F463867
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 561 | 332 | 485 | 126 |
Family's Representative Sequence
| Representative Sequence | 3300048927|Ga0496124_0006343|Ga0496124_0006343_7778_8200 |
| Length | 140 |
| Sequence | MNIHGAYPVWEHRSMIDHLDHIVLTCTDPEATTHFYVDVLRMKKETFRGDRVAFVFGNQKINLHVKGHEFEPKAHLPVPGALDLCFMASIPLDEVIAHLNASMWPIVEGPVERTGATQKIRSVYVRDPDLNLIEISEPIV |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2501025501 | Paraburkholderia silvatlantica PVA5 | Isolate | Unclassified |
| 2 | 2501025502 | Paraburkholderia unamae MTI-641 | Isolate | Rhizosphere |
| 3 | 2501025504 | Paraburkholderia silvatlantica SRMrh-20 | Isolate | Unclassified |
| 4 | 2510065053 | Pseudomonas sp. MOIL14HWK12:I1 | Isolate | Rhizosphere |
| 5 | 2510065055 | Pseudomonas sp. MOIL14HWK12:I2 | Isolate | Rhizosphere |
| 6 | 2510065058 | Pseudomonas oleovorans MOIL14HWK12 | Isolate | Rhizosphere |
| 7 | 2510917013 | Paraburkholderia unamae MTI-641 | Isolate | Rhizosphere |
| 8 | 2510917014 | Paraburkholderia silvatlantica SRMrh-20 | Isolate | Unclassified |
| 9 | 2510917015 | Paraburkholderia silvatlantica PVA5 | Isolate | Unclassified |
| 10 | 2513237150 | Cupriavidus taiwanensis STM6018 | Isolate | Nodule |
| 11 | 2515154189 | Paraburkholderia nodosa DSM 21604 | Isolate | Unclassified |
| 12 | 2562617112 | Burkholderia sp. BT03 | Isolate | Rhizosphere |
| 13 | 2599185185 | Pseudomonas sp. NFPP07 | Isolate | Rhizoplane |
| 14 | 2599185214 | Variovorax sp. NFACC26 | Isolate | Rhizoplane |
| 15 | 2599185226 | Variovorax sp. NFACC27 | Isolate | Rhizoplane |
| 16 | 2599185227 | Variovorax sp. NFACC28 | Isolate | Rhizoplane |
| 17 | 2599185229 | Variovorax sp. NFACC29 | Isolate | Endosphere |
| 18 | 2599185239 | Burkholderia sp. NFACC38-1 | Isolate | Rhizoplane |
| 19 | 2599185240 | Burkholderia sp. NFPP32 | Isolate | Rhizoplane |
| 20 | 2599185355 | Burkholderia sp. NFACC33-1 | Isolate | Rhizoplane |
| 21 | 2643221628 | Variovorax sp. Root318D1 | Isolate | Unclassified |
| 22 | 2643221658 | Variovorax sp. Root411 | Isolate | Unclassified |
| 23 | 2675903129 | Burkholderia pyrrocinia NFIX32 | Isolate | Rhizoplane |
| 24 | 2711768613 | Burkholderia sp. BT03 | Isolate | Rhizosphere |
| 25 | 2721755763 | Pandoraea thiooxydans ATSB16 | Isolate | Rhizosphere |
| 26 | 2765235841 | Pseudomonas putida AA7 | Isolate | Unclassified |
| 27 | 2773857672 | Pseudomonas sp. 1766 | Isolate | Unclassified |
| 28 | 2791355137 | Paraburkholderia piptadeniae STM7183 | Isolate | Unclassified |
| 29 | 2808606384 | Burkholderia sp. SJZ089 | Isolate | Rhizosphere |
| 30 | 2808606390 | Burkholderia sp. SJZ115 | Isolate | Rhizosphere |
| 31 | 2808606391 | Burkholderia sp. SJZ091 | Isolate | Rhizosphere |
| 32 | 2818991446 | Variovorax sp. 1180 | Isolate | Unclassified |
| 33 | 2818991452 | Burkholderia cepacia 561 | Isolate | Unclassified |
| 34 | 2831265667 | Variovorax guangxiensis DSM 27352 | Isolate | Rhizosphere |
| 35 | 2842914999 | Luteibacter sp. R-72151 | Isolate | Unclassified |
| 36 | 2856287931 | Paraburkholderia bannensis BE22 | Isolate | Rhizosphere |
| 37 | 2857357740 | Paraburkholderia tropica BE15 | Isolate | Rhizosphere |
| 38 | 2863421361 | Burkholderia cenocepacia CACua-24 | Isolate | Rhizosphere |
| 39 | 2870068957 | Burkholderia sp. JP2-270 | Isolate | Unclassified |
| 40 | 2883087390 | Paraburkholderia guartelaensis CNPSo 3008 | Isolate | Unclassified |
| 41 | 2885198086 | Variovorax sp. 679 | Isolate | Unclassified |
| 42 | 2885211737 | Variovorax sp. 553 | Isolate | Unclassified |
| 43 | 2904449895 | Variovorax sp. 1763 | Isolate | Rhizosphere |
| 44 | 2904456579 | Variovorax sp. 2002 | Isolate | Unclassified |
| 45 | 2904564687 | Burkholderia sp. 571 | Isolate | Unclassified |
| 46 | 2904571731 | Burkholderia cenocepacia 574 | Isolate | Unclassified |
| 47 | 2928037797 | Variovorax sp. 1126 | Isolate | Unclassified |
| 48 | 2928044640 | Variovorax sp. 1128 | Isolate | Unclassified |
| 49 | 2928051484 | Variovorax sp. 1133 | Isolate | Unclassified |
| 50 | 2928064002 | Variovorax sp. 1140 | Isolate | Rhizosphere |
| 51 | 2928070936 | Variovorax gossypii 1167 | Isolate | Unclassified |
| 52 | 2928084124 | Variovorax paradoxus 1218 | Isolate | Unclassified |
| 53 | 2928157003 | Burkholderia ambifaria 566 | Isolate | Unclassified |
| 54 | 2928163908 | Burkholderia sp. 567 | Isolate | Unclassified |
| 55 | 2928170801 | Burkholderia sp. 572 | Isolate | Unclassified |
| 56 | 2928536128 | Burkholderia sola 565 | Isolate | Unclassified |
| 57 | 2929520902 | Variovorax beijingensis 502 | Isolate | Unclassified |
| 58 | 2939573065 | Citrobacter sp. 506 | Isolate | Rhizosphere |
| 59 | 2945909444 | Variovorax sp. CRF3-Va-1 W1I1 | Isolate | Rhizosphere |
| 60 | 2945972063 | Variovorax paradoxus W2I8 | Isolate | Rhizosphere |
| 61 | 2945984333 | Variovorax sp. W2I14 | Isolate | Rhizosphere |
| 62 | 2954767861 | Variovorax sp. TBS-050B | Isolate | Rhizosphere |
| 63 | 2974298342 | Pseudomonas sp. SORGH_AS 211 | Isolate | Unclassified |
| 64 | 2981990288 | Burkholderia sp. PvR073 | Isolate | Rhizosphere |
| 65 | 2984499530 | Pseudomonas sp. SORGH_AS199 | Isolate | Aerial Root |
| 66 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 67 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 68 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 69 | 3300003578 | Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Unclassified |
| 70 | 3300003758 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 | Metagenome | Endosphere |
| 71 | 3300003760 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 | Metagenome | Endosphere |
| 72 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 73 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 74 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 75 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 76 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 77 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 78 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 79 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 80 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 81 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 82 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 83 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 84 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 85 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 86 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 87 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 88 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 89 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 90 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 91 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 92 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 93 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 94 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 95 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 96 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 97 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 98 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 99 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 100 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 101 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 102 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 103 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 104 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 105 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 106 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 107 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 109 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 111 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 112 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 113 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 114 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 115 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 116 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 117 | 3300012502 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610 | Metagenome | Rhizosphere |
| 118 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 126 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 127 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 128 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 129 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 130 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 131 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 132 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 133 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 134 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 135 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 136 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 137 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 138 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 139 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 140 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 141 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 142 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 143 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 144 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 145 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 146 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 147 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 148 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 171 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 174 | 3300030083 | Coralloid root microbial communities from Jiquipilas, Chiapas, Mexico - JPPOOL-T1 | Metagenome | Unclassified |
| 175 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 176 | 3300030731 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 | Metagenome | Rhizosphere |
| 177 | 3300030733 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 | Metagenome | Rhizosphere |
| 178 | 3300030742 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 | Metagenome | Rhizosphere |
| 179 | 3300030744 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 | Metagenome | Rhizosphere |
| 180 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 181 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 182 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 183 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 184 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 185 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 186 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 187 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 188 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 189 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 190 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 191 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 192 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 193 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 194 | 3300042002 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 | Metagenome | Rhizosphere |
| 195 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 196 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 197 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 198 | 3300042011 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 | Metagenome | Rhizosphere |
| 199 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 200 | 3300042016 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 | Metagenome | Rhizosphere |
| 201 | 3300042121 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 | Metagenome | Rhizosphere |
| 202 | 3300042125 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 | Metagenome | Rhizosphere |
| 203 | 3300042134 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 | Metagenome | Rhizosphere |
| 204 | 3300042135 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 | Metagenome | Rhizosphere |
| 205 | 3300042145 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 | Metagenome | Rhizosphere |
| 206 | 3300042146 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 | Metagenome | Rhizosphere |
| 207 | 3300042147 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 | Metagenome | Rhizosphere |
| 208 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 209 | 3300042184 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 | Metagenome | Rhizosphere |
| 210 | 3300042185 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 | Metagenome | Rhizosphere |
| 211 | 3300042532 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 | Metagenome | Rhizosphere |
| 212 | 3300042993 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 | Metagenome | Rhizosphere |
| 213 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 214 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 215 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 216 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 217 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 271 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 272 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 273 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 274 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 275 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 276 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 277 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 278 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 279 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 280 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 281 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 282 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 283 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 284 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 285 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 286 | 3300048986 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1E | Metagenome | Unclassified |
| 287 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 290 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 291 | 3300049758 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought | Metagenome | Rhizosphere |
| 292 | 3300049759 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought | Metagenome | Rhizosphere |
| 293 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 294 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 295 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 296 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 297 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 298 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 299 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 300 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 301 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 302 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 303 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 304 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 305 | 3300053107 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere | Metagenome | Endosphere |
| 306 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 307 | 3300053110 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 endosphere | Metagenome | Endosphere |
| 308 | 3300053116 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere | Metagenome | Endosphere |
| 309 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 310 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 311 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 312 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 313 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 314 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 315 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 316 | 3300053138 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere | Metagenome | Endosphere |
| 317 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 318 | 3300053141 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere | Metagenome | Endosphere |
| 319 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 320 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 321 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 322 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 323 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 324 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 325 | 641736154 | Burkholderia ambifaria IOP40-10 | Isolate | Rhizosphere |
| 326 | 644736347 | Cupriavidus taiwanensis LMG 19424 | Isolate | Nodule |
| 327 | 8020938398 | Burkholderia sp. BE12 | Isolate | Rhizosphere |
| 328 | 8020945358 | Burkholderia sp. BE17 | Isolate | Rhizosphere |
| 329 | 8020953355 | Burkholderia sp. BE24 | Isolate | Rhizosphere |
| 330 | 8021120328 | Burkholderia sp. LS-044 | Isolate | Rhizosphere |
| 331 | 8039098773 | Burkholderia multivorans MSMB612WGS | Isolate | Unclassified |
| 332 | 8054929484 | Pseudomonas vlassakiae RW4S1 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 86.27 |
| Metatranscriptomes | 0.18 |
| Isolates | 13.55 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.18 |
| Bulb | 0 |
| Endosphere | 19.79 |
| Nodule | 0.71 |
| Rhizoplane | 3.03 |
| Rhizosphere | 63.81 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 12.48 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24739J22299_10032598 | 3300001989 | Bacteria | 1791 |
| 2 | JGI25156J39149_1000406 | 3300002705 | Bacteria | 26975 |
| 3 | rootH2_10090600 | 3300003320 | Bacteria | 1133 |
| 4 | Ga0006562J51391_1069169 | 3300003578 | Bacteria | 800 |
| 5 | Ga0055532_1000529 | 3300003758 | Bacteria | 16669 |
| 6 | Ga0055532_1024655 | 3300003758 | Bacteria | 598 |
| 7 | Ga0055527_1000291 | 3300003760 | Bacteria | 29060 |
| 8 | Ga0055527_1017507 | 3300003760 | Bacteria | 768 |
| 9 | Ga0055535_1000215 | 3300003761 | Bacteria | 61211 |
| 10 | Ga0055535_1000506 | 3300003761 | Bacteria | 34557 |
| 11 | Ga0055542_1000004 | 3300003762 | Bacteria | 553532 |
| 12 | Ga0055542_1000502 | 3300003762 | Bacteria | 35790 |
| 13 | Ga0055529_1000495 | 3300003763 | Bacteria | 35799 |
| 14 | Ga0055536_1000532 | 3300003781 | Bacteria | 26166 |
| 15 | Ga0055536_1006662 | 3300003781 | Bacteria | 5320 |
| 16 | Ga0055536_1011569 | 3300003781 | Bacteria | 3365 |
| 17 | Ga0055534_1000024 | 3300003784 | Bacteria | 131674 |
| 18 | Ga0055534_1011908 | 3300003784 | Bacteria | 1745 |
| 19 | Ga0055528_1001110 | 3300003790 | Bacteria | 17660 |
| 20 | Ga0055530_10000502 | 3300003791 | Bacteria | 33938 |
| 21 | Ga0055530_10005458 | 3300003791 | Bacteria | 6033 |
| 22 | Ga0055540_1004114 | 3300003792 | Bacteria | 6728 |
| 23 | Ga0055540_1005189 | 3300003792 | Bacteria | 5588 |
| 24 | Ga0055540_1005483 | 3300003792 | Bacteria | 5320 |
| 25 | Ga0055531_10000983 | 3300003794 | Bacteria | 22683 |
| 26 | Ga0055531_10008665 | 3300003794 | Bacteria | 5320 |
| 27 | Ga0055531_10053606 | 3300003794 | Bacteria | 1040 |
| 28 | Ga0065704_10076870 | 3300005289 | Bacteria | 4945 |
| 29 | Ga0068869_100694438 | 3300005334 | Bacteria | 867 |
| 30 | Ga0070660_100001233 | 3300005339 | Bacteria | 17366 |
| 31 | Ga0070659_100000055 | 3300005366 | Bacteria | 88573 |
| 32 | Ga0070700_100216837 | 3300005441 | Bacteria | 1353 |
| 33 | Ga0070663_100335726 | 3300005455 | Bacteria | 1219 |
| 34 | Ga0070662_100051555 | 3300005457 | Bacteria | 2972 |
| 35 | Ga0068853_100491687 | 3300005539 | Bacteria | 1157 |
| 36 | Ga0070686_100653966 | 3300005544 | Bacteria | 834 |
| 37 | Ga0070695_100116339 | 3300005545 | Bacteria | 1823 |
| 38 | Ga0070695_100339818 | 3300005545 | Bacteria | 1122 |
| 39 | Ga0070665_102404286 | 3300005548 | Bacteria | 529 |
| 40 | Ga0068855_100001016 | 3300005563 | Bacteria | 34948 |
| 41 | Ga0068855_100686995 | 3300005563 | Bacteria | 1096 |
| 42 | Ga0070664_100208222 | 3300005564 | Bacteria | 1747 |
| 43 | Ga0070664_100458663 | 3300005564 | Bacteria | 1171 |
| 44 | Ga0068857_100343154 | 3300005577 | Bacteria | 1382 |
| 45 | Ga0068852_100013927 | 3300005616 | Bacteria | 6168 |
| 46 | Ga0068852_100046537 | 3300005616 | Bacteria | 3697 |
| 47 | Ga0075365_10036928 | 3300006038 | Bacteria | 3169 |
| 48 | Ga0075363_100066376 | 3300006048 | Bacteria | 1953 |
| 49 | Ga0075363_100137151 | 3300006048 | Bacteria | 1375 |
| 50 | Ga0075364_10052783 | 3300006051 | Bacteria | 2657 |
| 51 | Ga0075364_10415919 | 3300006051 | Bacteria | 918 |
| 52 | Ga0075432_10110808 | 3300006058 | Bacteria | 1022 |
| 53 | Ga0075362_10005546 | 3300006177 | Bacteria | 4629 |
| 54 | Ga0075367_10060239 | 3300006178 | Bacteria | 2263 |
| 55 | Ga0075369_10117873 | 3300006186 | Bacteria | 1200 |
| 56 | Ga0075366_10018935 | 3300006195 | Bacteria | 3979 |
| 57 | Ga0075366_10438519 | 3300006195 | Bacteria | 805 |
| 58 | Ga0075370_10001129 | 3300006353 | Bacteria | 11193 |
| 59 | Ga0075370_10001606 | 3300006353 | Bacteria | 9973 |
| 60 | Ga0075370_10244375 | 3300006353 | Bacteria | 1063 |
| 61 | Ga0075430_100058327 | 3300006846 | Bacteria | 3245 |
| 62 | Ga0079104_1027975 | 3300006946 | Bacteria | 1438 |
| 63 | Ga0105251_10034433 | 3300009011 | Bacteria | 2507 |
| 64 | Ga0105251_10129851 | 3300009011 | Bacteria | 1142 |
| 65 | Ga0105244_10005627 | 3300009036 | Bacteria | 8277 |
| 66 | Ga0105244_10006016 | 3300009036 | Bacteria | 7948 |
| 67 | Ga0105244_10242859 | 3300009036 | Bacteria | 841 |
| 68 | Ga0105250_10000117 | 3300009092 | Bacteria | 71574 |
| 69 | Ga0105240_10007671 | 3300009093 | Bacteria | 15623 |
| 70 | Ga0105240_10018272 | 3300009093 | Bacteria | 9425 |
| 71 | Ga0105243_10002802 | 3300009148 | Bacteria | 14476 |
| 72 | Ga0105243_10202552 | 3300009148 | Bacteria | 1742 |
| 73 | Ga0105243_10577967 | 3300009148 | Bacteria | 1078 |
| 74 | Ga0105242_11060362 | 3300009176 | Bacteria | 822 |
| 75 | Ga0105237_10097776 | 3300009545 | Bacteria | 2926 |
| 76 | Ga0105237_11028572 | 3300009545 | Bacteria | 831 |
| 77 | Ga0105238_10088529 | 3300009551 | Bacteria | 3082 |
| 78 | Ga0105239_10007284 | 3300010375 | Bacteria | 12699 |
| 79 | Ga0105239_10028949 | 3300010375 | Bacteria | 6089 |
| 80 | Ga0105239_11328507 | 3300010375 | Bacteria | 829 |
| 81 | Ga0105246_10088164 | 3300011119 | Bacteria | 2228 |
| 82 | Ga0105246_10265379 | 3300011119 | Bacteria | 1370 |
| 83 | Ga0157347_1019701 | 3300012502 | Bacteria | 781 |
| 84 | Ga0157373_10052060 | 3300013100 | Bacteria | 2914 |
| 85 | Ga0157371_10004655 | 3300013102 | Bacteria | 11878 |
| 86 | Ga0157371_10019307 | 3300013102 | Bacteria | 5028 |
| 87 | Ga0157370_10000372 | 3300013104 | Bacteria | 56499 |
| 88 | Ga0157370_10070692 | 3300013104 | Bacteria | 3294 |
| 89 | Ga0157370_10123118 | 3300013104 | Bacteria | 2421 |
| 90 | Ga0157370_10210915 | 3300013104 | Bacteria | 1800 |
| 91 | Ga0157370_11552258 | 3300013104 | Bacteria | 595 |
| 92 | Ga0157369_10001379 | 3300013105 | Bacteria | 29905 |
| 93 | Ga0157369_10255698 | 3300013105 | Bacteria | 1827 |
| 94 | Ga0157369_10897441 | 3300013105 | Bacteria | 909 |
| 95 | Ga0157374_11535429 | 3300013296 | Bacteria | 689 |
| 96 | Ga0157372_10783696 | 3300013307 | Bacteria | 1108 |
| 97 | Ga0157380_10451895 | 3300014326 | Bacteria | 1234 |
| 98 | Ga0182008_10001492 | 3300014497 | Bacteria | 15633 |
| 99 | Ga0182008_10023787 | 3300014497 | Bacteria | 3123 |
| 100 | Ga0182006_1001173 | 3300015261 | Bacteria | 16469 |
| 101 | Ga0182006_1048631 | 3300015261 | Bacteria | 1639 |
| 102 | Ga0182006_1160007 | 3300015261 | Bacteria | 759 |
| 103 | Ga0182007_10000583 | 3300015262 | Bacteria | 21488 |
| 104 | Ga0182007_10000924 | 3300015262 | Bacteria | 16214 |
| 105 | Ga0182005_1064955 | 3300015265 | Bacteria | 998 |
| 106 | Ga0163161_10000463 | 3300017792 | Bacteria | 33681 |
| 107 | Ga0163161_10010048 | 3300017792 | Bacteria | 6553 |
| 108 | Ga0209566_100258 | 3300025225 | Bacteria | 50542 |
| 109 | Ga0209672_100080 | 3300025228 | Bacteria | 143481 |
| 110 | Ga0209672_108431 | 3300025228 | Bacteria | 1526 |
| 111 | Ga0209147_100071 | 3300025229 | Bacteria | 215861 |
| 112 | Ga0209147_100091 | 3300025229 | Bacteria | 168353 |
| 113 | Ga0209147_102312 | 3300025229 | Bacteria | 4915 |
| 114 | Ga0209258_100022 | 3300025242 | Bacteria | 553584 |
| 115 | Ga0209258_100082 | 3300025242 | Bacteria | 247739 |
| 116 | Ga0207425_1010775 | 3300025245 | Bacteria | 2211 |
| 117 | Ga0209148_1000034 | 3300025254 | Bacteria | 553584 |
| 118 | Ga0209148_1000195 | 3300025254 | Bacteria | 109654 |
| 119 | Ga0209759_1000236 | 3300025256 | Bacteria | 82430 |
| 120 | Ga0209565_1000040 | 3300025263 | Bacteria | 266543 |
| 121 | Ga0209455_1000172 | 3300025272 | Bacteria | 109654 |
| 122 | Ga0209673_1000076 | 3300025273 | Bacteria | 230907 |
| 123 | Ga0209673_1000109 | 3300025273 | Bacteria | 183000 |
| 124 | Ga0209673_1048682 | 3300025273 | Bacteria | 1139 |
| 125 | Ga0209675_1000024 | 3300025291 | Bacteria | 312615 |
| 126 | Ga0209675_1033765 | 3300025291 | Bacteria | 1182 |
| 127 | Ga0209676_1000005 | 3300025292 | Bacteria | 1076001 |
| 128 | Ga0209676_1000478 | 3300025292 | Bacteria | 65984 |
| 129 | Ga0209676_1044454 | 3300025292 | Bacteria | 1218 |
| 130 | Ga0209676_1061001 | 3300025292 | Bacteria | 939 |
| 131 | Ga0209025_1007853 | 3300025294 | Bacteria | 7832 |
| 132 | Ga0209564_1092679 | 3300025295 | Bacteria | 548 |
| 133 | Ga0209050_1000007 | 3300025298 | Bacteria | 1187891 |
| 134 | Ga0209050_1000146 | 3300025298 | Bacteria | 166930 |
| 135 | Ga0209050_1031392 | 3300025298 | Bacteria | 1656 |
| 136 | Ga0207426_1149324 | 3300025302 | Bacteria | 547 |
| 137 | Ga0209051_1000009 | 3300025303 | Bacteria | 706778 |
| 138 | Ga0209051_1000092 | 3300025303 | Bacteria | 170056 |
| 139 | Ga0209051_1000598 | 3300025303 | Bacteria | 42554 |
| 140 | Ga0209257_1000011 | 3300025304 | Bacteria | 1112630 |
| 141 | Ga0209257_1000576 | 3300025304 | Bacteria | 61751 |
| 142 | Ga0209257_1004039 | 3300025304 | Bacteria | 11796 |
| 143 | Ga0207696_1000170 | 3300025711 | Bacteria | 102852 |
| 144 | Ga0207655_1005449 | 3300025728 | Bacteria | 8647 |
| 145 | Ga0207655_1008571 | 3300025728 | Bacteria | 6471 |
| 146 | Ga0207655_1075039 | 3300025728 | Bacteria | 1242 |
| 147 | Ga0207713_1000366 | 3300025735 | Bacteria | 49069 |
| 148 | Ga0207713_1146222 | 3300025735 | Bacteria | 767 |
| 149 | Ga0207647_10001075 | 3300025904 | Bacteria | 21061 |
| 150 | Ga0207705_10454097 | 3300025909 | Bacteria | 994 |
| 151 | Ga0207695_10000268 | 3300025913 | Bacteria | 130752 |
| 152 | Ga0207695_10021004 | 3300025913 | Bacteria | 7457 |
| 153 | Ga0207671_10028223 | 3300025914 | Bacteria | 4195 |
| 154 | Ga0207671_10065539 | 3300025914 | Bacteria | 2702 |
| 155 | Ga0207671_11482307 | 3300025914 | Bacteria | 524 |
| 156 | Ga0207657_10000087 | 3300025919 | Bacteria | 88335 |
| 157 | Ga0207694_10075553 | 3300025924 | Bacteria | 2637 |
| 158 | Ga0207650_10073315 | 3300025925 | Bacteria | 2578 |
| 159 | Ga0207690_10000071 | 3300025932 | Bacteria | 88665 |
| 160 | Ga0207706_10015493 | 3300025933 | Bacteria | 6889 |
| 161 | Ga0207706_10467588 | 3300025933 | Bacteria | 1090 |
| 162 | Ga0207709_10000233 | 3300025935 | Bacteria | 70451 |
| 163 | Ga0207709_10000813 | 3300025935 | Bacteria | 24175 |
| 164 | Ga0207709_10010216 | 3300025935 | Bacteria | 5170 |
| 165 | Ga0207670_10703795 | 3300025936 | Bacteria | 836 |
| 166 | Ga0207711_10056667 | 3300025941 | Bacteria | 3368 |
| 167 | Ga0207679_10426340 | 3300025945 | Bacteria | 1172 |
| 168 | Ga0207679_10620183 | 3300025945 | Bacteria | 976 |
| 169 | Ga0207667_10000040 | 3300025949 | Bacteria | 275827 |
| 170 | Ga0207667_10058539 | 3300025949 | Bacteria | 4040 |
| 171 | Ga0207667_10214911 | 3300025949 | Bacteria | 1970 |
| 172 | Ga0207639_10074372 | 3300026041 | Bacteria | 2668 |
| 173 | Ga0207708_10095980 | 3300026075 | Bacteria | 2290 |
| 174 | Ga0207702_10387413 | 3300026078 | Bacteria | 1345 |
| 175 | Ga0207674_10067087 | 3300026116 | Bacteria | 3613 |
| 176 | Ga0207698_10009359 | 3300026142 | Bacteria | 6244 |
| 177 | Ga0207698_10995973 | 3300026142 | Bacteria | 849 |
| 178 | Ga0209281_1020575 | 3300027111 | Bacteria | 1287 |
| 179 | Ga0209371_1000713 | 3300027312 | Bacteria | 28089 |
| 180 | Ga0268264_10175879 | 3300028381 | Unclassified | 1940 |
| 181 | Ga0265338_10000191 | 3300028800 | Bacteria | 115408 |
| 182 | Ga0237817_14244 | 3300030083 | Bacteria | 546 |
| 183 | Ga0268256_1000608 | 3300030500 | Bacteria | 28089 |
| 184 | Ga0316177_1015375 | 3300030731 | Bacteria | 873 |
| 185 | Ga0314311_1224032 | 3300030733 | Bacteria | 2939 |
| 186 | Ga0316183_1118103 | 3300030742 | Bacteria | 2320 |
| 187 | Ga0316181_1001035 | 3300030744 | Bacteria | 871 |
| 188 | Ga0316181_1255510 | 3300030744 | Bacteria | 1271 |
| 189 | Ga0265340_10069789 | 3300031247 | Bacteria | 1667 |
| 190 | Ga0307408_100026404 | 3300031548 | Bacteria | 3989 |
| 191 | Ga0307408_100060441 | 3300031548 | Bacteria | 2762 |
| 192 | Ga0307408_100291317 | 3300031548 | Bacteria | 1363 |
| 193 | Ga0307408_100393226 | 3300031548 | Bacteria | 1188 |
| 194 | Ga0307408_100471126 | 3300031548 | Bacteria | 1093 |
| 195 | Ga0307408_100683966 | 3300031548 | Bacteria | 920 |
| 196 | Ga0307408_100848614 | 3300031548 | Bacteria | 832 |
| 197 | Ga0307514_10034964 | 3300031649 | Bacteria | 4002 |
| 198 | Ga0307405_10014618 | 3300031731 | Bacteria | 4227 |
| 199 | Ga0307405_10025215 | 3300031731 | Bacteria | 3409 |
| 200 | Ga0307405_10114750 | 3300031731 | Bacteria | 1831 |
| 201 | Ga0307405_11719944 | 3300031731 | Bacteria | 556 |
| 202 | Ga0307413_10408734 | 3300031824 | Bacteria | 1066 |
| 203 | Ga0307406_10000519 | 3300031901 | Bacteria | 22118 |
| 204 | Ga0307406_10301505 | 3300031901 | Bacteria | 1231 |
| 205 | Ga0307406_10847918 | 3300031901 | Bacteria | 774 |
| 206 | Ga0307406_11948251 | 3300031901 | Bacteria | 524 |
| 207 | Ga0307412_10003407 | 3300031911 | Bacteria | 8831 |
| 208 | Ga0307412_10023191 | 3300031911 | Bacteria | 3815 |
| 209 | Ga0307412_10143792 | 3300031911 | Bacteria | 1750 |
| 210 | Ga0307412_10370971 | 3300031911 | Bacteria | 1155 |
| 211 | Ga0307412_11195905 | 3300031911 | Bacteria | 680 |
| 212 | Ga0307412_11890962 | 3300031911 | Bacteria | 550 |
| 213 | Ga0307416_100289303 | 3300032002 | Bacteria | 1621 |
| 214 | Ga0307416_100402699 | 3300032002 | Bacteria | 1406 |
| 215 | Ga0307416_101967494 | 3300032002 | Bacteria | 687 |
| 216 | Ga0307416_102691274 | 3300032002 | Bacteria | 594 |
| 217 | Ga0307414_10004871 | 3300032004 | Bacteria | 7334 |
| 218 | Ga0307414_10078007 | 3300032004 | Bacteria | 2413 |
| 219 | Ga0307414_10205866 | 3300032004 | Bacteria | 1604 |
| 220 | Ga0307414_10493591 | 3300032004 | Bacteria | 1082 |
| 221 | Ga0307414_12323245 | 3300032004 | Bacteria | 501 |
| 222 | Ga0307411_10127515 | 3300032005 | Bacteria | 1853 |
| 223 | Ga0307411_10445228 | 3300032005 | Bacteria | 1082 |
| 224 | Ga0307411_10969389 | 3300032005 | Bacteria | 759 |
| 225 | Ga0307510_10089335 | 3300033180 | Bacteria | 2934 |
| 226 | Ga0395898_0209753 | 3300037466 | Bacteria | 1858 |
| 227 | Ga0439436_0001827 | 3300041404 | Bacteria | 6272 |
| 228 | Ga0439466_0049950 | 3300041411 | Bacteria | 1372 |
| 229 | Ga0439442_030159 | 3300042002 | Bacteria | 1132 |
| 230 | Ga0439442_046508 | 3300042002 | Bacteria | 914 |
| 231 | Ga0439432_001720 | 3300042006 | Bacteria | 8193 |
| 232 | Ga0439449_0013591 | 3300042007 | Bacteria | 3063 |
| 233 | Ga0439452_023182 | 3300042010 | Bacteria | 1599 |
| 234 | Ga0439454_067965 | 3300042011 | Bacteria | 628 |
| 235 | Ga0439462_0001315 | 3300042015 | Bacteria | 5469 |
| 236 | Ga0439463_000012 | 3300042016 | Bacteria | 37568 |
| 237 | Ga0439463_000222 | 3300042016 | Bacteria | 15649 |
| 238 | Ga0450919_008504 | 3300042121 | Bacteria | 1186 |
| 239 | Ga0450923_041812 | 3300042125 | Bacteria | 965 |
| 240 | Ga0450898_040524 | 3300042134 | Bacteria | 880 |
| 241 | Ga0450899_032795 | 3300042135 | Bacteria | 635 |
| 242 | Ga0450906_042136 | 3300042145 | Bacteria | 806 |
| 243 | Ga0450907_044396 | 3300042146 | Bacteria | 762 |
| 244 | Ga0450910_000794 | 3300042147 | Bacteria | 3805 |
| 245 | Ga0439446_0111104 | 3300042156 | Bacteria | 874 |
| 246 | Ga0450908_031759 | 3300042184 | Bacteria | 917 |
| 247 | Ga0450909_008810 | 3300042185 | Bacteria | 1469 |
| 248 | Ga0450893_0008581 | 3300042532 | Bacteria | 1664 |
| 249 | Ga0439440_0019607 | 3300042993 | Bacteria | 1510 |
| 250 | Ga0466961_0168972 | 3300044693 | Bacteria | 1360 |
| 251 | Ga0466970_0084980 | 3300044765 | Bacteria | 1714 |
| 252 | Ga0466957_0072122 | 3300044842 | Bacteria | 2137 |
| 253 | Ga0466959_0552902 | 3300045049 | Bacteria | 776 |
| 254 | Ga0495617_082426 | 3300046452 | Bacteria | 1053 |
| 255 | Ga0495627_006765 | 3300046453 | Bacteria | 4460 |
| 256 | Ga0495627_031761 | 3300046453 | Bacteria | 1665 |
| 257 | Ga0495590_0097735 | 3300046457 | Bacteria | 1042 |
| 258 | Ga0495591_000009 | 3300046458 | Bacteria | 331626 |
| 259 | Ga0495591_000137 | 3300046458 | Bacteria | 79532 |
| 260 | Ga0495591_001356 | 3300046458 | Bacteria | 15361 |
| 261 | Ga0495591_002627 | 3300046458 | Bacteria | 9852 |
| 262 | Ga0495591_018493 | 3300046458 | Bacteria | 2361 |
| 263 | Ga0495629_0340940 | 3300046459 | Bacteria | 1023 |
| 264 | Ga0495629_0469847 | 3300046459 | Bacteria | 850 |
| 265 | Ga0495638_0009525 | 3300046460 | Bacteria | 6810 |
| 266 | Ga0495650_0018878 | 3300046471 | Bacteria | 3414 |
| 267 | Ga0495580_0002292 | 3300046472 | Bacteria | 16704 |
| 268 | Ga0495605_0000007 | 3300046474 | Bacteria | 358289 |
| 269 | Ga0495605_0000075 | 3300046474 | Bacteria | 128702 |
| 270 | Ga0495605_0000404 | 3300046474 | Bacteria | 39626 |
| 271 | Ga0495605_0008009 | 3300046474 | Bacteria | 5982 |
| 272 | Ga0495605_0123854 | 3300046474 | Bacteria | 1170 |
| 273 | Ga0495605_0208814 | 3300046474 | Bacteria | 848 |
| 274 | Ga0495584_0006944 | 3300046491 | Bacteria | 5914 |
| 275 | Ga0495585_0029842 | 3300046492 | Bacteria | 3102 |
| 276 | Ga0495594_0076408 | 3300046499 | Bacteria | 1867 |
| 277 | Ga0495596_0074665 | 3300046500 | Bacteria | 1316 |
| 278 | Ga0495607_0000051 | 3300046501 | Bacteria | 119303 |
| 279 | Ga0495607_0000206 | 3300046501 | Bacteria | 62802 |
| 280 | Ga0495607_0000525 | 3300046501 | Bacteria | 37706 |
| 281 | Ga0495607_0002273 | 3300046501 | Bacteria | 15821 |
| 282 | Ga0495607_0041545 | 3300046501 | Bacteria | 2730 |
| 283 | Ga0495583_0000007 | 3300046506 | Bacteria | 434661 |
| 284 | Ga0495583_0001550 | 3300046506 | Bacteria | 22768 |
| 285 | Ga0495583_0003154 | 3300046506 | Bacteria | 13000 |
| 286 | Ga0495583_0005107 | 3300046506 | Bacteria | 9042 |
| 287 | Ga0495583_0251850 | 3300046506 | Bacteria | 708 |
| 288 | Ga0495606_0000360 | 3300046507 | Bacteria | 77832 |
| 289 | Ga0495606_0006185 | 3300046507 | Bacteria | 11140 |
| 290 | Ga0495606_0270085 | 3300046507 | Bacteria | 934 |
| 291 | Ga0495610_0004042 | 3300046512 | Bacteria | 11036 |
| 292 | Ga0495610_0006856 | 3300046512 | Bacteria | 7722 |
| 293 | Ga0495610_0052116 | 3300046512 | Bacteria | 1987 |
| 294 | Ga0495616_0006074 | 3300046513 | Bacteria | 7358 |
| 295 | Ga0495616_0127605 | 3300046513 | Bacteria | 1168 |
| 296 | Ga0495616_0204806 | 3300046513 | Bacteria | 865 |
| 297 | Ga0495620_0000103 | 3300046515 | Bacteria | 67830 |
| 298 | Ga0495620_0000399 | 3300046515 | Bacteria | 29177 |
| 299 | Ga0495620_0048087 | 3300046515 | Bacteria | 1832 |
| 300 | Ga0495631_0001287 | 3300046518 | Bacteria | 15402 |
| 301 | Ga0495631_0003741 | 3300046518 | Bacteria | 8286 |
| 302 | Ga0495631_0007776 | 3300046518 | Bacteria | 5438 |
| 303 | Ga0495631_0021365 | 3300046518 | Bacteria | 3014 |
| 304 | Ga0495632_0007675 | 3300046519 | Bacteria | 6736 |
| 305 | Ga0495632_0063563 | 3300046519 | Bacteria | 1786 |
| 306 | Ga0495637_0000063 | 3300046520 | Bacteria | 93270 |
| 307 | Ga0495637_0001128 | 3300046520 | Bacteria | 16357 |
| 308 | Ga0495637_0019129 | 3300046520 | Bacteria | 3168 |
| 309 | Ga0495637_0022657 | 3300046520 | Bacteria | 2862 |
| 310 | Ga0495637_0033147 | 3300046520 | Bacteria | 2271 |
| 311 | Ga0495643_0004968 | 3300046522 | Bacteria | 9125 |
| 312 | Ga0495643_0168510 | 3300046522 | Bacteria | 1072 |
| 313 | Ga0495643_0458733 | 3300046522 | Bacteria | 553 |
| 314 | Ga0495644_0002845 | 3300046523 | Bacteria | 6856 |
| 315 | Ga0495648_0000255 | 3300046524 | Bacteria | 60610 |
| 316 | Ga0495648_0003240 | 3300046524 | Bacteria | 14433 |
| 317 | Ga0495648_0004197 | 3300046524 | Bacteria | 12375 |
| 318 | Ga0495654_0004712 | 3300046530 | Bacteria | 8035 |
| 319 | Ga0495654_0008660 | 3300046530 | Bacteria | 5607 |
| 320 | Ga0495654_0016276 | 3300046530 | Bacteria | 3935 |
| 321 | Ga0495654_0021036 | 3300046530 | Bacteria | 3397 |
| 322 | Ga0495654_0021850 | 3300046530 | Bacteria | 3328 |
| 323 | Ga0495654_0100863 | 3300046530 | Bacteria | 1329 |
| 324 | Ga0495609_0000004 | 3300046538 | Bacteria | 697346 |
| 325 | Ga0495609_0002514 | 3300046538 | Bacteria | 11252 |
| 326 | Ga0495609_0055191 | 3300046538 | Bacteria | 1763 |
| 327 | Ga0495621_0015286 | 3300046539 | Bacteria | 2445 |
| 328 | Ga0495597_0000057 | 3300046542 | Bacteria | 93902 |
| 329 | Ga0495597_0033869 | 3300046542 | Bacteria | 2310 |
| 330 | Ga0495622_0013650 | 3300046557 | Bacteria | 3767 |
| 331 | Ga0495622_0258083 | 3300046557 | Bacteria | 765 |
| 332 | Ga0495633_0000020 | 3300046558 | Bacteria | 227180 |
| 333 | Ga0495633_0000426 | 3300046558 | Bacteria | 43843 |
| 334 | Ga0495633_0091302 | 3300046558 | Bacteria | 1416 |
| 335 | Ga0495633_0273544 | 3300046558 | Bacteria | 769 |
| 336 | Ga0495668_0004469 | 3300046616 | Bacteria | 9916 |
| 337 | Ga0495668_0021572 | 3300046616 | Bacteria | 3691 |
| 338 | Ga0495668_0021986 | 3300046616 | Bacteria | 3649 |
| 339 | Ga0495668_0041105 | 3300046616 | Bacteria | 2577 |
| 340 | Ga0495611_0006050 | 3300046648 | Bacteria | 5161 |
| 341 | Ga0495611_0016690 | 3300046648 | Bacteria | 3138 |
| 342 | Ga0495611_0024399 | 3300046648 | Bacteria | 2630 |
| 343 | Ga0495625_0000004 | 3300046660 | Bacteria | 611314 |
| 344 | Ga0495625_0000624 | 3300046660 | Bacteria | 51214 |
| 345 | Ga0495625_0161055 | 3300046660 | Bacteria | 1503 |
| 346 | Ga0495635_0072452 | 3300046663 | Bacteria | 2360 |
| 347 | Ga0495661_0000006 | 3300046665 | Bacteria | 427288 |
| 348 | Ga0495661_0000009 | 3300046665 | Bacteria | 291327 |
| 349 | Ga0495661_0041112 | 3300046665 | Bacteria | 2863 |
| 350 | Ga0495661_0144133 | 3300046665 | Bacteria | 1293 |
| 351 | Ga0495588_0009342 | 3300046674 | Bacteria | 4529 |
| 352 | Ga0495588_0025816 | 3300046674 | Bacteria | 2930 |
| 353 | Ga0495588_0081384 | 3300046674 | Bacteria | 1690 |
| 354 | Ga0495658_0009072 | 3300046683 | Bacteria | 4946 |
| 355 | Ga0495670_0003007 | 3300046691 | Bacteria | 8314 |
| 356 | Ga0495671_0001461 | 3300046692 | Bacteria | 15856 |
| 357 | Ga0495671_0001571 | 3300046692 | Bacteria | 15129 |
| 358 | Ga0495671_0018352 | 3300046692 | Bacteria | 3714 |
| 359 | Ga0495671_0025678 | 3300046692 | Bacteria | 3058 |
| 360 | Ga0495649_0099266 | 3300046694 | Bacteria | 1548 |
| 361 | Ga0495589_0009149 | 3300046794 | Bacteria | 5151 |
| 362 | Ga0495660_0001968 | 3300046810 | Bacteria | 13361 |
| 363 | Ga0495660_0001969 | 3300046810 | Bacteria | 13356 |
| 364 | Ga0495660_0005239 | 3300046810 | Bacteria | 7778 |
| 365 | Ga0495660_0014756 | 3300046810 | Bacteria | 4518 |
| 366 | Ga0495660_0269151 | 3300046810 | Bacteria | 783 |
| 367 | Ga0495660_0296982 | 3300046810 | Bacteria | 733 |
| 368 | Ga0495660_0459430 | 3300046810 | Bacteria | 549 |
| 369 | Ga0495672_0024061 | 3300047320 | Bacteria | 3931 |
| 370 | Ga0495672_0026368 | 3300047320 | Bacteria | 3709 |
| 371 | Ga0495672_0046189 | 3300047320 | Bacteria | 2599 |
| 372 | Ga0495672_0071765 | 3300047320 | Bacteria | 1958 |
| 373 | Ga0495676_0006320 | 3300047321 | Bacteria | 10905 |
| 374 | Ga0495676_0007228 | 3300047321 | Bacteria | 10184 |
| 375 | Ga0495683_0000003 | 3300047323 | Bacteria | 383992 |
| 376 | Ga0495683_0003277 | 3300047323 | Bacteria | 9463 |
| 377 | Ga0495683_0103674 | 3300047323 | Bacteria | 1365 |
| 378 | Ga0495679_000066 | 3300047446 | Bacteria | 100641 |
| 379 | Ga0495679_001956 | 3300047446 | Bacteria | 10998 |
| 380 | Ga0495679_130050 | 3300047446 | Bacteria | 683 |
| 381 | Ga0495673_0000846 | 3300047469 | Bacteria | 28434 |
| 382 | Ga0495673_0002601 | 3300047469 | Bacteria | 12557 |
| 383 | Ga0495673_0008081 | 3300047469 | Bacteria | 5961 |
| 384 | Ga0495673_0015974 | 3300047469 | Bacteria | 3850 |
| 385 | Ga0495673_0028944 | 3300047469 | Bacteria | 2618 |
| 386 | Ga0495681_0006555 | 3300047470 | Bacteria | 7627 |
| 387 | Ga0495681_0020372 | 3300047470 | Bacteria | 3600 |
| 388 | Ga0495681_0148150 | 3300047470 | Bacteria | 986 |
| 389 | Ga0495681_0205473 | 3300047470 | Bacteria | 797 |
| 390 | Ga0495686_0052314 | 3300047472 | Bacteria | 2561 |
| 391 | Ga0495686_0283200 | 3300047472 | Bacteria | 920 |
| 392 | Ga0495593_0016457 | 3300047673 | Bacteria | 4170 |
| 393 | Ga0495614_0155401 | 3300048089 | Bacteria | 1021 |
| 394 | Ga0495626_0003278 | 3300048091 | Bacteria | 10449 |
| 395 | Ga0496101_0685048 | 3300048904 | Bacteria | 809 |
| 396 | Ga0496102_0786985 | 3300048905 | Bacteria | 874 |
| 397 | Ga0496102_1265770 | 3300048905 | Bacteria | 657 |
| 398 | Ga0496102_1317976 | 3300048905 | Bacteria | 641 |
| 399 | Ga0496104_0884538 | 3300048907 | Bacteria | 798 |
| 400 | Ga0496104_0951144 | 3300048907 | Bacteria | 763 |
| 401 | Ga0496109_0462773 | 3300048912 | Bacteria | 1198 |
| 402 | Ga0496111_0625790 | 3300048914 | Bacteria | 787 |
| 403 | Ga0496113_1437345 | 3300048916 | Bacteria | 533 |
| 404 | Ga0496116_0232549 | 3300048919 | Bacteria | 933 |
| 405 | Ga0496117_0080737 | 3300048920 | Bacteria | 2137 |
| 406 | Ga0496117_0315654 | 3300048920 | Bacteria | 821 |
| 407 | Ga0496117_0505264 | 3300048920 | Bacteria | 585 |
| 408 | Ga0496117_0623653 | 3300048920 | Bacteria | 501 |
| 409 | Ga0496118_0023686 | 3300048921 | Bacteria | 5324 |
| 410 | Ga0496118_0035743 | 3300048921 | Bacteria | 4027 |
| 411 | Ga0496118_0047685 | 3300048921 | Bacteria | 3318 |
| 412 | Ga0496118_0129965 | 3300048921 | Bacteria | 1620 |
| 413 | Ga0496118_0344714 | 3300048921 | Bacteria | 796 |
| 414 | Ga0496120_0410442 | 3300048923 | Bacteria | 596 |
| 415 | Ga0496121_0078267 | 3300048924 | Bacteria | 2629 |
| 416 | Ga0496121_0093760 | 3300048924 | Bacteria | 2336 |
| 417 | Ga0496122_0006710 | 3300048925 | Bacteria | 13098 |
| 418 | Ga0496122_0040955 | 3300048925 | Bacteria | 3672 |
| 419 | Ga0496122_0045503 | 3300048925 | Bacteria | 3410 |
| 420 | Ga0496122_0276394 | 3300048925 | Bacteria | 921 |
| 421 | Ga0496123_0005642 | 3300048926 | Bacteria | 12493 |
| 422 | Ga0496123_0030273 | 3300048926 | Bacteria | 3964 |
| 423 | Ga0496123_0102542 | 3300048926 | Bacteria | 1660 |
| 424 | Ga0496124_0005009 | 3300048927 | Bacteria | 15150 |
| 425 | Ga0496124_0006343 | 3300048927 | Bacteria | 12912 |
| 426 | Ga0496124_0007422 | 3300048927 | Bacteria | 11656 |
| 427 | Ga0496124_0047139 | 3300048927 | Bacteria | 3688 |
| 428 | Ga0496124_0128712 | 3300048927 | Bacteria | 2014 |
| 429 | Ga0496124_0168972 | 3300048927 | Bacteria | 1696 |
| 430 | Ga0496125_0000055 | 3300048928 | Bacteria | 278140 |
| 431 | Ga0496125_0024163 | 3300048928 | Bacteria | 5592 |
| 432 | Ga0496125_0041637 | 3300048928 | Bacteria | 3924 |
| 433 | Ga0496126_0074043 | 3300048929 | Bacteria | 3025 |
| 434 | Ga0466983_0488659 | 3300048986 | Bacteria | 853 |
| 435 | Ga0495678_000007 | 3300049459 | Bacteria | 448039 |
| 436 | Ga0495678_000043 | 3300049459 | Bacteria | 172593 |
| 437 | Ga0495678_051234 | 3300049459 | Bacteria | 1596 |
| 438 | Ga0495678_124868 | 3300049459 | Bacteria | 859 |
| 439 | Ga0495682_0000982 | 3300049460 | Bacteria | 17072 |
| 440 | Ga0501249_001947 | 3300049679 | Bacteria | 4201 |
| 441 | Ga0501225_0006911 | 3300049705 | Bacteria | 3307 |
| 442 | Ga0501241_050264 | 3300049758 | Bacteria | 823 |
| 443 | Ga0501262_000355 | 3300049759 | Bacteria | 5548 |
| 444 | nmdc:mga03683_22114_c1 | 3300050489 | Bacteria | 2462 |
| 445 | nmdc:mga03683_23539_c1 | 3300050489 | Bacteria | 2400 |
| 446 | nmdc:mga03683_64856_c1 | 3300050489 | Bacteria | 1551 |
| 447 | nmdc:mga03n38_145570_c1 | 3300050490 | Bacteria | 1188 |
| 448 | nmdc:mga03n38_153649_c1 | 3300050490 | Bacteria | 1160 |
| 449 | nmdc:mga03n38_55134_c1 | 3300050490 | Bacteria | 1790 |
| 450 | nmdc:mga00v17_44307_c1 | 3300050491 | Bacteria | 2683 |
| 451 | nmdc:mga00v17_517219_c1 | 3300050491 | Bacteria | 773 |
| 452 | nmdc:mga00v17_978_c1 | 3300050491 | Bacteria | 15304 |
| 453 | nmdc:mga0yw44_185578_c1 | 3300050492 | Bacteria | 1370 |
| 454 | nmdc:mga0yw44_71309_c1 | 3300050492 | Bacteria | 2157 |
| 455 | nmdc:mga0k408_50879_c1 | 3300050493 | Bacteria | 2399 |
| 456 | nmdc:mga06z11_73906_c1 | 3300050494 | Bacteria | 1811 |
| 457 | nmdc:mga07m45_488_c1 | 3300050496 | Bacteria | 16759 |
| 458 | nmdc:mga07m45_84669_c1 | 3300050496 | Bacteria | 1813 |
| 459 | nmdc:mga0qj67_31033_c1 | 3300050509 | Bacteria | 4161 |
| 460 | nmdc:mga0sz30_62240_c1 | 3300050516 | Bacteria | 1596 |
| 461 | Ga0500610_0004702 | 3300053079 | Bacteria | 5473 |
| 462 | Ga0500651_0000052 | 3300053093 | Bacteria | 76301 |
| 463 | Ga0500566_0291107 | 3300053094 | Bacteria | 773 |
| 464 | Ga0500560_052353 | 3300053107 | Bacteria | 1313 |
| 465 | Ga0500562_179051 | 3300053108 | Bacteria | 576 |
| 466 | Ga0500571_000118 | 3300053110 | Bacteria | 25948 |
| 467 | Ga0500592_008047 | 3300053116 | Bacteria | 1672 |
| 468 | Ga0500593_000306 | 3300053117 | Bacteria | 19926 |
| 469 | Ga0500594_0001446 | 3300053118 | Bacteria | 5155 |
| 470 | Ga0500607_001189 | 3300053121 | Bacteria | 23935 |
| 471 | Ga0500608_005072 | 3300053122 | Bacteria | 5182 |
| 472 | Ga0500655_000281 | 3300053133 | Bacteria | 11746 |
| 473 | Ga0500658_0000033 | 3300053134 | Bacteria | 89738 |
| 474 | Ga0500658_0000040 | 3300053134 | Bacteria | 79293 |
| 475 | Ga0500559_0019480 | 3300053136 | Bacteria | 2867 |
| 476 | Ga0500564_098966 | 3300053138 | Bacteria | 1291 |
| 477 | Ga0500568_0008134 | 3300053139 | Bacteria | 5082 |
| 478 | Ga0500574_000532 | 3300053141 | Bacteria | 4892 |
| 479 | Ga0500616_0050524 | 3300053153 | Bacteria | 2195 |
| 480 | Ga0500627_0000079 | 3300053158 | Bacteria | 35871 |
| 481 | Ga0500634_0014576 | 3300053161 | Bacteria | 4148 |
| 482 | Ga0500634_0047084 | 3300053161 | Bacteria | 2329 |
| 483 | Ga0500638_006107 | 3300053162 | Bacteria | 4891 |
| 484 | Ga0500636_0075606 | 3300053177 | Bacteria | 1948 |
| 485 | Ga0466962_0047799 | 3300061719 | Bacteria | 2045 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300048926 | Ga0496123_0102542 | Ga0496123_0102542_1293_1649 | 117 |
| 2 | iso_pu_bacteria | 2513237150 | 2513954670 | 121 |
| 3 | iso_pu_bacteria | 2599185214 | 2599625931 | 121 |
| 4 | iso_pu_bacteria | 2599185226 | 2599674987 | 121 |
| 5 | iso_pu_bacteria | 2599185227 | 2599683881 | 121 |
| 6 | iso_pu_bacteria | 2599185229 | 2599695516 | 121 |
| 7 | iso_pu_bacteria | 2643221628 | 2644162956 | 121 |
| 8 | iso_pu_bacteria | 2643221658 | 2644329556 | 121 |
| 9 | iso_pu_bacteria | 2721755763 | 2723876078 | 121 |
| 10 | iso_pu_bacteria | 2765235841 | 2765584459 | 121 |
| 11 | iso_pu_bacteria | 2818991446 | 2819596217 | 121 |
| 12 | iso_pu_bacteria | 2831265667 | 2831270442 | 121 |
| 13 | iso_pu_bacteria | 2842914999 | 2842915890 | 121 |
| 14 | iso_pu_bacteria | 2885198086 | 2885199726 | 121 |
| 15 | iso_pu_bacteria | 2885211737 | 2885213377 | 121 |
| 16 | iso_pu_bacteria | 2904449895 | 2904454680 | 121 |
| 17 | iso_pu_bacteria | 2904456579 | 2904460397 | 121 |
| 18 | iso_pu_bacteria | 2928037797 | 2928038307 | 121 |
| 19 | iso_pu_bacteria | 2928044640 | 2928046088 | 121 |
| 20 | iso_pu_bacteria | 2928051484 | 2928053787 | 121 |
| 21 | iso_pu_bacteria | 2928064002 | 2928067330 | 121 |
| 22 | iso_pu_bacteria | 2928070936 | 2928076298 | 121 |
| 23 | iso_pu_bacteria | 2928084124 | 2928088905 | 121 |
| 24 | iso_pu_bacteria | 2929520902 | 2929524601 | 121 |
| 25 | iso_pu_bacteria | 2945909444 | 2945912841 | 121 |
| 26 | iso_pu_bacteria | 2945972063 | 2945976709 | 121 |
| 27 | iso_pu_bacteria | 2945984333 | 2945984893 | 121 |
| 28 | iso_pu_bacteria | 2954767861 | 2954771763 | 121 |
| 29 | iso_pu_bacteria | 644736347 | 644752232 | 121 |
| 30 | iso_pu_bacteria | 8054929484 | 8054932092 | 121 |
| 31 | iso_pu_bacteria | 2510065053 | 2510281145 | 122 |
| 32 | iso_pu_bacteria | 2510065055 | 2510295748 | 122 |
| 33 | iso_pu_bacteria | 2510065058 | 2510309293 | 122 |
| 34 | iso_pu_bacteria | 2599185185 | 2599486529 | 122 |
| 35 | iso_pu_bacteria | 2773857672 | 2774132086 | 122 |
| 36 | iso_pu_bacteria | 2974298342 | 2974300950 | 122 |
| 37 | iso_pu_bacteria | 2984499530 | 2984503426 | 122 |
| 38 | iso_pu_bacteria | 2501025501 | 2501076115 | 123 |
| 39 | iso_pu_bacteria | 2501025502 | 2501085825 | 123 |
| 40 | iso_pu_bacteria | 2501025504 | 2501411946 | 123 |
| 41 | iso_pu_bacteria | 2510917013 | 2511088442 | 123 |
| 42 | iso_pu_bacteria | 2510917014 | 2511100944 | 123 |
| 43 | iso_pu_bacteria | 2510917015 | 2511107291 | 123 |
| 44 | iso_pu_bacteria | 2515154189 | 2516020559 | 123 |
| 45 | iso_pu_bacteria | 2562617112 | 2563064079 | 123 |
| 46 | iso_pu_bacteria | 2599185239 | 2599741548 | 123 |
| 47 | iso_pu_bacteria | 2599185240 | 2599746723 | 123 |
| 48 | iso_pu_bacteria | 2599185355 | 2600208629 | 123 |
| 49 | iso_pu_bacteria | 2675903129 | 2676744285 | 123 |
| 50 | iso_pu_bacteria | 2711768613 | 2713472354 | 123 |
| 51 | iso_pu_bacteria | 2791355137 | 2792839120 | 123 |
| 52 | iso_pu_bacteria | 2808606384 | 2808967676 | 123 |
| 53 | iso_pu_bacteria | 2808606384 | 2808973812 | 123 |
| 54 | iso_pu_bacteria | 2808606390 | 2809002507 | 123 |
| 55 | iso_pu_bacteria | 2808606390 | 2809008746 | 123 |
| 56 | iso_pu_bacteria | 2808606391 | 2809009785 | 123 |
| 57 | iso_pu_bacteria | 2808606391 | 2809015748 | 123 |
| 58 | iso_pu_bacteria | 2818991452 | 2819630776 | 123 |
| 59 | iso_pu_bacteria | 2856287931 | 2856294528 | 123 |
| 60 | iso_pu_bacteria | 2857357740 | 2857367901 | 123 |
| 61 | iso_pu_bacteria | 2863421361 | 2863424617 | 123 |
| 62 | iso_pu_bacteria | 2870068957 | 2870071449 | 123 |
| 63 | iso_pu_bacteria | 2883087390 | 2883089461 | 123 |
| 64 | iso_pu_bacteria | 2904564687 | 2904568595 | 123 |
| 65 | iso_pu_bacteria | 2904571731 | 2904575637 | 123 |
| 66 | iso_pu_bacteria | 2928157003 | 2928160386 | 123 |
| 67 | iso_pu_bacteria | 2928163908 | 2928170632 | 123 |
| 68 | iso_pu_bacteria | 2928170801 | 2928172567 | 123 |
| 69 | iso_pu_bacteria | 2928536128 | 2928540658 | 123 |
| 70 | iso_pu_bacteria | 2981990288 | 2981996304 | 123 |
| 71 | iso_pu_bacteria | 641736154 | 642418204 | 123 |
| 72 | iso_pu_bacteria | 8020938398 | 8020941435 | 123 |
| 73 | iso_pu_bacteria | 8020945358 | 8020949371 | 123 |
| 74 | iso_pu_bacteria | 8020953355 | 8020957776 | 123 |
| 75 | iso_pu_bacteria | 8021120328 | 8021128004 | 123 |
| 76 | iso_pu_bacteria | 8039098773 | 8039104852 | 123 |
| 77 | 3300005441 | Ga0070700_100216837 | Ga0070700_1002168372 | 124 |
| 78 | 3300005545 | Ga0070695_100116339 | Ga0070695_1001163392 | 124 |
| 79 | 3300005545 | Ga0070695_100339818 | Ga0070695_1003398182 | 124 |
| 80 | 3300026075 | Ga0207708_10095980 | Ga0207708_100959803 | 124 |
| 81 | 3300003578 | Ga0006562J51391_1069169 | Ga0006562J51391_10691691 | 125 |
| 82 | 3300003758 | Ga0055532_1024655 | Ga0055532_10246552 | 125 |
| 83 | 3300003760 | Ga0055527_1017507 | Ga0055527_10175072 | 125 |
| 84 | 3300003761 | Ga0055535_1000215 | Ga0055535_10002152 | 125 |
| 85 | 3300003762 | Ga0055542_1000004 | Ga0055542_1000004424 | 125 |
| 86 | 3300003781 | Ga0055536_1000532 | Ga0055536_100053220 | 125 |
| 87 | 3300003781 | Ga0055536_1006662 | Ga0055536_10066626 | 125 |
| 88 | 3300003781 | Ga0055536_1011569 | Ga0055536_10115693 | 125 |
| 89 | 3300003784 | Ga0055534_1000024 | Ga0055534_100002499 | 125 |
| 90 | 3300003784 | Ga0055534_1011908 | Ga0055534_10119082 | 125 |
| 91 | 3300003790 | Ga0055528_1001110 | Ga0055528_100111015 | 125 |
| 92 | 3300003791 | Ga0055530_10000502 | Ga0055530_1000050223 | 125 |
| 93 | 3300003791 | Ga0055530_10005458 | Ga0055530_100054586 | 125 |
| 94 | 3300003792 | Ga0055540_1004114 | Ga0055540_10041146 | 125 |
| 95 | 3300003792 | Ga0055540_1005189 | Ga0055540_10051894 | 125 |
| 96 | 3300003792 | Ga0055540_1005483 | Ga0055540_10054833 | 125 |
| 97 | 3300003794 | Ga0055531_10000983 | Ga0055531_1000098318 | 125 |
| 98 | 3300003794 | Ga0055531_10008665 | Ga0055531_100086653 | 125 |
| 99 | 3300003794 | Ga0055531_10053606 | Ga0055531_100536062 | 125 |
| 100 | 3300005289 | Ga0065704_10076870 | Ga0065704_100768702 | 125 |
| 101 | 3300005334 | Ga0068869_100694438 | Ga0068869_1006944382 | 125 |
| 102 | 3300005457 | Ga0070662_100051555 | Ga0070662_1000515552 | 125 |
| 103 | 3300005539 | Ga0068853_100491687 | Ga0068853_1004916872 | 125 |
| 104 | 3300005544 | Ga0070686_100653966 | Ga0070686_1006539662 | 125 |
| 105 | 3300005548 | Ga0070665_102404286 | Ga0070665_1024042861 | 125 |
| 106 | 3300005563 | Ga0068855_100001016 | Ga0068855_10000101621 | 125 |
| 107 | 3300005564 | Ga0070664_100458663 | Ga0070664_1004586632 | 125 |
| 108 | 3300005577 | Ga0068857_100343154 | Ga0068857_1003431542 | 125 |
| 109 | 3300005616 | Ga0068852_100046537 | Ga0068852_1000465374 | 125 |
| 110 | 3300006038 | Ga0075365_10036928 | Ga0075365_100369282 | 125 |
| 111 | 3300006048 | Ga0075363_100066376 | Ga0075363_1000663762 | 125 |
| 112 | 3300006048 | Ga0075363_100137151 | Ga0075363_1001371512 | 125 |
| 113 | 3300006051 | Ga0075364_10052783 | Ga0075364_100527832 | 125 |
| 114 | 3300006051 | Ga0075364_10415919 | Ga0075364_104159192 | 125 |
| 115 | 3300006058 | Ga0075432_10110808 | Ga0075432_101108082 | 125 |
| 116 | 3300006177 | Ga0075362_10005546 | Ga0075362_100055462 | 125 |
| 117 | 3300006178 | Ga0075367_10060239 | Ga0075367_100602392 | 125 |
| 118 | 3300006186 | Ga0075369_10117873 | Ga0075369_101178732 | 125 |
| 119 | 3300006195 | Ga0075366_10018935 | Ga0075366_100189354 | 125 |
| 120 | 3300006195 | Ga0075366_10438519 | Ga0075366_104385192 | 125 |
| 121 | 3300006353 | Ga0075370_10001129 | Ga0075370_100011297 | 125 |
| 122 | 3300006353 | Ga0075370_10001606 | Ga0075370_1000160610 | 125 |
| 123 | 3300006353 | Ga0075370_10244375 | Ga0075370_102443751 | 125 |
| 124 | 3300006846 | Ga0075430_100058327 | Ga0075430_1000583273 | 125 |
| 125 | 3300006946 | Ga0079104_1027975 | Ga0079104_10279752 | 125 |
| 126 | 3300009011 | Ga0105251_10129851 | Ga0105251_101298512 | 125 |
| 127 | 3300009036 | Ga0105244_10006016 | Ga0105244_100060166 | 125 |
| 128 | 3300009036 | Ga0105244_10242859 | Ga0105244_102428592 | 125 |
| 129 | 3300009093 | Ga0105240_10007671 | Ga0105240_100076714 | 125 |
| 130 | 3300009148 | Ga0105243_10002802 | Ga0105243_100028025 | 125 |
| 131 | 3300009148 | Ga0105243_10202552 | Ga0105243_102025522 | 125 |
| 132 | 3300009148 | Ga0105243_10577967 | Ga0105243_105779672 | 125 |
| 133 | 3300009176 | Ga0105242_11060362 | Ga0105242_110603621 | 125 |
| 134 | 3300009545 | Ga0105237_11028572 | Ga0105237_110285722 | 125 |
| 135 | 3300010375 | Ga0105239_10028949 | Ga0105239_100289493 | 125 |
| 136 | 3300010375 | Ga0105239_11328507 | Ga0105239_113285071 | 125 |
| 137 | 3300011119 | Ga0105246_10088164 | Ga0105246_100881642 | 125 |
| 138 | 3300011119 | Ga0105246_10265379 | Ga0105246_102653792 | 125 |
| 139 | 3300012502 | Ga0157347_1019701 | Ga0157347_10197012 | 125 |
| 140 | 3300013102 | Ga0157371_10019307 | Ga0157371_100193074 | 125 |
| 141 | 3300013104 | Ga0157370_10000372 | Ga0157370_1000037231 | 125 |
| 142 | 3300013104 | Ga0157370_10123118 | Ga0157370_101231184 | 125 |
| 143 | 3300013104 | Ga0157370_11552258 | Ga0157370_115522582 | 125 |
| 144 | 3300013105 | Ga0157369_10255698 | Ga0157369_102556982 | 125 |
| 145 | 3300014326 | Ga0157380_10451895 | Ga0157380_104518953 | 125 |
| 146 | 3300014497 | Ga0182008_10001492 | Ga0182008_100014926 | 125 |
| 147 | 3300014497 | Ga0182008_10023787 | Ga0182008_100237875 | 125 |
| 148 | 3300015261 | Ga0182006_1001173 | Ga0182006_10011736 | 125 |
| 149 | 3300015261 | Ga0182006_1160007 | Ga0182006_11600071 | 125 |
| 150 | 3300015262 | Ga0182007_10000924 | Ga0182007_100009246 | 125 |
| 151 | 3300015265 | Ga0182005_1064955 | Ga0182005_10649552 | 125 |
| 152 | 3300017792 | Ga0163161_10000463 | Ga0163161_100004634 | 125 |
| 153 | 3300017792 | Ga0163161_10010048 | Ga0163161_100100487 | 125 |
| 154 | 3300025228 | Ga0209672_108431 | Ga0209672_1084312 | 125 |
| 155 | 3300025229 | Ga0209147_102312 | Ga0209147_1023125 | 125 |
| 156 | 3300025242 | Ga0209258_100022 | Ga0209258_100022424 | 125 |
| 157 | 3300025245 | Ga0207425_1010775 | Ga0207425_10107753 | 125 |
| 158 | 3300025254 | Ga0209148_1000034 | Ga0209148_1000034424 | 125 |
| 159 | 3300025263 | Ga0209565_1000040 | Ga0209565_100004041 | 125 |
| 160 | 3300025273 | Ga0209673_1000109 | Ga0209673_1000109122 | 125 |
| 161 | 3300025273 | Ga0209673_1048682 | Ga0209673_10486822 | 125 |
| 162 | 3300025291 | Ga0209675_1000024 | Ga0209675_1000024227 | 125 |
| 163 | 3300025292 | Ga0209676_1000005 | Ga0209676_1000005278 | 125 |
| 164 | 3300025292 | Ga0209676_1000478 | Ga0209676_100047811 | 125 |
| 165 | 3300025292 | Ga0209676_1044454 | Ga0209676_10444542 | 125 |
| 166 | 3300025292 | Ga0209676_1061001 | Ga0209676_10610012 | 125 |
| 167 | 3300025294 | Ga0209025_1007853 | Ga0209025_10078535 | 125 |
| 168 | 3300025298 | Ga0209050_1000007 | Ga0209050_1000007819 | 125 |
| 169 | 3300025298 | Ga0209050_1000146 | Ga0209050_100014658 | 125 |
| 170 | 3300025298 | Ga0209050_1031392 | Ga0209050_10313922 | 125 |
| 171 | 3300025302 | Ga0207426_1149324 | Ga0207426_11493241 | 125 |
| 172 | 3300025303 | Ga0209051_1000009 | Ga0209051_1000009278 | 125 |
| 173 | 3300025303 | Ga0209051_1000092 | Ga0209051_100009225 | 125 |
| 174 | 3300025303 | Ga0209051_1000598 | Ga0209051_100059821 | 125 |
| 175 | 3300025304 | Ga0209257_1000011 | Ga0209257_1000011252 | 125 |
| 176 | 3300025304 | Ga0209257_1000576 | Ga0209257_100057658 | 125 |
| 177 | 3300025304 | Ga0209257_1004039 | Ga0209257_10040396 | 125 |
| 178 | 3300025728 | Ga0207655_1005449 | Ga0207655_10054492 | 125 |
| 179 | 3300025728 | Ga0207655_1008571 | Ga0207655_10085714 | 125 |
| 180 | 3300025735 | Ga0207713_1000366 | Ga0207713_100036642 | 125 |
| 181 | 3300025735 | Ga0207713_1146222 | Ga0207713_11462222 | 125 |
| 182 | 3300025913 | Ga0207695_10021004 | Ga0207695_100210042 | 125 |
| 183 | 3300025914 | Ga0207671_10065539 | Ga0207671_100655393 | 125 |
| 184 | 3300025914 | Ga0207671_11482307 | Ga0207671_114823071 | 125 |
| 185 | 3300025925 | Ga0207650_10073315 | Ga0207650_100733152 | 125 |
| 186 | 3300025933 | Ga0207706_10015493 | Ga0207706_100154937 | 125 |
| 187 | 3300025933 | Ga0207706_10467588 | Ga0207706_104675882 | 125 |
| 188 | 3300025935 | Ga0207709_10000233 | Ga0207709_1000023362 | 125 |
| 189 | 3300025935 | Ga0207709_10000813 | Ga0207709_1000081319 | 125 |
| 190 | 3300025935 | Ga0207709_10010216 | Ga0207709_100102165 | 125 |
| 191 | 3300025936 | Ga0207670_10703795 | Ga0207670_107037951 | 125 |
| 192 | 3300025941 | Ga0207711_10056667 | Ga0207711_100566673 | 125 |
| 193 | 3300025945 | Ga0207679_10426340 | Ga0207679_104263402 | 125 |
| 194 | 3300025949 | Ga0207667_10000040 | Ga0207667_1000004020 | 125 |
| 195 | 3300025949 | Ga0207667_10214911 | Ga0207667_102149111 | 125 |
| 196 | 3300026041 | Ga0207639_10074372 | Ga0207639_100743722 | 125 |
| 197 | 3300026078 | Ga0207702_10387413 | Ga0207702_103874132 | 125 |
| 198 | 3300026116 | Ga0207674_10067087 | Ga0207674_100670873 | 125 |
| 199 | 3300026142 | Ga0207698_10995973 | Ga0207698_109959732 | 125 |
| 200 | 3300027111 | Ga0209281_1020575 | Ga0209281_10205752 | 125 |
| 201 | 3300028381 | Ga0268264_10175879 | Ga0268264_101758793 | 125 |
| 202 | 3300028800 | Ga0265338_10000191 | Ga0265338_1000019157 | 125 |
| 203 | 3300030731 | Ga0316177_1015375 | Ga0316177_10153752 | 125 |
| 204 | 3300030733 | Ga0314311_1224032 | Ga0314311_12240322 | 125 |
| 205 | 3300030742 | Ga0316183_1118103 | Ga0316183_11181033 | 125 |
| 206 | 3300030744 | Ga0316181_1001035 | Ga0316181_10010352 | 125 |
| 207 | 3300030744 | Ga0316181_1255510 | Ga0316181_12555102 | 125 |
| 208 | 3300031247 | Ga0265340_10069789 | Ga0265340_100697892 | 125 |
| 209 | 3300031548 | Ga0307408_100026404 | Ga0307408_1000264042 | 125 |
| 210 | 3300031548 | Ga0307408_100060441 | Ga0307408_1000604413 | 125 |
| 211 | 3300031548 | Ga0307408_100291317 | Ga0307408_1002913172 | 125 |
| 212 | 3300031548 | Ga0307408_100393226 | Ga0307408_1003932262 | 125 |
| 213 | 3300031548 | Ga0307408_100471126 | Ga0307408_1004711262 | 125 |
| 214 | 3300031548 | Ga0307408_100683966 | Ga0307408_1006839662 | 125 |
| 215 | 3300031548 | Ga0307408_100848614 | Ga0307408_1008486142 | 125 |
| 216 | 3300031649 | Ga0307514_10034964 | Ga0307514_100349644 | 125 |
| 217 | 3300031731 | Ga0307405_10014618 | Ga0307405_100146183 | 125 |
| 218 | 3300031731 | Ga0307405_10025215 | Ga0307405_100252155 | 125 |
| 219 | 3300031731 | Ga0307405_10114750 | Ga0307405_101147502 | 125 |
| 220 | 3300031731 | Ga0307405_11719944 | Ga0307405_117199441 | 125 |
| 221 | 3300031824 | Ga0307413_10408734 | Ga0307413_104087342 | 125 |
| 222 | 3300031901 | Ga0307406_10000519 | Ga0307406_1000051920 | 125 |
| 223 | 3300031901 | Ga0307406_10301505 | Ga0307406_103015052 | 125 |
| 224 | 3300031901 | Ga0307406_10847918 | Ga0307406_108479182 | 125 |
| 225 | 3300031901 | Ga0307406_11948251 | Ga0307406_119482511 | 125 |
| 226 | 3300031911 | Ga0307412_10003407 | Ga0307412_100034079 | 125 |
| 227 | 3300031911 | Ga0307412_10023191 | Ga0307412_100231913 | 125 |
| 228 | 3300031911 | Ga0307412_10143792 | Ga0307412_101437921 | 125 |
| 229 | 3300031911 | Ga0307412_10370971 | Ga0307412_103709712 | 125 |
| 230 | 3300031911 | Ga0307412_11195905 | Ga0307412_111959052 | 125 |
| 231 | 3300031911 | Ga0307412_11890962 | Ga0307412_118909622 | 125 |
| 232 | 3300032002 | Ga0307416_100289303 | Ga0307416_1002893032 | 125 |
| 233 | 3300032002 | Ga0307416_100402699 | Ga0307416_1004026992 | 125 |
| 234 | 3300032002 | Ga0307416_101967494 | Ga0307416_1019674942 | 125 |
| 235 | 3300032002 | Ga0307416_102691274 | Ga0307416_1026912741 | 125 |
| 236 | 3300032004 | Ga0307414_10004871 | Ga0307414_100048713 | 125 |
| 237 | 3300032004 | Ga0307414_10078007 | Ga0307414_100780072 | 125 |
| 238 | 3300032004 | Ga0307414_10205866 | Ga0307414_102058663 | 125 |
| 239 | 3300032004 | Ga0307414_10493591 | Ga0307414_104935912 | 125 |
| 240 | 3300032004 | Ga0307414_12323245 | Ga0307414_123232451 | 125 |
| 241 | 3300032005 | Ga0307411_10127515 | Ga0307411_101275153 | 125 |
| 242 | 3300032005 | Ga0307411_10445228 | Ga0307411_104452282 | 125 |
| 243 | 3300032005 | Ga0307411_10969389 | Ga0307411_109693892 | 125 |
| 244 | 3300033180 | Ga0307510_10089335 | Ga0307510_100893352 | 125 |
| 245 | 3300041404 | Ga0439436_0001827 | Ga0439436_0001827_4196_4576 | 125 |
| 246 | 3300041411 | Ga0439466_0049950 | Ga0439466_0049950_551_931 | 125 |
| 247 | 3300042002 | Ga0439442_030159 | Ga0439442_030159_601_981 | 125 |
| 248 | 3300042002 | Ga0439442_046508 | Ga0439442_046508_306_686 | 125 |
| 249 | 3300042006 | Ga0439432_001720 | Ga0439432_001720_5232_5612 | 125 |
| 250 | 3300042007 | Ga0439449_0013591 | Ga0439449_0013591_1561_1941 | 125 |
| 251 | 3300042010 | Ga0439452_023182 | Ga0439452_023182_613_993 | 125 |
| 252 | 3300042015 | Ga0439462_0001315 | Ga0439462_0001315_3718_4098 | 125 |
| 253 | 3300042016 | Ga0439463_000222 | Ga0439463_000222_7362_7739 | 125 |
| 254 | 3300042121 | Ga0450919_008504 | Ga0450919_008504_324_704 | 125 |
| 255 | 3300042125 | Ga0450923_041812 | Ga0450923_041812_386_766 | 125 |
| 256 | 3300042134 | Ga0450898_040524 | Ga0450898_040524_122_502 | 125 |
| 257 | 3300042135 | Ga0450899_032795 | Ga0450899_032795_32_412 | 125 |
| 258 | 3300042145 | Ga0450906_042136 | Ga0450906_042136_394_774 | 125 |
| 259 | 3300042146 | Ga0450907_044396 | Ga0450907_044396_91_471 | 125 |
| 260 | 3300042147 | Ga0450910_000794 | Ga0450910_000794_561_941 | 125 |
| 261 | 3300042156 | Ga0439446_0111104 | Ga0439446_0111104_280_660 | 125 |
| 262 | 3300042184 | Ga0450908_031759 | Ga0450908_031759_505_885 | 125 |
| 263 | 3300042185 | Ga0450909_008810 | Ga0450909_008810_1053_1433 | 125 |
| 264 | 3300042532 | Ga0450893_0008581 | Ga0450893_0008581_705_1085 | 125 |
| 265 | 3300046452 | Ga0495617_082426 | Ga0495617_082426_108_485 | 125 |
| 266 | 3300046453 | Ga0495627_006765 | Ga0495627_006765_1595_1972 | 125 |
| 267 | 3300046453 | Ga0495627_031761 | Ga0495627_031761_420_800 | 125 |
| 268 | 3300046457 | Ga0495590_0097735 | Ga0495590_0097735_83_460 | 125 |
| 269 | 3300046458 | Ga0495591_000009 | Ga0495591_000009_126626_127003 | 125 |
| 270 | 3300046458 | Ga0495591_000137 | Ga0495591_000137_40317_40694 | 125 |
| 271 | 3300046458 | Ga0495591_001356 | Ga0495591_001356_7095_7472 | 125 |
| 272 | 3300046458 | Ga0495591_002627 | Ga0495591_002627_8726_9103 | 125 |
| 273 | 3300046458 | Ga0495591_018493 | Ga0495591_018493_854_1231 | 125 |
| 274 | 3300046459 | Ga0495629_0340940 | Ga0495629_0340940_538_918 | 125 |
| 275 | 3300046459 | Ga0495629_0469847 | Ga0495629_0469847_396_776 | 125 |
| 276 | 3300046460 | Ga0495638_0009525 | Ga0495638_0009525_4809_5189 | 125 |
| 277 | 3300046471 | Ga0495650_0018878 | Ga0495650_0018878_2060_2437 | 125 |
| 278 | 3300046474 | Ga0495605_0000007 | Ga0495605_0000007_80935_81312 | 125 |
| 279 | 3300046474 | Ga0495605_0000075 | Ga0495605_0000075_28232_28609 | 125 |
| 280 | 3300046474 | Ga0495605_0000404 | Ga0495605_0000404_182_559 | 125 |
| 281 | 3300046474 | Ga0495605_0008009 | Ga0495605_0008009_5523_5900 | 125 |
| 282 | 3300046474 | Ga0495605_0123854 | Ga0495605_0123854_434_811 | 125 |
| 283 | 3300046491 | Ga0495584_0006944 | Ga0495584_0006944_2225_2602 | 125 |
| 284 | 3300046492 | Ga0495585_0029842 | Ga0495585_0029842_2478_2855 | 125 |
| 285 | 3300046499 | Ga0495594_0076408 | Ga0495594_0076408_1231_1608 | 125 |
| 286 | 3300046500 | Ga0495596_0074665 | Ga0495596_0074665_302_679 | 125 |
| 287 | 3300046501 | Ga0495607_0000051 | Ga0495607_0000051_32292_32669 | 125 |
| 288 | 3300046501 | Ga0495607_0000206 | Ga0495607_0000206_31000_31377 | 125 |
| 289 | 3300046501 | Ga0495607_0000525 | Ga0495607_0000525_28497_28874 | 125 |
| 290 | 3300046501 | Ga0495607_0002273 | Ga0495607_0002273_3363_3740 | 125 |
| 291 | 3300046501 | Ga0495607_0041545 | Ga0495607_0041545_729_1106 | 125 |
| 292 | 3300046506 | Ga0495583_0000007 | Ga0495583_0000007_39637_40014 | 125 |
| 293 | 3300046506 | Ga0495583_0001550 | Ga0495583_0001550_8430_8807 | 125 |
| 294 | 3300046506 | Ga0495583_0003154 | Ga0495583_0003154_11812_12189 | 125 |
| 295 | 3300046506 | Ga0495583_0005107 | Ga0495583_0005107_4999_5376 | 125 |
| 296 | 3300046506 | Ga0495583_0251850 | Ga0495583_0251850_207_587 | 125 |
| 297 | 3300046507 | Ga0495606_0006185 | Ga0495606_0006185_9737_10114 | 125 |
| 298 | 3300046507 | Ga0495606_0270085 | Ga0495606_0270085_455_832 | 125 |
| 299 | 3300046512 | Ga0495610_0004042 | Ga0495610_0004042_9979_10356 | 125 |
| 300 | 3300046512 | Ga0495610_0006856 | Ga0495610_0006856_6215_6592 | 125 |
| 301 | 3300046512 | Ga0495610_0052116 | Ga0495610_0052116_513_893 | 125 |
| 302 | 3300046513 | Ga0495616_0006074 | Ga0495616_0006074_4762_5142 | 125 |
| 303 | 3300046513 | Ga0495616_0127605 | Ga0495616_0127605_148_525 | 125 |
| 304 | 3300046513 | Ga0495616_0204806 | Ga0495616_0204806_341_718 | 125 |
| 305 | 3300046515 | Ga0495620_0000103 | Ga0495620_0000103_67011_67388 | 125 |
| 306 | 3300046515 | Ga0495620_0000399 | Ga0495620_0000399_13933_14310 | 125 |
| 307 | 3300046515 | Ga0495620_0048087 | Ga0495620_0048087_276_653 | 125 |
| 308 | 3300046518 | Ga0495631_0001287 | Ga0495631_0001287_2502_2879 | 125 |
| 309 | 3300046518 | Ga0495631_0003741 | Ga0495631_0003741_7574_7951 | 125 |
| 310 | 3300046518 | Ga0495631_0007776 | Ga0495631_0007776_109_489 | 125 |
| 311 | 3300046518 | Ga0495631_0021365 | Ga0495631_0021365_249_626 | 125 |
| 312 | 3300046519 | Ga0495632_0007675 | Ga0495632_0007675_4759_5136 | 125 |
| 313 | 3300046519 | Ga0495632_0063563 | Ga0495632_0063563_646_1023 | 125 |
| 314 | 3300046520 | Ga0495637_0000063 | Ga0495637_0000063_31731_32108 | 125 |
| 315 | 3300046520 | Ga0495637_0001128 | Ga0495637_0001128_341_718 | 125 |
| 316 | 3300046520 | Ga0495637_0019129 | Ga0495637_0019129_1905_2285 | 125 |
| 317 | 3300046520 | Ga0495637_0022657 | Ga0495637_0022657_2367_2744 | 125 |
| 318 | 3300046520 | Ga0495637_0033147 | Ga0495637_0033147_571_948 | 125 |
| 319 | 3300046522 | Ga0495643_0004968 | Ga0495643_0004968_7239_7616 | 125 |
| 320 | 3300046522 | Ga0495643_0168510 | Ga0495643_0168510_275_652 | 125 |
| 321 | 3300046522 | Ga0495643_0458733 | Ga0495643_0458733_141_518 | 125 |
| 322 | 3300046523 | Ga0495644_0002845 | Ga0495644_0002845_5730_6107 | 125 |
| 323 | 3300046524 | Ga0495648_0000255 | Ga0495648_0000255_24627_25004 | 125 |
| 324 | 3300046524 | Ga0495648_0004197 | Ga0495648_0004197_3359_3736 | 125 |
| 325 | 3300046530 | Ga0495654_0004712 | Ga0495654_0004712_2163_2540 | 125 |
| 326 | 3300046530 | Ga0495654_0008660 | Ga0495654_0008660_236_613 | 125 |
| 327 | 3300046530 | Ga0495654_0016276 | Ga0495654_0016276_1601_1978 | 125 |
| 328 | 3300046530 | Ga0495654_0021036 | Ga0495654_0021036_2739_3116 | 125 |
| 329 | 3300046530 | Ga0495654_0021850 | Ga0495654_0021850_2834_3214 | 125 |
| 330 | 3300046530 | Ga0495654_0100863 | Ga0495654_0100863_156_536 | 125 |
| 331 | 3300046538 | Ga0495609_0000004 | Ga0495609_0000004_83412_83789 | 125 |
| 332 | 3300046538 | Ga0495609_0002514 | Ga0495609_0002514_10336_10713 | 125 |
| 333 | 3300046538 | Ga0495609_0055191 | Ga0495609_0055191_1184_1561 | 125 |
| 334 | 3300046539 | Ga0495621_0015286 | Ga0495621_0015286_1272_1652 | 125 |
| 335 | 3300046542 | Ga0495597_0000057 | Ga0495597_0000057_32463_32840 | 125 |
| 336 | 3300046542 | Ga0495597_0033869 | Ga0495597_0033869_1848_2225 | 125 |
| 337 | 3300046557 | Ga0495622_0013650 | Ga0495622_0013650_1774_2151 | 125 |
| 338 | 3300046557 | Ga0495622_0258083 | Ga0495622_0258083_186_566 | 125 |
| 339 | 3300046558 | Ga0495633_0000020 | Ga0495633_0000020_143679_144056 | 125 |
| 340 | 3300046558 | Ga0495633_0000426 | Ga0495633_0000426_22984_23361 | 125 |
| 341 | 3300046558 | Ga0495633_0091302 | Ga0495633_0091302_511_891 | 125 |
| 342 | 3300046558 | Ga0495633_0273544 | Ga0495633_0273544_311_688 | 125 |
| 343 | 3300046616 | Ga0495668_0004469 | Ga0495668_0004469_1341_1718 | 125 |
| 344 | 3300046616 | Ga0495668_0021572 | Ga0495668_0021572_1816_2193 | 125 |
| 345 | 3300046616 | Ga0495668_0021986 | Ga0495668_0021986_1244_1621 | 125 |
| 346 | 3300046616 | Ga0495668_0041105 | Ga0495668_0041105_1870_2247 | 125 |
| 347 | 3300046648 | Ga0495611_0006050 | Ga0495611_0006050_3481_3858 | 125 |
| 348 | 3300046648 | Ga0495611_0016690 | Ga0495611_0016690_255_632 | 125 |
| 349 | 3300046648 | Ga0495611_0024399 | Ga0495611_0024399_1658_2035 | 125 |
| 350 | 3300046660 | Ga0495625_0000004 | Ga0495625_0000004_610636_611013 | 125 |
| 351 | 3300046660 | Ga0495625_0000624 | Ga0495625_0000624_44746_45126 | 125 |
| 352 | 3300046660 | Ga0495625_0161055 | Ga0495625_0161055_257_637 | 125 |
| 353 | 3300046663 | Ga0495635_0072452 | Ga0495635_0072452_211_591 | 125 |
| 354 | 3300046665 | Ga0495661_0000006 | Ga0495661_0000006_359004_359381 | 125 |
| 355 | 3300046665 | Ga0495661_0000009 | Ga0495661_0000009_39913_40290 | 125 |
| 356 | 3300046665 | Ga0495661_0041112 | Ga0495661_0041112_697_1074 | 125 |
| 357 | 3300046665 | Ga0495661_0144133 | Ga0495661_0144133_770_1150 | 125 |
| 358 | 3300046674 | Ga0495588_0009342 | Ga0495588_0009342_859_1239 | 125 |
| 359 | 3300046674 | Ga0495588_0025816 | Ga0495588_0025816_1857_2237 | 125 |
| 360 | 3300046674 | Ga0495588_0081384 | Ga0495588_0081384_898_1278 | 125 |
| 361 | 3300046683 | Ga0495658_0009072 | Ga0495658_0009072_3080_3460 | 125 |
| 362 | 3300046691 | Ga0495670_0003007 | Ga0495670_0003007_3938_4315 | 125 |
| 363 | 3300046692 | Ga0495671_0001461 | Ga0495671_0001461_12207_12587 | 125 |
| 364 | 3300046692 | Ga0495671_0001571 | Ga0495671_0001571_10047_10424 | 125 |
| 365 | 3300046692 | Ga0495671_0018352 | Ga0495671_0018352_2302_2679 | 125 |
| 366 | 3300046692 | Ga0495671_0025678 | Ga0495671_0025678_1456_1833 | 125 |
| 367 | 3300046694 | Ga0495649_0099266 | Ga0495649_0099266_834_1211 | 125 |
| 368 | 3300046794 | Ga0495589_0009149 | Ga0495589_0009149_1041_1418 | 125 |
| 369 | 3300046810 | Ga0495660_0001968 | Ga0495660_0001968_5550_5927 | 125 |
| 370 | 3300046810 | Ga0495660_0001969 | Ga0495660_0001969_7266_7643 | 125 |
| 371 | 3300046810 | Ga0495660_0005239 | Ga0495660_0005239_6526_6903 | 125 |
| 372 | 3300046810 | Ga0495660_0014756 | Ga0495660_0014756_1801_2178 | 125 |
| 373 | 3300046810 | Ga0495660_0269151 | Ga0495660_0269151_171_548 | 125 |
| 374 | 3300046810 | Ga0495660_0296982 | Ga0495660_0296982_187_564 | 125 |
| 375 | 3300046810 | Ga0495660_0459430 | Ga0495660_0459430_90_473 | 125 |
| 376 | 3300047320 | Ga0495672_0024061 | Ga0495672_0024061_3084_3461 | 125 |
| 377 | 3300047320 | Ga0495672_0026368 | Ga0495672_0026368_989_1366 | 125 |
| 378 | 3300047320 | Ga0495672_0046189 | Ga0495672_0046189_1403_1780 | 125 |
| 379 | 3300047320 | Ga0495672_0071765 | Ga0495672_0071765_1321_1698 | 125 |
| 380 | 3300047321 | Ga0495676_0006320 | Ga0495676_0006320_9663_10040 | 125 |
| 381 | 3300047321 | Ga0495676_0007228 | Ga0495676_0007228_405_785 | 125 |
| 382 | 3300047323 | Ga0495683_0000003 | Ga0495683_0000003_134615_134992 | 125 |
| 383 | 3300047323 | Ga0495683_0003277 | Ga0495683_0003277_7833_8210 | 125 |
| 384 | 3300047446 | Ga0495679_000066 | Ga0495679_000066_53252_53629 | 125 |
| 385 | 3300047446 | Ga0495679_001956 | Ga0495679_001956_10281_10658 | 125 |
| 386 | 3300047446 | Ga0495679_130050 | Ga0495679_130050_201_578 | 125 |
| 387 | 3300047469 | Ga0495673_0000846 | Ga0495673_0000846_1450_1827 | 125 |
| 388 | 3300047469 | Ga0495673_0002601 | Ga0495673_0002601_3597_3974 | 125 |
| 389 | 3300047469 | Ga0495673_0008081 | Ga0495673_0008081_786_1163 | 125 |
| 390 | 3300047469 | Ga0495673_0015974 | Ga0495673_0015974_966_1343 | 125 |
| 391 | 3300047469 | Ga0495673_0028944 | Ga0495673_0028944_797_1174 | 125 |
| 392 | 3300047470 | Ga0495681_0006555 | Ga0495681_0006555_5237_5614 | 125 |
| 393 | 3300047470 | Ga0495681_0020372 | Ga0495681_0020372_2715_3092 | 125 |
| 394 | 3300047470 | Ga0495681_0148150 | Ga0495681_0148150_339_716 | 125 |
| 395 | 3300047470 | Ga0495681_0205473 | Ga0495681_0205473_151_531 | 125 |
| 396 | 3300047472 | Ga0495686_0052314 | Ga0495686_0052314_444_821 | 125 |
| 397 | 3300047472 | Ga0495686_0283200 | Ga0495686_0283200_482_859 | 125 |
| 398 | 3300047673 | Ga0495593_0016457 | Ga0495593_0016457_1917_2297 | 125 |
| 399 | 3300048089 | Ga0495614_0155401 | Ga0495614_0155401_283_663 | 125 |
| 400 | 3300048091 | Ga0495626_0003278 | Ga0495626_0003278_302_679 | 125 |
| 401 | 3300048905 | Ga0496102_0786985 | Ga0496102_0786985_245_622 | 125 |
| 402 | 3300048905 | Ga0496102_1317976 | Ga0496102_1317976_97_477 | 125 |
| 403 | 3300048912 | Ga0496109_0462773 | Ga0496109_0462773_700_1089 | 125 |
| 404 | 3300048914 | Ga0496111_0625790 | Ga0496111_0625790_246_629 | 125 |
| 405 | 3300048916 | Ga0496113_1437345 | Ga0496113_1437345_84_473 | 125 |
| 406 | 3300048920 | Ga0496117_0080737 | Ga0496117_0080737_1125_1505 | 125 |
| 407 | 3300048920 | Ga0496117_0315654 | Ga0496117_0315654_247_627 | 125 |
| 408 | 3300048920 | Ga0496117_0505264 | Ga0496117_0505264_191_568 | 125 |
| 409 | 3300048920 | Ga0496117_0623653 | Ga0496117_0623653_93_485 | 125 |
| 410 | 3300048921 | Ga0496118_0023686 | Ga0496118_0023686_1622_2014 | 125 |
| 411 | 3300048921 | Ga0496118_0047685 | Ga0496118_0047685_1161_1541 | 125 |
| 412 | 3300048921 | Ga0496118_0129965 | Ga0496118_0129965_404_784 | 125 |
| 413 | 3300048924 | Ga0496121_0093760 | Ga0496121_0093760_1888_2268 | 125 |
| 414 | 3300048925 | Ga0496122_0006710 | Ga0496122_0006710_6012_6392 | 125 |
| 415 | 3300048925 | Ga0496122_0045503 | Ga0496122_0045503_260_637 | 125 |
| 416 | 3300048925 | Ga0496122_0276394 | Ga0496122_0276394_453_833 | 125 |
| 417 | 3300048926 | Ga0496123_0005642 | Ga0496123_0005642_4637_5017 | 125 |
| 418 | 3300048926 | Ga0496123_0030273 | Ga0496123_0030273_2297_2674 | 125 |
| 419 | 3300048927 | Ga0496124_0005009 | Ga0496124_0005009_12525_12905 | 125 |
| 420 | 3300048927 | Ga0496124_0007422 | Ga0496124_0007422_1024_1407 | 125 |
| 421 | 3300048927 | Ga0496124_0128712 | Ga0496124_0128712_615_995 | 125 |
| 422 | 3300048927 | Ga0496124_0168972 | Ga0496124_0168972_1261_1641 | 125 |
| 423 | 3300048928 | Ga0496125_0024163 | Ga0496125_0024163_3288_3668 | 125 |
| 424 | 3300048928 | Ga0496125_0041637 | Ga0496125_0041637_2676_3056 | 125 |
| 425 | 3300048929 | Ga0496126_0074043 | Ga0496126_0074043_2541_2921 | 125 |
| 426 | 3300049459 | Ga0495678_000007 | Ga0495678_000007_143353_143730 | 125 |
| 427 | 3300049459 | Ga0495678_000043 | Ga0495678_000043_9692_10069 | 125 |
| 428 | 3300049459 | Ga0495678_051234 | Ga0495678_051234_493_870 | 125 |
| 429 | 3300049459 | Ga0495678_124868 | Ga0495678_124868_189_566 | 125 |
| 430 | 3300049460 | Ga0495682_0000982 | Ga0495682_0000982_16453_16830 | 125 |
| 431 | 3300049679 | Ga0501249_001947 | Ga0501249_001947_3051_3431 | 125 |
| 432 | 3300049705 | Ga0501225_0006911 | Ga0501225_0006911_1117_1497 | 125 |
| 433 | 3300049758 | Ga0501241_050264 | Ga0501241_050264_269_649 | 125 |
| 434 | 3300049759 | Ga0501262_000355 | Ga0501262_000355_2437_2817 | 125 |
| 435 | 3300050489 | nmdc:mga03683_22114_c1 | nmdc:mga03683_22114_c1_1617_1997 | 125 |
| 436 | 3300050489 | nmdc:mga03683_23539_c1 | nmdc:mga03683_23539_c1_812_1192 | 125 |
| 437 | 3300050489 | nmdc:mga03683_64856_c1 | nmdc:mga03683_64856_c1_229_609 | 125 |
| 438 | 3300050490 | nmdc:mga03n38_145570_c1 | nmdc:mga03n38_145570_c1_542_922 | 125 |
| 439 | 3300050490 | nmdc:mga03n38_153649_c1 | nmdc:mga03n38_153649_c1_189_569 | 125 |
| 440 | 3300050490 | nmdc:mga03n38_55134_c1 | nmdc:mga03n38_55134_c1_963_1343 | 125 |
| 441 | 3300050491 | nmdc:mga00v17_44307_c1 | nmdc:mga00v17_44307_c1_2151_2531 | 125 |
| 442 | 3300050491 | nmdc:mga00v17_517219_c1 | nmdc:mga00v17_517219_c1_296_676 | 125 |
| 443 | 3300050491 | nmdc:mga00v17_978_c1 | nmdc:mga00v17_978_c1_1443_1826 | 125 |
| 444 | 3300050492 | nmdc:mga0yw44_185578_c1 | nmdc:mga0yw44_185578_c1_160_540 | 125 |
| 445 | 3300050492 | nmdc:mga0yw44_71309_c1 | nmdc:mga0yw44_71309_c1_724_1104 | 125 |
| 446 | 3300050493 | nmdc:mga0k408_50879_c1 | nmdc:mga0k408_50879_c1_779_1159 | 125 |
| 447 | 3300050494 | nmdc:mga06z11_73906_c1 | nmdc:mga06z11_73906_c1_733_1113 | 125 |
| 448 | 3300050496 | nmdc:mga07m45_488_c1 | nmdc:mga07m45_488_c1_4916_5296 | 125 |
| 449 | 3300050496 | nmdc:mga07m45_84669_c1 | nmdc:mga07m45_84669_c1_105_485 | 125 |
| 450 | 3300050516 | nmdc:mga0sz30_62240_c1 | nmdc:mga0sz30_62240_c1_265_645 | 125 |
| 451 | 3300053079 | Ga0500610_0004702 | Ga0500610_0004702_4179_4559 | 125 |
| 452 | 3300053093 | Ga0500651_0000052 | Ga0500651_0000052_36649_37029 | 125 |
| 453 | 3300053094 | Ga0500566_0291107 | Ga0500566_0291107_140_520 | 125 |
| 454 | 3300053107 | Ga0500560_052353 | Ga0500560_052353_458_838 | 125 |
| 455 | 3300053108 | Ga0500562_179051 | Ga0500562_179051_24_404 | 125 |
| 456 | 3300053110 | Ga0500571_000118 | Ga0500571_000118_3557_3937 | 125 |
| 457 | 3300053116 | Ga0500592_008047 | Ga0500592_008047_465_845 | 125 |
| 458 | 3300053117 | Ga0500593_000306 | Ga0500593_000306_1377_1757 | 125 |
| 459 | 3300053118 | Ga0500594_0001446 | Ga0500594_0001446_2833_3213 | 125 |
| 460 | 3300053121 | Ga0500607_001189 | Ga0500607_001189_20307_20687 | 125 |
| 461 | 3300053122 | Ga0500608_005072 | Ga0500608_005072_3354_3734 | 125 |
| 462 | 3300053133 | Ga0500655_000281 | Ga0500655_000281_3866_4246 | 125 |
| 463 | 3300053134 | Ga0500658_0000033 | Ga0500658_0000033_69483_69863 | 125 |
| 464 | 3300053134 | Ga0500658_0000040 | Ga0500658_0000040_27464_27844 | 125 |
| 465 | 3300053136 | Ga0500559_0019480 | Ga0500559_0019480_2282_2662 | 125 |
| 466 | 3300053138 | Ga0500564_098966 | Ga0500564_098966_326_706 | 125 |
| 467 | 3300053139 | Ga0500568_0008134 | Ga0500568_0008134_2883_3263 | 125 |
| 468 | 3300053141 | Ga0500574_000532 | Ga0500574_000532_2905_3285 | 125 |
| 469 | 3300053153 | Ga0500616_0050524 | Ga0500616_0050524_779_1159 | 125 |
| 470 | 3300053158 | Ga0500627_0000079 | Ga0500627_0000079_32166_32546 | 125 |
| 471 | 3300053161 | Ga0500634_0014576 | Ga0500634_0014576_1366_1746 | 125 |
| 472 | 3300053161 | Ga0500634_0047084 | Ga0500634_0047084_813_1193 | 125 |
| 473 | 3300053162 | Ga0500638_006107 | Ga0500638_006107_1465_1845 | 125 |
| 474 | 3300053177 | Ga0500636_0075606 | Ga0500636_0075606_287_667 | 125 |
| 475 | iso_pu_bacteria | 2939573065 | 2939574304 | 125 |
| 476 | 3300009011 | Ga0105251_10034433 | Ga0105251_100344333 | 126 |
| 477 | 3300009036 | Ga0105244_10005627 | Ga0105244_100056272 | 126 |
| 478 | 3300013102 | Ga0157371_10004655 | Ga0157371_100046557 | 126 |
| 479 | 3300013105 | Ga0157369_10001379 | Ga0157369_1000137921 | 126 |
| 480 | 3300025728 | Ga0207655_1075039 | Ga0207655_10750392 | 126 |
| 481 | 3300042016 | Ga0439463_000012 | Ga0439463_000012_17627_18007 | 126 |
| 482 | 3300042993 | Ga0439440_0019607 | Ga0439440_0019607_156_536 | 126 |
| 483 | 3300001989 | JGI24739J22299_10032598 | JGI24739J22299_100325981 | 127 |
| 484 | 3300002705 | JGI25156J39149_1000406 | JGI25156J39149_10004069 | 127 |
| 485 | 3300003320 | rootH2_10090600 | rootH2_100906001 | 127 |
| 486 | 3300003758 | Ga0055532_1000529 | Ga0055532_100052914 | 127 |
| 487 | 3300003760 | Ga0055527_1000291 | Ga0055527_10002914 | 127 |
| 488 | 3300003761 | Ga0055535_1000506 | Ga0055535_100050615 | 127 |
| 489 | 3300003762 | Ga0055542_1000502 | Ga0055542_100050227 | 127 |
| 490 | 3300003763 | Ga0055529_1000495 | Ga0055529_100049515 | 127 |
| 491 | 3300005339 | Ga0070660_100001233 | Ga0070660_10000123310 | 127 |
| 492 | 3300005366 | Ga0070659_100000055 | Ga0070659_10000005583 | 127 |
| 493 | 3300005455 | Ga0070663_100335726 | Ga0070663_1003357262 | 127 |
| 494 | 3300005563 | Ga0068855_100686995 | Ga0068855_1006869951 | 127 |
| 495 | 3300005564 | Ga0070664_100208222 | Ga0070664_1002082222 | 127 |
| 496 | 3300005616 | Ga0068852_100013927 | Ga0068852_1000139276 | 127 |
| 497 | 3300009092 | Ga0105250_10000117 | Ga0105250_1000011743 | 127 |
| 498 | 3300009093 | Ga0105240_10018272 | Ga0105240_100182722 | 127 |
| 499 | 3300009545 | Ga0105237_10097776 | Ga0105237_100977763 | 127 |
| 500 | 3300009551 | Ga0105238_10088529 | Ga0105238_100885292 | 127 |
| 501 | 3300010375 | Ga0105239_10007284 | Ga0105239_1000728410 | 127 |
| 502 | 3300013100 | Ga0157373_10052060 | Ga0157373_100520603 | 127 |
| 503 | 3300013104 | Ga0157370_10070692 | Ga0157370_100706923 | 127 |
| 504 | 3300013104 | Ga0157370_10210915 | Ga0157370_102109152 | 127 |
| 505 | 3300013105 | Ga0157369_10897441 | Ga0157369_108974412 | 127 |
| 506 | 3300013296 | Ga0157374_11535429 | Ga0157374_115354291 | 127 |
| 507 | 3300013307 | Ga0157372_10783696 | Ga0157372_107836961 | 127 |
| 508 | 3300015261 | Ga0182006_1048631 | Ga0182006_10486312 | 127 |
| 509 | 3300015262 | Ga0182007_10000583 | Ga0182007_1000058320 | 127 |
| 510 | 3300025225 | Ga0209566_100258 | Ga0209566_10025811 | 127 |
| 511 | 3300025228 | Ga0209672_100080 | Ga0209672_10008015 | 127 |
| 512 | 3300025229 | Ga0209147_100071 | Ga0209147_100071195 | 127 |
| 513 | 3300025229 | Ga0209147_100091 | Ga0209147_10009153 | 127 |
| 514 | 3300025242 | Ga0209258_100082 | Ga0209258_10008215 | 127 |
| 515 | 3300025254 | Ga0209148_1000195 | Ga0209148_100019579 | 127 |
| 516 | 3300025256 | Ga0209759_1000236 | Ga0209759_100023632 | 127 |
| 517 | 3300025272 | Ga0209455_1000172 | Ga0209455_100017279 | 127 |
| 518 | 3300025273 | Ga0209673_1000076 | Ga0209673_1000076108 | 127 |
| 519 | 3300025291 | Ga0209675_1033765 | Ga0209675_10337652 | 127 |
| 520 | 3300025295 | Ga0209564_1092679 | Ga0209564_10926791 | 127 |
| 521 | 3300025711 | Ga0207696_1000170 | Ga0207696_100017077 | 127 |
| 522 | 3300025904 | Ga0207647_10001075 | Ga0207647_1000107515 | 127 |
| 523 | 3300025909 | Ga0207705_10454097 | Ga0207705_104540972 | 127 |
| 524 | 3300025913 | Ga0207695_10000268 | Ga0207695_10000268112 | 127 |
| 525 | 3300025914 | Ga0207671_10028223 | Ga0207671_100282233 | 127 |
| 526 | 3300025919 | Ga0207657_10000087 | Ga0207657_1000008780 | 127 |
| 527 | 3300025924 | Ga0207694_10075553 | Ga0207694_100755533 | 127 |
| 528 | 3300025932 | Ga0207690_10000071 | Ga0207690_1000007181 | 127 |
| 529 | 3300025945 | Ga0207679_10620183 | Ga0207679_106201832 | 127 |
| 530 | 3300025949 | Ga0207667_10058539 | Ga0207667_100585393 | 127 |
| 531 | 3300026142 | Ga0207698_10009359 | Ga0207698_100093596 | 127 |
| 532 | 3300027312 | Ga0209371_1000713 | Ga0209371_100071319 | 127 |
| 533 | 3300030083 | Ga0237817_14244 | Ga0237817_142441 | 127 |
| 534 | 3300030500 | Ga0268256_1000608 | Ga0268256_100060814 | 127 |
| 535 | 3300037466 | Ga0395898_0209753 | Ga0395898_0209753_1158_1541 | 127 |
| 536 | 3300042011 | Ga0439454_067965 | Ga0439454_067965_106_537 | 127 |
| 537 | 3300044693 | Ga0466961_0168972 | Ga0466961_0168972_403_786 | 127 |
| 538 | 3300044765 | Ga0466970_0084980 | Ga0466970_0084980_937_1320 | 127 |
| 539 | 3300044842 | Ga0466957_0072122 | Ga0466957_0072122_1450_1833 | 127 |
| 540 | 3300045049 | Ga0466959_0552902 | Ga0466959_0552902_160_543 | 127 |
| 541 | 3300046472 | Ga0495580_0002292 | Ga0495580_0002292_9067_9450 | 127 |
| 542 | 3300046474 | Ga0495605_0208814 | Ga0495605_0208814_443_826 | 127 |
| 543 | 3300046507 | Ga0495606_0000360 | Ga0495606_0000360_20279_20665 | 127 |
| 544 | 3300046524 | Ga0495648_0003240 | Ga0495648_0003240_5914_6297 | 127 |
| 545 | 3300047323 | Ga0495683_0103674 | Ga0495683_0103674_914_1297 | 127 |
| 546 | 3300048904 | Ga0496101_0685048 | Ga0496101_0685048_89_472 | 127 |
| 547 | 3300048905 | Ga0496102_1265770 | Ga0496102_1265770_143_526 | 127 |
| 548 | 3300048907 | Ga0496104_0884538 | Ga0496104_0884538_230_613 | 127 |
| 549 | 3300048907 | Ga0496104_0951144 | Ga0496104_0951144_145_528 | 127 |
| 550 | 3300048919 | Ga0496116_0232549 | Ga0496116_0232549_519_902 | 127 |
| 551 | 3300048921 | Ga0496118_0035743 | Ga0496118_0035743_2923_3306 | 127 |
| 552 | 3300048921 | Ga0496118_0344714 | Ga0496118_0344714_243_626 | 127 |
| 553 | 3300048923 | Ga0496120_0410442 | Ga0496120_0410442_108_491 | 127 |
| 554 | 3300048924 | Ga0496121_0078267 | Ga0496121_0078267_1864_2247 | 127 |
| 555 | 3300048925 | Ga0496122_0040955 | Ga0496122_0040955_219_623 | 127 |
| 556 | 3300048927 | Ga0496124_0006343 | Ga0496124_0006343_7778_8200 | 127 |
| 557 | 3300048927 | Ga0496124_0047139 | Ga0496124_0047139_2944_3348 | 127 |
| 558 | 3300048928 | Ga0496125_0000055 | Ga0496125_0000055_94451_94855 | 127 |
| 559 | 3300048986 | Ga0466983_0488659 | Ga0466983_0488659_276_659 | 127 |
| 560 | 3300050509 | nmdc:mga0qj67_31033_c1 | nmdc:mga0qj67_31033_c1_1466_1852 | 127 |
| 561 | 3300061719 | Ga0466962_0047799 | Ga0466962_0047799_1515_1898 | 127 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3hnq-assembly1.cif.gz_A | crystal structure of virulence protein stm3117 from salmonella typhimurium. northeast structural genomics consortium target id str274 | 0.9594 | 2 | 127 |
| 3zw5-assembly1.cif.gz_B | crystal structure of the human glyoxalase domain-containing protein 5 | 0.957 | 4 | 125 |
| 3zw5-assembly1.cif.gz_A | crystal structure of the human glyoxalase domain-containing protein 5 | 0.956 | 3 | 125 |
| 3hnq-assembly1.cif.gz_A | crystal structure of virulence protein stm3117 from salmonella typhimurium. northeast structural genomics consortium target id str274 | 0.952 | 2 | 127 |
| 3huh-assembly2.cif.gz_C | the structure of biphenyl-2,3-diol 1,2-dioxygenase iii-related protein from salmonella typhimurium | 0.9511 | 3 | 125 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_A6NK44_39_157_3.10.180.10 | Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 | 0.9681 | 8 | 125 | 3.10.180.10 |
| af_A6NK44_39_157_3.10.180.10 | Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 | 0.9524 | 8 | 125 | 3.10.180.10 |
| 2i7rB00 | Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 | 0.7998 | 6 | 125 | 3.10.180.10 |
| 3itwA02 | Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; | 0.7926 | 71 | 127 | 3.30.720.110 |
| 2i7rB00 | Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 | 0.7872 | 6 | 125 | 3.10.180.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A0P9Z811-F1-model_v4 | Uncharacterized protein | 1.004 | 67 | 127 |
|
| AF-A0A0P9MU27-F1-model_v4 | Glyoxalase/bleomycin resistance protein/dioxygenase | 1.002 | 67 | 125 |
GO:0051213
|
| AF-A0A741VTR4-F1-model_v4 | VOC family protein | 0.9907 | 65 | 127 |
|
| AF-A0A2K8W4I0-F1-model_v4 | deleted | 0.9827 | 3 | 127 |
|
| AF-E0SGR6-F1-model_v4 | Glyoxalase/bleomycin resistance protein/dioxygenase | 0.9821 | 2 | 127 |
GO:0051213
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar