu_bacteria 2885198086 2885199726 121
15 iso_pu_bacteria 2885211737 2885213377 121
16 iso_pu_bacteria 2904449895 2904454680 121
17 iso_pu_bacteria 2904456579 2904460397 121
18 iso_pu_bacteria 2928037797 2928038307 121
19 iso_pu_bacteria 2928044640 2928046088 121
20 iso_pu_bacteria 2928051484 2928053787 121
21 iso_pu_bacteria 2928064002 2928067330 121
22 iso_pu_bacteria 2928070936 2928076298 121
23 iso_pu_bacteria 2928084124 2928088905 121
24 iso_pu_bacteria 2929520902 2929524601 121
25 iso_pu_bacteria 2945909444 2945912841 121
26 iso_pu_bacteria 2945972063 2945976709 121
27 iso_pu_bacteria 2945984333 2945984893 121
28 iso_pu_bacteria 2954767861 2954771763 121
29 iso_pu_bacteria 644736347 644752232 121
30 iso_pu_bacteria 8054929484 8054932092 121
31 iso_pu_bacteria 2510065053 2510281145 122
32 iso_pu_bacteria 2510065055 2510295748 122
33 iso_pu_bacteria 2510065058 2510309293 122
34 iso_pu_bacteria 2599185185 2599486529 122
35 iso_pu_bacteria 2773857672 2774132086 122
36 iso_pu_bacteria 2974298342 2974300950 122
37 iso_pu_bacteria 2984499530 2984503426 122
38 iso_pu_bacteria 2501025501 2501076115 123
39 iso_pu_bacteria 2501025502 2501085825 123
40 iso_pu_bacteria 2501025504 2501411946 123
41 iso_pu_bacteria 2510917013 2511088442 123
42 iso_pu_bacteria 2510917014 2511100944 123
43 iso_pu_bacteria 2510917015 2511107291 123
44 iso_pu_bacteria 2515154189 2516020559 123
45 iso_pu_bacteria 2562617112 2563064079 123
46 iso_pu_bacteria 2599185239 2599741548 123
47 iso_pu_bacteria 2599185240 2599746723 123
48 iso_pu_bacteria 2599185355 2600208629 123
49 iso_pu_bacteria 2675903129 2676744285 123
50 iso_pu_bacteria 2711768613 2713472354 123
51 iso_pu_bacteria 2791355137 2792839120 123
52 iso_pu_bacteria 2808606384 2808967676 123
53 iso_pu_bacteria 2808606384 2808973812 123
54 iso_pu_bacteria 2808606390 2809002507 123
55 iso_pu_bacteria 2808606390 2809008746 123
56 iso_pu_bacteria 2808606391 2809009785 123
57 iso_pu_bacteria 2808606391 2809015748 123
58 iso_pu_bacteria 2818991452 2819630776 123
59 iso_pu_bacteria 2856287931 2856294528 123
60 iso_pu_bacteria 2857357740 2857367901 123
61 iso_pu_bacteria 2863421361 2863424617 123
62 iso_pu_bacteria 2870068957 2870071449 123
63 iso_pu_bacteria 2883087390 2883089461 123
64 iso_pu_bacteria 2904564687 2904568595 123
65 iso_pu_bacteria 2904571731 2904575637 123
66 iso_pu_bacteria 2928157003 2928160386 123
67 iso_pu_bacteria 2928163908 2928170632 123
68 iso_pu_bacteria 2928170801 2928172567 123
69 iso_pu_bacteria 2928536128 2928540658 123
70 iso_pu_bacteria 2981990288 2981996304 123
71 iso_pu_bacteria 641736154 642418204 123
72 iso_pu_bacteria 8020938398 8020941435 123
73 iso_pu_bacteria 8020945358 8020949371 123
74 iso_pu_bacteria 8020953355 8020957776 123
75 iso_pu_bacteria 8021120328 8021128004 123
76 iso_pu_bacteria 8039098773 8039104852 123
77 3300005441 Ga0070700_100216837 Ga0070700_1002168372 124
78 3300005545 Ga0070695_100116339 Ga0070695_1001163392 124
79 3300005545 Ga0070695_100339818 Ga0070695_1003398182 124
80 3300026075 Ga0207708_10095980 Ga0207708_100959803 124
81 3300003578 Ga0006562J51391_1069169 Ga0006562J51391_10691691 125
82 3300003758 Ga0055532_1024655 Ga0055532_10246552 125
83 3300003760 Ga0055527_1017507 Ga0055527_10175072 125
84 3300003761 Ga0055535_1000215 Ga0055535_10002152 125
85 3300003762 Ga0055542_1000004 Ga0055542_1000004424 125
86 3300003781 Ga0055536_1000532 Ga0055536_100053220 125
87 3300003781 Ga0055536_1006662 Ga0055536_10066626 125
88 3300003781 Ga0055536_1011569 Ga0055536_10115693 125
89 3300003784 Ga0055534_1000024 Ga0055534_100002499 125
90 3300003784 Ga0055534_1011908 Ga0055534_10119082 125
91 3300003790 Ga0055528_1001110 Ga0055528_100111015 125
92 3300003791 Ga0055530_10000502 Ga0055530_1000050223 125
93 3300003791 Ga0055530_10005458 Ga0055530_100054586 125
94 3300003792 Ga0055540_1004114 Ga0055540_10041146 125
95 3300003792 Ga0055540_1005189 Ga0055540_10051894 125
96 3300003792 Ga0055540_1005483 Ga0055540_10054833 125
97 3300003794 Ga0055531_10000983 Ga0055531_1000098318 125
98 3300003794 Ga0055531_10008665 Ga0055531_100086653 125
99 3300003794 Ga0055531_10053606 Ga0055531_100536062 125
100 3300005289 Ga0065704_10076870 Ga0065704_100768702 125
101 3300005334 Ga0068869_100694438 Ga0068869_1006944382 125
102 3300005457 Ga0070662_100051555 Ga0070662_1000515552 125
103 3300005539 Ga0068853_100491687 Ga0068853_1004916872 125
104 3300005544 Ga0070686_100653966 Ga0070686_1006539662 125
105 3300005548 Ga0070665_102404286 Ga0070665_1024042861 125
106 3300005563 Ga0068855_100001016 Ga0068855_10000101621 125
107 3300005564 Ga0070664_100458663 Ga0070664_1004586632 125
108 3300005577 Ga0068857_100343154 Ga0068857_1003431542 125
109 3300005616 Ga0068852_100046537 Ga0068852_1000465374 125
110 3300006038 Ga0075365_10036928 Ga0075365_100369282 125
111 3300006048 Ga0075363_100066376 Ga0075363_1000663762 125
112 3300006048 Ga0075363_100137151 Ga0075363_1001371512 125
113 3300006051 Ga0075364_10052783 Ga0075364_100527832 125
114 3300006051 Ga0075364_10415919 Ga0075364_104159192 125
115 3300006058 Ga0075432_10110808 Ga0075432_101108082 125
116 3300006177 Ga0075362_10005546 Ga0075362_100055462 125
117 3300006178 Ga0075367_10060239 Ga0075367_100602392 125
118 3300006186 Ga0075369_10117873 Ga0075369_101178732 125
119 3300006195 Ga0075366_10018935 Ga0075366_100189354 125
120 3300006195 Ga0075366_10438519 Ga0075366_104385192 125
121 3300006353 Ga0075370_10001129 Ga0075370_100011297 125
122 3300006353 Ga0075370_10001606 Ga0075370_1000160610 125
123 3300006353 Ga0075370_10244375 Ga0075370_102443751 125
124 3300006846 Ga0075430_100058327 Ga0075430_1000583273 125
125 3300006946 Ga0079104_1027975 Ga0079104_10279752 125
126 3300009011 Ga0105251_10129851 Ga0105251_101298512 125
127 3300009036 Ga0105244_10006016 Ga0105244_100060166 125
128 3300009036 Ga0105244_10242859 Ga0105244_102428592 125
129 3300009093 Ga0105240_10007671 Ga0105240_100076714 125
130 3300009148 Ga0105243_10002802 Ga0105243_100028025 125
131 3300009148 Ga0105243_10202552 Ga0105243_102025522 125
132 3300009148 Ga0105243_10577967 Ga0105243_105779672 125
133 3300009176 Ga0105242_11060362 Ga0105242_110603621 125
134 3300009545 Ga0105237_11028572 Ga0105237_110285722 125
135 3300010375 Ga0105239_10028949 Ga0105239_100289493 125
136 3300010375 Ga0105239_11328507 Ga0105239_113285071 125
137 3300011119 Ga0105246_10088164 Ga0105246_100881642 125
138 3300011119 Ga0105246_10265379 Ga0105246_102653792 125
139 3300012502 Ga0157347_1019701 Ga0157347_10197012 125
140 3300013102 Ga0157371_10019307 Ga0157371_100193074 125
141 3300013104 Ga0157370_10000372 Ga0157370_1000037231 125
142 3300013104 Ga0157370_10123118 Ga0157370_101231184 125
143 3300013104 Ga0157370_11552258 Ga0157370_115522582 125
144 3300013105 Ga0157369_10255698 Ga0157369_102556982 125
145 3300014326 Ga0157380_10451895 Ga0157380_104518953 125
146 3300014497 Ga0182008_10001492 Ga0182008_100014926 125
147 3300014497 Ga0182008_10023787 Ga0182008_100237875 125
148 3300015261 Ga0182006_1001173 Ga0182006_10011736 125
149 3300015261 Ga0182006_1160007 Ga0182006_11600071 125
150 3300015262 Ga0182007_10000924 Ga0182007_100009246 125
151 3300015265 Ga0182005_1064955 Ga0182005_10649552 125
152 3300017792 Ga0163161_10000463 Ga0163161_100004634 125
153 3300017792 Ga0163161_10010048 Ga0163161_100100487 125
154 3300025228 Ga0209672_108431 Ga0209672_1084312 125
155 3300025229 Ga0209147_102312 Ga0209147_1023125 125
156 3300025242 Ga0209258_100022 Ga0209258_100022424 125
157 3300025245 Ga0207425_1010775 Ga0207425_10107753 125
158 3300025254 Ga0209148_1000034 Ga0209148_1000034424 125
159 3300025263 Ga0209565_1000040 Ga0209565_100004041 125
160 3300025273 Ga0209673_1000109 Ga0209673_1000109122 125
161 3300025273 Ga0209673_1048682 Ga0209673_10486822 125
162 3300025291 Ga0209675_1000024 Ga0209675_1000024227 125
163 3300025292 Ga0209676_1000005 Ga0209676_1000005278 125
164 3300025292 Ga0209676_1000478 Ga0209676_100047811 125
165 3300025292 Ga0209676_1044454 Ga0209676_10444542 125
166 3300025292 Ga0209676_1061001 Ga0209676_10610012 125
167 3300025294 Ga0209025_1007853 Ga0209025_10078535 125
168 3300025298 Ga0209050_1000007 Ga0209050_1000007819 125
169 3300025298 Ga0209050_1000146 Ga0209050_100014658 125
170 3300025298 Ga0209050_1031392 Ga0209050_10313922 125
171 3300025302 Ga0207426_1149324 Ga0207426_11493241 125
172 3300025303 Ga0209051_1000009 Ga0209051_1000009278 125
173 3300025303 Ga0209051_1000092 Ga0209051_100009225 125
174 3300025303 Ga0209051_1000598 Ga0209051_100059821 125
175 3300025304 Ga0209257_1000011 Ga0209257_1000011252 125
176 3300025304 Ga0209257_1000576 Ga0209257_100057658 125
177 3300025304 Ga0209257_1004039 Ga0209257_10040396 125
178 3300025728 Ga0207655_1005449 Ga0207655_10054492 125
179 3300025728 Ga0207655_1008571 Ga0207655_10085714 125
180 3300025735 Ga0207713_1000366 Ga0207713_100036642 125
181 3300025735 Ga0207713_1146222 Ga0207713_11462222 125
182 3300025913 Ga0207695_10021004 Ga0207695_100210042 125
183 3300025914 Ga0207671_10065539 Ga0207671_100655393 125
184 3300025914 Ga0207671_11482307 Ga0207671_114823071 125
185 3300025925 Ga0207650_10073315 Ga0207650_100733152 125
186 3300025933 Ga0207706_10015493 Ga0207706_100154937 125
187 3300025933 Ga0207706_10467588 Ga0207706_104675882 125
188 3300025935 Ga0207709_10000233 Ga0207709_1000023362 125
189 3300025935 Ga0207709_10000813 Ga0207709_1000081319 125
190 3300025935 Ga0207709_10010216 Ga0207709_100102165 125
191 3300025936 Ga0207670_10703795 Ga0207670_107037951 125
192 3300025941 Ga0207711_10056667 Ga0207711_100566673 125
193 3300025945 Ga0207679_10426340 Ga0207679_104263402 125
194 3300025949 Ga0207667_10000040 Ga0207667_1000004020 125
195 3300025949 Ga0207667_10214911 Ga0207667_102149111 125
196 3300026041 Ga0207639_10074372 Ga0207639_100743722 125
197 3300026078 Ga0207702_10387413 Ga0207702_103874132 125
198 3300026116 Ga0207674_10067087 Ga0207674_100670873 125
199 3300026142 Ga0207698_10995973 Ga0207698_109959732 125
200 3300027111 Ga0209281_1020575 Ga0209281_10205752 125
201 3300028381 Ga0268264_10175879 Ga0268264_101758793 125
202 3300028800 Ga0265338_10000191 Ga0265338_1000019157 125
203 3300030731 Ga0316177_1015375 Ga0316177_10153752 125
204 3300030733 Ga0314311_1224032 Ga0314311_12240322 125
205 3300030742 Ga0316183_1118103 Ga0316183_11181033 125
206 3300030744 Ga0316181_1001035 Ga0316181_10010352 125
207 3300030744 Ga0316181_1255510 Ga0316181_12555102 125
208 3300031247 Ga0265340_10069789 Ga0265340_100697892 125
209 3300031548 Ga0307408_100026404 Ga0307408_1000264042 125
210 3300031548 Ga0307408_100060441 Ga0307408_1000604413 125
211 3300031548 Ga0307408_100291317 Ga0307408_1002913172 125
212 3300031548 Ga0307408_100393226 Ga0307408_1003932262 125
213 3300031548 Ga0307408_100471126 Ga0307408_1004711262 125
214 3300031548 Ga0307408_100683966 Ga0307408_1006839662 125
215 3300031548 Ga0307408_100848614 Ga0307408_1008486142 125
216 3300031649 Ga0307514_10034964 Ga0307514_100349644 125
217 3300031731 Ga0307405_10014618 Ga0307405_100146183 125
218 3300031731 Ga0307405_10025215 Ga0307405_100252155 125
219 3300031731 Ga0307405_10114750 Ga0307405_101147502 125
220 3300031731 Ga0307405_11719944 Ga0307405_117199441 125
221 3300031824 Ga0307413_10408734 Ga0307413_104087342 125
222 3300031901 Ga0307406_10000519 Ga0307406_1000051920 125
223 3300031901 Ga0307406_10301505 Ga0307406_103015052 125
224 3300031901 Ga0307406_10847918 Ga0307406_108479182 125
225 3300031901 Ga0307406_11948251 Ga0307406_119482511 125
226 3300031911 Ga0307412_10003407 Ga0307412_100034079 125
227 3300031911 Ga0307412_10023191 Ga0307412_100231913 125
228 3300031911 Ga0307412_10143792 Ga0307412_101437921 125
229 3300031911 Ga0307412_10370971 Ga0307412_103709712 125
230 3300031911 Ga0307412_11195905 Ga0307412_111959052 125
231 3300031911 Ga0307412_11890962 Ga0307412_118909622 125
232 3300032002 Ga0307416_100289303 Ga0307416_1002893032 125
233 3300032002 Ga0307416_100402699 Ga0307416_1004026992 125
234 3300032002 Ga0307416_101967494 Ga0307416_1019674942 125
235 3300032002 Ga0307416_102691274 Ga0307416_1026912741 125
236 3300032004 Ga0307414_10004871 Ga0307414_100048713 125
237 3300032004 Ga0307414_10078007 Ga0307414_100780072 125
238 3300032004 Ga0307414_10205866 Ga0307414_102058663 125
239 3300032004 Ga0307414_10493591 Ga0307414_104935912 125
240 3300032004 Ga0307414_12323245 Ga0307414_123232451 125
241 3300032005 Ga0307411_10127515 Ga0307411_101275153 125
242 3300032005 Ga0307411_10445228 Ga0307411_104452282 125
243 3300032005 Ga0307411_10969389 Ga0307411_109693892 125
244 3300033180 Ga0307510_10089335 Ga0307510_100893352 125
245 3300041404 Ga0439436_0001827 Ga0439436_0001827_4196_4576 125
246 3300041411 Ga0439466_0049950 Ga0439466_0049950_551_931 125
247 3300042002 Ga0439442_030159 Ga0439442_030159_601_981 125
248 3300042002 Ga0439442_046508 Ga0439442_046508_306_686 125
249 3300042006 Ga0439432_001720 Ga0439432_001720_5232_5612 125
250 3300042007 Ga0439449_0013591 Ga0439449_0013591_1561_1941 125
251 3300042010 Ga0439452_023182 Ga0439452_023182_613_993 125
252 3300042015 Ga0439462_0001315 Ga0439462_0001315_3718_4098 125
253 3300042016 Ga0439463_000222 Ga0439463_000222_7362_7739 125
254 3300042121 Ga0450919_008504 Ga0450919_008504_324_704 125
255 3300042125 Ga0450923_041812 Ga0450923_041812_386_766 125
256 3300042134 Ga0450898_040524 Ga0450898_040524_122_502 125
257 3300042135 Ga0450899_032795 Ga0450899_032795_32_412 125
258 3300042145 Ga0450906_042136 Ga0450906_042136_394_774 125
259 3300042146 Ga0450907_044396 Ga0450907_044396_91_471 125
260 3300042147 Ga0450910_000794 Ga0450910_000794_561_941 125
261 3300042156 Ga0439446_0111104 Ga0439446_0111104_280_660 125
262 3300042184 Ga0450908_031759 Ga0450908_031759_505_885 125
263 3300042185 Ga0450909_008810 Ga0450909_008810_1053_1433 125
264 3300042532 Ga0450893_0008581 Ga0450893_0008581_705_1085 125
265 3300046452 Ga0495617_082426 Ga0495617_082426_108_485 125
266 3300046453 Ga0495627_006765 Ga0495627_006765_1595_1972 125
267 3300046453 Ga0495627_031761 Ga0495627_031761_420_800 125
268 3300046457 Ga0495590_0097735 Ga0495590_0097735_83_460 125
269 3300046458 Ga0495591_000009 Ga0495591_000009_126626_127003 125
270 3300046458 Ga0495591_000137 Ga0495591_000137_40317_40694 125
271 3300046458 Ga0495591_001356 Ga0495591_001356_7095_7472 125
272 3300046458 Ga0495591_002627 Ga0495591_002627_8726_9103 125
273 3300046458 Ga0495591_018493 Ga0495591_018493_854_1231 125
274 3300046459 Ga0495629_0340940 Ga0495629_0340940_538_918 125
275 3300046459 Ga0495629_0469847 Ga0495629_0469847_396_776 125
276 3300046460 Ga0495638_0009525 Ga0495638_0009525_4809_5189 125
277 3300046471 Ga0495650_0018878 Ga0495650_0018878_2060_2437 125
278 3300046474 Ga0495605_0000007 Ga0495605_0000007_80935_81312 125
279 3300046474 Ga0495605_0000075 Ga0495605_0000075_28232_28609 125
280 3300046474 Ga0495605_0000404 Ga0495605_0000404_182_559 125
281 3300046474 Ga0495605_0008009 Ga0495605_0008009_5523_5900 125
282 3300046474 Ga0495605_0123854 Ga0495605_0123854_434_811 125
283 3300046491 Ga0495584_0006944 Ga0495584_0006944_2225_2602 125
284 3300046492 Ga0495585_0029842 Ga0495585_0029842_2478_2855 125
285 3300046499 Ga0495594_0076408 Ga0495594_0076408_1231_1608 125
286 3300046500 Ga0495596_0074665 Ga0495596_0074665_302_679 125
287 3300046501 Ga0495607_0000051 Ga0495607_0000051_32292_32669 125
288 3300046501 Ga0495607_0000206 Ga0495607_0000206_31000_31377 125
289 3300046501 Ga0495607_0000525 Ga0495607_0000525_28497_28874 125
290 3300046501 Ga0495607_0002273 Ga0495607_0002273_3363_3740 125
291 3300046501 Ga0495607_0041545 Ga0495607_0041545_729_1106 125
292 3300046506 Ga0495583_0000007 Ga0495583_0000007_39637_40014 125
293 3300046506 Ga0495583_0001550 Ga0495583_0001550_8430_8807 125
294 3300046506 Ga0495583_0003154 Ga0495583_0003154_11812_12189 125
295 3300046506 Ga0495583_0005107 Ga0495583_0005107_4999_5376 125
296 3300046506 Ga0495583_0251850 Ga0495583_0251850_207_587 125
297 3300046507 Ga0495606_0006185 Ga0495606_0006185_9737_10114 125
298 3300046507 Ga0495606_0270085 Ga0495606_0270085_455_832 125
299 3300046512 Ga0495610_0004042 Ga0495610_0004042_9979_10356 125
300 3300046512 Ga0495610_0006856 Ga0495610_0006856_6215_6592 125
301 3300046512 Ga0495610_0052116 Ga0495610_0052116_513_893 125
302 3300046513 Ga0495616_0006074 Ga0495616_0006074_4762_5142 125
303 3300046513 Ga0495616_0127605 Ga0495616_0127605_148_525 125
304 3300046513 Ga0495616_0204806 Ga0495616_0204806_341_718 125
305 3300046515 Ga0495620_0000103 Ga0495620_0000103_67011_67388 125
306 3300046515 Ga0495620_0000399 Ga0495620_0000399_13933_14310 125
307 3300046515 Ga0495620_0048087 Ga0495620_0048087_276_653 125
308 3300046518 Ga0495631_0001287 Ga0495631_0001287_2502_2879 125
309 3300046518 Ga0495631_0003741 Ga0495631_0003741_7574_7951 125
310 3300046518 Ga0495631_0007776 Ga0495631_0007776_109_489 125
311 3300046518 Ga0495631_0021365 Ga0495631_0021365_249_626 125
312 3300046519 Ga0495632_0007675 Ga0495632_0007675_4759_5136 125
313 3300046519 Ga0495632_0063563 Ga0495632_0063563_646_1023 125
314 3300046520 Ga0495637_0000063 Ga0495637_0000063_31731_32108 125
315 3300046520 Ga0495637_0001128 Ga0495637_0001128_341_718 125
316 3300046520 Ga0495637_0019129 Ga0495637_0019129_1905_2285 125
317 3300046520 Ga0495637_0022657 Ga0495637_0022657_2367_2744 125
318 3300046520 Ga0495637_0033147 Ga0495637_0033147_571_948 125
319 3300046522 Ga0495643_0004968 Ga0495643_0004968_7239_7616 125
320 3300046522 Ga0495643_0168510 Ga0495643_0168510_275_652 125
321 3300046522 Ga0495643_0458733 Ga0495643_0458733_141_518 125
322 3300046523 Ga0495644_0002845 Ga0495644_0002845_5730_6107 125
323 3300046524 Ga0495648_0000255 Ga0495648_0000255_24627_25004 125
324 3300046524 Ga0495648_0004197 Ga0495648_0004197_3359_3736 125
325 3300046530 Ga0495654_0004712 Ga0495654_0004712_2163_2540 125
326 3300046530 Ga0495654_0008660 Ga0495654_0008660_236_613 125
327 3300046530 Ga0495654_0016276 Ga0495654_0016276_1601_1978 125
328 3300046530 Ga0495654_0021036 Ga0495654_0021036_2739_3116 125
329 3300046530 Ga0495654_0021850 Ga0495654_0021850_2834_3214 125
330 3300046530 Ga0495654_0100863 Ga0495654_0100863_156_536 125
331 3300046538 Ga0495609_0000004 Ga0495609_0000004_83412_83789 125
332 3300046538 Ga0495609_0002514 Ga0495609_0002514_10336_10713 125
333 3300046538 Ga0495609_0055191 Ga0495609_0055191_1184_1561 125
334 3300046539 Ga0495621_0015286 Ga0495621_0015286_1272_1652 125
335 3300046542 Ga0495597_0000057 Ga0495597_0000057_32463_32840 125
336 3300046542 Ga0495597_0033869 Ga0495597_0033869_1848_2225 125
337 3300046557 Ga0495622_0013650 Ga0495622_0013650_1774_2151 125
338 3300046557 Ga0495622_0258083 Ga0495622_0258083_186_566 125
339 3300046558 Ga0495633_0000020 Ga0495633_0000020_143679_144056 125
340 3300046558 Ga0495633_0000426 Ga0495633_0000426_22984_23361 125
341 3300046558 Ga0495633_0091302 Ga0495633_0091302_511_891 125
342 3300046558 Ga0495633_0273544 Ga0495633_0273544_311_688 125
343 3300046616 Ga0495668_0004469 Ga0495668_0004469_1341_1718 125
344 3300046616 Ga0495668_0021572 Ga0495668_0021572_1816_2193 125
345 3300046616 Ga0495668_0021986 Ga0495668_0021986_1244_1621 125
346 3300046616 Ga0495668_0041105 Ga0495668_0041105_1870_2247 125
347 3300046648 Ga0495611_0006050 Ga0495611_0006050_3481_3858 125
348 3300046648 Ga0495611_0016690 Ga0495611_0016690_255_632 125
349 3300046648 Ga0495611_0024399 Ga0495611_0024399_1658_2035 125
350 3300046660 Ga0495625_0000004 Ga0495625_0000004_610636_611013 125
351 3300046660 Ga0495625_0000624 Ga0495625_0000624_44746_45126 125
352 3300046660 Ga0495625_0161055 Ga0495625_0161055_257_637 125
353 3300046663 Ga0495635_0072452 Ga0495635_0072452_211_591 125
354 3300046665 Ga0495661_0000006 Ga0495661_0000006_359004_359381 125
355 3300046665 Ga0495661_0000009 Ga0495661_0000009_39913_40290 125
356 3300046665 Ga0495661_0041112 Ga0495661_0041112_697_1074 125
357 3300046665 Ga0495661_0144133 Ga0495661_0144133_770_1150 125
358 3300046674 Ga0495588_0009342 Ga0495588_0009342_859_1239 125
359 3300046674 Ga0495588_0025816 Ga0495588_0025816_1857_2237 125
360 3300046674 Ga0495588_0081384 Ga0495588_0081384_898_1278 125
361 3300046683 Ga0495658_0009072 Ga0495658_0009072_3080_3460 125
362 3300046691 Ga0495670_0003007 Ga0495670_0003007_3938_4315 125
363 3300046692 Ga0495671_0001461 Ga0495671_0001461_12207_12587 125
364 3300046692 Ga0495671_0001571 Ga0495671_0001571_10047_10424 125
365 3300046692 Ga0495671_0018352 Ga0495671_0018352_2302_2679 125
366 3300046692 Ga0495671_0025678 Ga0495671_0025678_1456_1833 125
367 3300046694 Ga0495649_0099266 Ga0495649_0099266_834_1211 125
368 3300046794 Ga0495589_0009149 Ga0495589_0009149_1041_1418 125
369 3300046810 Ga0495660_0001968 Ga0495660_0001968_5550_5927 125
370 3300046810 Ga0495660_0001969 Ga0495660_0001969_7266_7643 125
371 3300046810 Ga0495660_0005239 Ga0495660_0005239_6526_6903 125
372 3300046810 Ga0495660_0014756 Ga0495660_0014756_1801_2178 125
373 3300046810 Ga0495660_0269151 Ga0495660_0269151_171_548 125
374 3300046810 Ga0495660_0296982 Ga0495660_0296982_187_564 125
375 3300046810 Ga0495660_0459430 Ga0495660_0459430_90_473 125
376 3300047320 Ga0495672_0024061 Ga0495672_0024061_3084_3461 125
377 3300047320 Ga0495672_0026368 Ga0495672_0026368_989_1366 125
378 3300047320 Ga0495672_0046189 Ga0495672_0046189_1403_1780 125
379 3300047320 Ga0495672_0071765 Ga0495672_0071765_1321_1698 125
380 3300047321 Ga0495676_0006320 Ga0495676_0006320_9663_10040 125
381 3300047321 Ga0495676_0007228 Ga0495676_0007228_405_785 125
382 3300047323 Ga0495683_0000003 Ga0495683_0000003_134615_134992 125
383 3300047323 Ga0495683_0003277 Ga0495683_0003277_7833_8210 125
384 3300047446 Ga0495679_000066 Ga0495679_000066_53252_53629 125
385 3300047446 Ga0495679_001956 Ga0495679_001956_10281_10658 125
386 3300047446 Ga0495679_130050 Ga0495679_130050_201_578 125
387 3300047469 Ga0495673_0000846 Ga0495673_0000846_1450_1827 125
388 3300047469 Ga0495673_0002601 Ga0495673_0002601_3597_3974 125
389 3300047469 Ga0495673_0008081 Ga0495673_0008081_786_1163 125
390 3300047469 Ga0495673_0015974 Ga0495673_0015974_966_1343 125
391 3300047469 Ga0495673_0028944 Ga0495673_0028944_797_1174 125
392 3300047470 Ga0495681_0006555 Ga0495681_0006555_5237_5614 125
393 3300047470 Ga0495681_0020372 Ga0495681_0020372_2715_3092 125
394 3300047470 Ga0495681_0148150 Ga0495681_0148150_339_716 125
395 3300047470 Ga0495681_0205473 Ga0495681_0205473_151_531 125
396 3300047472 Ga0495686_0052314 Ga0495686_0052314_444_821 125
397 3300047472 Ga0495686_0283200 Ga0495686_0283200_482_859 125
398 3300047673 Ga0495593_0016457 Ga0495593_0016457_1917_2297 125
399 3300048089 Ga0495614_0155401 Ga0495614_0155401_283_663 125
400 3300048091 Ga0495626_0003278 Ga0495626_0003278_302_679 125
401 3300048905 Ga0496102_0786985 Ga0496102_0786985_245_622 125
402 3300048905 Ga0496102_1317976 Ga0496102_1317976_97_477 125
403 3300048912 Ga0496109_0462773 Ga0496109_0462773_700_1089 125
404 3300048914 Ga0496111_0625790 Ga0496111_0625790_246_629 125
405 3300048916 Ga0496113_1437345 Ga0496113_1437345_84_473 125
406 3300048920 Ga0496117_0080737 Ga0496117_0080737_1125_1505 125
407 3300048920 Ga0496117_0315654 Ga0496117_0315654_247_627 125
408 3300048920 Ga0496117_0505264 Ga0496117_0505264_191_568 125
409 3300048920 Ga0496117_0623653 Ga0496117_0623653_93_485 125
410 3300048921 Ga0496118_0023686 Ga0496118_0023686_1622_2014 125
411 3300048921 Ga0496118_0047685 Ga0496118_0047685_1161_1541 125
412 3300048921 Ga0496118_0129965 Ga0496118_0129965_404_784 125
413 3300048924 Ga0496121_0093760 Ga0496121_0093760_1888_2268 125
414 3300048925 Ga0496122_0006710 Ga0496122_0006710_6012_6392 125
415 3300048925 Ga0496122_0045503 Ga0496122_0045503_260_637 125
416 3300048925 Ga0496122_0276394 Ga0496122_0276394_453_833 125
417 3300048926 Ga0496123_0005642 Ga0496123_0005642_4637_5017 125
418 3300048926 Ga0496123_0030273 Ga0496123_0030273_2297_2674 125
419 3300048927 Ga0496124_0005009 Ga0496124_0005009_12525_12905 125
420 3300048927 Ga0496124_0007422 Ga0496124_0007422_1024_1407 125
421 3300048927 Ga0496124_0128712 Ga0496124_0128712_615_995 125
422 3300048927 Ga0496124_0168972 Ga0496124_0168972_1261_1641 125
423 3300048928 Ga0496125_0024163 Ga0496125_0024163_3288_3668 125
424 3300048928 Ga0496125_0041637 Ga0496125_0041637_2676_3056 125
425 3300048929 Ga0496126_0074043 Ga0496126_0074043_2541_2921 125
426 3300049459 Ga0495678_000007 Ga0495678_000007_143353_143730 125
427 3300049459 Ga0495678_000043 Ga0495678_000043_9692_10069 125
428 3300049459 Ga0495678_051234 Ga0495678_051234_493_870 125
429 3300049459 Ga0495678_124868 Ga0495678_124868_189_566 125
430 3300049460 Ga0495682_0000982 Ga0495682_0000982_16453_16830 125
431 3300049679 Ga0501249_001947 Ga0501249_001947_3051_3431 125
432 3300049705 Ga0501225_0006911 Ga0501225_0006911_1117_1497 125
433 3300049758 Ga0501241_050264 Ga0501241_050264_269_649 125
434 3300049759 Ga0501262_000355 Ga0501262_000355_2437_2817 125
435 3300050489 nmdc:mga03683_22114_c1 nmdc:mga03683_22114_c1_1617_1997 125
436 3300050489 nmdc:mga03683_23539_c1 nmdc:mga03683_23539_c1_812_1192 125
437 3300050489 nmdc:mga03683_64856_c1 nmdc:mga03683_64856_c1_229_609 125
438 3300050490 nmdc:mga03n38_145570_c1 nmdc:mga03n38_145570_c1_542_922 125
439 3300050490 nmdc:mga03n38_153649_c1 nmdc:mga03n38_153649_c1_189_569 125
440 3300050490 nmdc:mga03n38_55134_c1 nmdc:mga03n38_55134_c1_963_1343 125
441 3300050491 nmdc:mga00v17_44307_c1 nmdc:mga00v17_44307_c1_2151_2531 125
442 3300050491 nmdc:mga00v17_517219_c1 nmdc:mga00v17_517219_c1_296_676 125
443 3300050491 nmdc:mga00v17_978_c1 nmdc:mga00v17_978_c1_1443_1826 125
444 3300050492 nmdc:mga0yw44_185578_c1 nmdc:mga0yw44_185578_c1_160_540 125
445 3300050492 nmdc:mga0yw44_71309_c1 nmdc:mga0yw44_71309_c1_724_1104 125
446 3300050493 nmdc:mga0k408_50879_c1 nmdc:mga0k408_50879_c1_779_1159 125
447 3300050494 nmdc:mga06z11_73906_c1 nmdc:mga06z11_73906_c1_733_1113 125
448 3300050496 nmdc:mga07m45_488_c1 nmdc:mga07m45_488_c1_4916_5296 125
449 3300050496 nmdc:mga07m45_84669_c1 nmdc:mga07m45_84669_c1_105_485 125
450 3300050516 nmdc:mga0sz30_62240_c1 nmdc:mga0sz30_62240_c1_265_645 125
451 3300053079 Ga0500610_0004702 Ga0500610_0004702_4179_4559 125
452 3300053093 Ga0500651_0000052 Ga0500651_0000052_36649_37029 125
453 3300053094 Ga0500566_0291107 Ga0500566_0291107_140_520 125
454 3300053107 Ga0500560_052353 Ga0500560_052353_458_838 125
455 3300053108 Ga0500562_179051 Ga0500562_179051_24_404 125
456 3300053110 Ga0500571_000118 Ga0500571_000118_3557_3937 125
457 3300053116 Ga0500592_008047 Ga0500592_008047_465_845 125
458 3300053117 Ga0500593_000306 Ga0500593_000306_1377_1757 125
459 3300053118 Ga0500594_0001446 Ga0500594_0001446_2833_3213 125
460 3300053121 Ga0500607_001189 Ga0500607_001189_20307_20687 125
461 3300053122 Ga0500608_005072 Ga0500608_005072_3354_3734 125
462 3300053133 Ga0500655_000281 Ga0500655_000281_3866_4246 125
463 3300053134 Ga0500658_0000033 Ga0500658_0000033_69483_69863 125
464 3300053134 Ga0500658_0000040 Ga0500658_0000040_27464_27844 125
465 3300053136 Ga0500559_0019480 Ga0500559_0019480_2282_2662 125
466 3300053138 Ga0500564_098966 Ga0500564_098966_326_706 125
467 3300053139 Ga0500568_0008134 Ga0500568_0008134_2883_3263 125
468 3300053141 Ga0500574_000532 Ga0500574_000532_2905_3285 125
469 3300053153 Ga0500616_0050524 Ga0500616_0050524_779_1159 125
470 3300053158 Ga0500627_0000079 Ga0500627_0000079_32166_32546 125
471 3300053161 Ga0500634_0014576 Ga0500634_0014576_1366_1746 125
472 3300053161 Ga0500634_0047084 Ga0500634_0047084_813_1193 125
473 3300053162 Ga0500638_006107 Ga0500638_006107_1465_1845 125
474 3300053177 Ga0500636_0075606 Ga0500636_0075606_287_667 125
475 iso_pu_bacteria 2939573065 2939574304 125
476 3300009011 Ga0105251_10034433 Ga0105251_100344333 126
477 3300009036 Ga0105244_10005627 Ga0105244_100056272 126
478 3300013102 Ga0157371_10004655 Ga0157371_100046557 126
479 3300013105 Ga0157369_10001379 Ga0157369_1000137921 126
480 3300025728 Ga0207655_1075039 Ga0207655_10750392 126
481 3300042016 Ga0439463_000012 Ga0439463_000012_17627_18007 126
482 3300042993 Ga0439440_0019607 Ga0439440_0019607_156_536 126
483 3300001989 JGI24739J22299_10032598 JGI24739J22299_100325981 127
484 3300002705 JGI25156J39149_1000406 JGI25156J39149_10004069 127
485 3300003320 rootH2_10090600 rootH2_100906001 127
486 3300003758 Ga0055532_1000529 Ga0055532_100052914 127
487 3300003760 Ga0055527_1000291 Ga0055527_10002914 127
488 3300003761 Ga0055535_1000506 Ga0055535_100050615 127
489 3300003762 Ga0055542_1000502 Ga0055542_100050227 127
490 3300003763 Ga0055529_1000495 Ga0055529_100049515 127
491 3300005339 Ga0070660_100001233 Ga0070660_10000123310 127
492 3300005366 Ga0070659_100000055 Ga0070659_10000005583 127
493 3300005455 Ga0070663_100335726 Ga0070663_1003357262 127
494 3300005563 Ga0068855_100686995 Ga0068855_1006869951 127
495 3300005564 Ga0070664_100208222 Ga0070664_1002082222 127
496 3300005616 Ga0068852_100013927 Ga0068852_1000139276 127
497 3300009092 Ga0105250_10000117 Ga0105250_1000011743 127
498 3300009093 Ga0105240_10018272 Ga0105240_100182722 127
499 3300009545 Ga0105237_10097776 Ga0105237_100977763 127
500 3300009551 Ga0105238_10088529 Ga0105238_100885292 127
501 3300010375 Ga0105239_10007284 Ga0105239_1000728410 127
502 3300013100 Ga0157373_10052060 Ga0157373_100520603 127
503 3300013104 Ga0157370_10070692 Ga0157370_100706923 127
504 3300013104 Ga0157370_10210915 Ga0157370_102109152 127
505 3300013105 Ga0157369_10897441 Ga0157369_108974412 127
506 3300013296 Ga0157374_11535429 Ga0157374_115354291 127
507 3300013307 Ga0157372_10783696 Ga0157372_107836961 127
508 3300015261 Ga0182006_1048631 Ga0182006_10486312 127
509 3300015262 Ga0182007_10000583 Ga0182007_1000058320 127
510 3300025225 Ga0209566_100258 Ga0209566_10025811 127
511 3300025228 Ga0209672_100080 Ga0209672_10008015 127
512 3300025229 Ga0209147_100071 Ga0209147_100071195 127
513 3300025229 Ga0209147_100091 Ga0209147_10009153 127
514 3300025242 Ga0209258_100082 Ga0209258_10008215 127
515 3300025254 Ga0209148_1000195 Ga0209148_100019579 127
516 3300025256 Ga0209759_1000236 Ga0209759_100023632 127
517 3300025272 Ga0209455_1000172 Ga0209455_100017279 127
518 3300025273 Ga0209673_1000076 Ga0209673_1000076108 127
519 3300025291 Ga0209675_1033765 Ga0209675_10337652 127
520 3300025295 Ga0209564_1092679 Ga0209564_10926791 127
521 3300025711 Ga0207696_1000170 Ga0207696_100017077 127
522 3300025904 Ga0207647_10001075 Ga0207647_1000107515 127
523 3300025909 Ga0207705_10454097 Ga0207705_104540972 127
524 3300025913 Ga0207695_10000268 Ga0207695_10000268112 127
525 3300025914 Ga0207671_10028223 Ga0207671_100282233 127
526 3300025919 Ga0207657_10000087 Ga0207657_1000008780 127
527 3300025924 Ga0207694_10075553 Ga0207694_100755533 127
528 3300025932 Ga0207690_10000071 Ga0207690_1000007181 127
529 3300025945 Ga0207679_10620183 Ga0207679_106201832 127
530 3300025949 Ga0207667_10058539 Ga0207667_100585393 127
531 3300026142 Ga0207698_10009359 Ga0207698_100093596 127
532 3300027312 Ga0209371_1000713 Ga0209371_100071319 127
533 3300030083 Ga0237817_14244 Ga0237817_142441 127
534 3300030500 Ga0268256_1000608 Ga0268256_100060814 127
535 3300037466 Ga0395898_0209753 Ga0395898_0209753_1158_1541 127
536 3300042011 Ga0439454_067965 Ga0439454_067965_106_537 127
537 3300044693 Ga0466961_0168972 Ga0466961_0168972_403_786 127
538 3300044765 Ga0466970_0084980 Ga0466970_0084980_937_1320 127
539 3300044842 Ga0466957_0072122 Ga0466957_0072122_1450_1833 127
540 3300045049 Ga0466959_0552902 Ga0466959_0552902_160_543 127
541 3300046472 Ga0495580_0002292 Ga0495580_0002292_9067_9450 127
542 3300046474 Ga0495605_0208814 Ga0495605_0208814_443_826 127
543 3300046507 Ga0495606_0000360 Ga0495606_0000360_20279_20665 127
544 3300046524 Ga0495648_0003240 Ga0495648_0003240_5914_6297 127
545 3300047323 Ga0495683_0103674 Ga0495683_0103674_914_1297 127
546 3300048904 Ga0496101_0685048 Ga0496101_0685048_89_472 127
547 3300048905 Ga0496102_1265770 Ga0496102_1265770_143_526 127
548 3300048907 Ga0496104_0884538 Ga0496104_0884538_230_613 127
549 3300048907 Ga0496104_0951144 Ga0496104_0951144_145_528 127
550 3300048919 Ga0496116_0232549 Ga0496116_0232549_519_902 127
551 3300048921 Ga0496118_0035743 Ga0496118_0035743_2923_3306 127
552 3300048921 Ga0496118_0344714 Ga0496118_0344714_243_626 127
553 3300048923 Ga0496120_0410442 Ga0496120_0410442_108_491 127
554 3300048924 Ga0496121_0078267 Ga0496121_0078267_1864_2247 127
555 3300048925 Ga0496122_0040955 Ga0496122_0040955_219_623 127
556 3300048927 Ga0496124_0006343 Ga0496124_0006343_7778_8200 127
557 3300048927 Ga0496124_0047139 Ga0496124_0047139_2944_3348 127
558 3300048928 Ga0496125_0000055 Ga0496125_0000055_94451_94855 127
559 3300048986 Ga0466983_0488659 Ga0466983_0488659_276_659 127
560 3300050509 nmdc:mga0qj67_31033_c1 nmdc:mga0qj67_31033_c1_1466_1852 127
561 3300061719 Ga0466962_0047799 Ga0466962_0047799_1515_1898 127

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00903

Glyoxalase

Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily

18

135

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
3hnq-assembly1.cif.gz_A crystal structure of virulence protein stm3117 from salmonella typhimurium. northeast structural genomics consortium target id str274 0.9594 2 127
3zw5-assembly1.cif.gz_B crystal structure of the human glyoxalase domain-containing protein 5 0.957 4 125
3zw5-assembly1.cif.gz_A crystal structure of the human glyoxalase domain-containing protein 5 0.956 3 125
3hnq-assembly1.cif.gz_A crystal structure of virulence protein stm3117 from salmonella typhimurium. northeast structural genomics consortium target id str274 0.952 2 127
3huh-assembly2.cif.gz_C the structure of biphenyl-2,3-diol 1,2-dioxygenase iii-related protein from salmonella typhimurium 0.9511 3 125
ID Description Score Start End Superfamily
af_A6NK44_39_157_3.10.180.10 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.9681 8 125 3.10.180.10
af_A6NK44_39_157_3.10.180.10 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.9524 8 125 3.10.180.10
2i7rB00 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.7998 6 125 3.10.180.10
3itwA02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.7926 71 127 3.30.720.110
2i7rB00 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.7872 6 125 3.10.180.10
ID Description Score Start End GO Terms
AF-A0A0P9Z811-F1-model_v4 Uncharacterized protein 1.004 67 127
AF-A0A0P9MU27-F1-model_v4 Glyoxalase/bleomycin resistance protein/dioxygenase 1.002 67 125 GO:0051213
AF-A0A741VTR4-F1-model_v4 VOC family protein 0.9907 65 127
AF-A0A2K8W4I0-F1-model_v4 deleted 0.9827 3 127
AF-E0SGR6-F1-model_v4 Glyoxalase/bleomycin resistance protein/dioxygenase 0.9821 2 127 GO:0051213

Feature Viewer

pLDDT pTM Quality
91.9 0.84 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map