F463829

General Info

Members Datasets Scaffolds Average Seq Length
561 224 1122 335

Family's Representative Sequence

Representative Sequence 3300025911|Ga0207654_10032274|Ga0207654_100322742
Length 327
Sequence MASQPSSFIVTLPKAELHLHLEGAIDPTTLLELRQRHGKNSTLAEIEQLYSYQDFNGFLMAFKAVTEDLQTAGDYELITYRLMERLRAQNVLHAEVYVSVGVCLWRKQNFDALFEGERDFGVSLLWIFDAVRQFGPVAAREVFEVAVRHRERKVVAIGIGGDEQKGPPELFRDAYAYAADNGLHLTAHAGENAGPESIWGALNLRAERIGHGLTAAQDPELVEELATRQVPVEICITSNLRTGACPSLNAHPVRQYFDQGIMITLNTDDPAMFRTSLAREYHLAQQSFGFNEEHLRELARNSFEASFLPAEEKLTFLNLFDAAAAHT

Samples

Sample ID Description Type Environment
1 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 3300000546 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled Metagenome Rhizosphere
3 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
14 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
15 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
16 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
17 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
18 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
19 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
20 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
21 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
22 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
23 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
24 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
25 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
26 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
27 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
28 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
29 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
30 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
31 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
32 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
33 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
34 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
35 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
36 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
37 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
38 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
39 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
40 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
41 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
42 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
43 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
44 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
45 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
46 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
47 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
48 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
49 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
50 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
51 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
52 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
53 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
54 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
55 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
56 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
57 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
58 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
59 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
60 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
61 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
62 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
63 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
64 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
65 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
66 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
67 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
68 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
69 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
70 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
71 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
72 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
73 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
74 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
75 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
76 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
77 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
78 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
79 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
80 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
81 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
82 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
83 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
84 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
85 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
86 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
87 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
88 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
89 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
90 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
91 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
92 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
93 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
94 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
95 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
96 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
97 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
98 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
99 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
100 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
101 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
102 3300022730 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU2 Metagenome Rhizosphere
103 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
104 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300028017 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 Metagenome Rhizosphere
158 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
162 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
163 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
164 3300030879 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
165 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
166 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
167 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
168 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
169 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
170 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
171 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
172 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
173 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
174 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
175 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
176 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
177 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
178 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
179 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
180 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
181 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
182 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
183 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
184 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
185 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
186 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
187 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
188 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
189 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
190 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
191 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
192 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
193 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
194 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
195 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
196 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
197 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
198 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
199 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
200 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
201 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
202 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
203 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
204 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
205 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
206 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
207 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
208 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
209 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
210 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
211 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
212 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
213 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
214 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
215 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
216 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
217 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
218 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
219 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
220 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
221 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
222 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
223 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
224 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.75
Metatranscriptomes 1.25
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 6.06
Rhizosphere 93.4
Stem 0
Stem Tuber 0
Unclassified 13.37

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207654_10032274 3300025911 Bacteria 2892
2 LJNas_1003006 3300000546 Unclassified 1977
3 JGI24751J29686_10003429 3300002459 Bacteria 3194
4 Ga0070658_10081821 3300005327 Bacteria 2653
5 Ga0070676_10025864 3300005328 Bacteria 3320
6 Ga0070683_100018324 3300005329 Bacteria 6199
7 Ga0070683_100023492 3300005329 Bacteria 5515
8 Ga0070683_100024117 3300005329 Bacteria 5445
9 Ga0070683_100052543 3300005329 Bacteria 3775
10 Ga0070670_100027685 3300005331 Bacteria 4876
11 Ga0070670_100054588 3300005331 Bacteria 3430
12 Ga0070670_100470003 3300005331 Unclassified 1116
13 Ga0070677_10002404 3300005333 Bacteria 5970
14 Ga0068869_100002204 3300005334 Bacteria 11719
15 Ga0068869_100312386 3300005334 Bacteria 1272
16 Ga0070680_100159343 3300005336 Bacteria 1896
17 Ga0070680_100167303 3300005336 Bacteria 1849
18 Ga0068868_100020989 3300005338 Bacteria 4918
19 Ga0068868_100023084 3300005338 Bacteria 4705
20 Ga0068868_100025396 3300005338 Unclassified 4507
21 Ga0068868_100064127 3300005338 Bacteria 2916
22 Ga0068868_100070792 3300005338 Unclassified 2781
23 Ga0068868_100100585 3300005338 Unclassified 2339
24 Ga0068868_100105500 3300005338 Bacteria 2285
25 Ga0070660_100007536 3300005339 Bacteria 7586
26 Ga0070660_100025125 3300005339 Bacteria 4426
27 Ga0070660_100084745 3300005339 Bacteria 2491
28 Ga0070689_100020369 3300005340 Bacteria 4920
29 Ga0070687_100098200 3300005343 Bacteria 1634
30 Ga0070661_100010313 3300005344 Bacteria 6495
31 Ga0070661_100041719 3300005344 Bacteria 3348
32 Ga0070668_100020879 3300005347 Bacteria 4946
33 Ga0070668_100041307 3300005347 Unclassified 3533
34 Ga0070669_100028398 3300005353 Bacteria 4029
35 Ga0070671_100059308 3300005355 Bacteria 3184
36 Ga0070674_100010264 3300005356 Bacteria 5651
37 Ga0070659_100018381 3300005366 Bacteria 5277
38 Ga0070659_100150790 3300005366 Unclassified 1896
39 Ga0070667_100106558 3300005367 Unclassified 2426
40 Ga0070709_10000485 3300005434 Bacteria 23474
41 Ga0070709_10025278 3300005434 Bacteria 3507
42 Ga0070709_10049384 3300005434 Bacteria 2631
43 Ga0070709_10053840 3300005434 Bacteria 2535
44 Ga0070709_10136578 3300005434 Unclassified 1680
45 Ga0070709_10267630 3300005434 Bacteria 1237
46 Ga0070714_100007931 3300005435 Bacteria 8271
47 Ga0070714_100082097 3300005435 Bacteria 2807
48 Ga0070714_100183996 3300005435 Bacteria 1903
49 Ga0070713_100000163 3300005436 Bacteria 45293
50 Ga0070713_100000820 3300005436 Bacteria 19932
51 Ga0070713_100058988 3300005436 Bacteria 3203
52 Ga0070713_100086136 3300005436 Bacteria 2693
53 Ga0070713_100144437 3300005436 Unclassified 2110
54 Ga0070710_10006894 3300005437 Bacteria 5482
55 Ga0070710_10027233 3300005437 Bacteria 3046
56 Ga0070711_100008538 3300005439 Bacteria 6278
57 Ga0070694_100052640 3300005444 Bacteria 2752
58 Ga0070708_100000415 3300005445 Bacteria 31989
59 Ga0070708_100000611 3300005445 Bacteria 26919
60 Ga0070708_100004519 3300005445 Bacteria 10952
61 Ga0070708_100014892 3300005445 Bacteria 6410
62 Ga0070708_100045758 3300005445 Bacteria 3858
63 Ga0070708_100396191 3300005445 Unclassified 1302
64 Ga0070678_100331065 3300005456 Bacteria 1303
65 Ga0070662_100007633 3300005457 Bacteria 7020
66 Ga0070662_100019596 3300005457 Bacteria 4594
67 Ga0070681_10000134 3300005458 Bacteria 56209
68 Ga0070681_10066174 3300005458 Bacteria 3582
69 Ga0070681_10342455 3300005458 Bacteria 1405
70 Ga0068867_100006250 3300005459 Bacteria 8426
71 Ga0068867_100184384 3300005459 Bacteria 1661
72 Ga0068867_100195140 3300005459 Bacteria 1618
73 Ga0070685_10019709 3300005466 Bacteria 3643
74 Ga0070685_10030771 3300005466 Bacteria 2994
75 Ga0070706_100002374 3300005467 Bacteria 19022
76 Ga0070706_100002562 3300005467 Bacteria 18279
77 Ga0070706_100003656 3300005467 Bacteria 15050
78 Ga0070706_100028654 3300005467 Bacteria 5128
79 Ga0070706_100033860 3300005467 Bacteria 4716
80 Ga0070706_100034180 3300005467 Bacteria 4695
81 Ga0070706_100301430 3300005467 Bacteria 1495
82 Ga0070707_100000278 3300005468 Bacteria 50450
83 Ga0070707_100000663 3300005468 Bacteria 34278
84 Ga0070707_100020358 3300005468 Bacteria 6258
85 Ga0070707_100290833 3300005468 Bacteria 1588
86 Ga0070707_100316685 3300005468 Bacteria 1516
87 Ga0070707_100413076 3300005468 Unclassified 1310
88 Ga0070698_100000203 3300005471 Bacteria 57165
89 Ga0070698_100007473 3300005471 Bacteria 11824
90 Ga0070698_100019203 3300005471 Bacteria 7182
91 Ga0070699_100000706 3300005518 Bacteria 30940
92 Ga0070699_100001034 3300005518 Bacteria 25839
93 Ga0070699_100025461 3300005518 Bacteria 5100
94 Ga0070699_100045693 3300005518 Unclassified 3790
95 Ga0070699_100284135 3300005518 Unclassified 1482
96 Ga0070679_100034387 3300005530 Bacteria 5023
97 Ga0070679_100157477 3300005530 Bacteria 2246
98 Ga0070684_100007884 3300005535 Bacteria 8306
99 Ga0070684_100074922 3300005535 Unclassified 2984
100 Ga0070684_100124573 3300005535 Bacteria 2320
101 Ga0070697_100000053 3300005536 Bacteria 88025
102 Ga0070697_100000375 3300005536 Bacteria 34936
103 Ga0070697_100001907 3300005536 Bacteria 15957
104 Ga0070697_100004705 3300005536 Bacteria 10460
105 Ga0070697_100010820 3300005536 Bacteria 7125
106 Ga0070697_100020303 3300005536 Bacteria 5254
107 Ga0070697_100049833 3300005536 Unclassified 3398
108 Ga0068853_100025237 3300005539 Bacteria 4987
109 Ga0068853_100046851 3300005539 Bacteria 3709
110 Ga0068853_100065296 3300005539 Bacteria 3158
111 Ga0068853_100081989 3300005539 Unclassified 2825
112 Ga0068853_100111089 3300005539 Bacteria 2435
113 Ga0070672_100279759 3300005543 Bacteria 1410
114 Ga0070686_100017387 3300005544 Bacteria 4201
115 Ga0070686_100029466 3300005544 Bacteria 3340
116 Ga0070693_100078478 3300005547 Bacteria 1962
117 Ga0070665_100003957 3300005548 Bacteria 15626
118 Ga0068855_100009417 3300005563 Bacteria 11796
119 Ga0068855_100013448 3300005563 Bacteria 9867
120 Ga0068855_100058499 3300005563 Bacteria 4514
121 Ga0068855_100126740 3300005563 Bacteria 2918
122 Ga0068855_100259029 3300005563 Bacteria 1938
123 Ga0070664_100000499 3300005564 Bacteria 29728
124 Ga0070664_100046454 3300005564 Bacteria 3667
125 Ga0070664_100156519 3300005564 Bacteria 2014
126 Ga0070664_100224011 3300005564 Unclassified 1683
127 Ga0070664_100346174 3300005564 Bacteria 1351
128 Ga0068857_100000884 3300005577 Bacteria 22647
129 Ga0068857_100004174 3300005577 Bacteria 12166
130 Ga0068857_100007990 3300005577 Bacteria 9131
131 Ga0068857_100064556 3300005577 Bacteria 3255
132 Ga0068856_100001233 3300005614 Bacteria 26823
133 Ga0068856_100003730 3300005614 Bacteria 15271
134 Ga0068856_100003905 3300005614 Bacteria 14948
135 Ga0068856_100010421 3300005614 Bacteria 9026
136 Ga0068856_100055393 3300005614 Bacteria 3913
137 Ga0068856_100090171 3300005614 Bacteria 3050
138 Ga0068856_100156594 3300005614 Unclassified 2288
139 Ga0068852_100046020 3300005616 Unclassified 3715
140 Ga0068852_100151687 3300005616 Bacteria 2156
141 Ga0068859_100004449 3300005617 Bacteria 14303
142 Ga0068859_100007294 3300005617 Bacteria 11215
143 Ga0068859_100014487 3300005617 Bacteria 7916
144 Ga0068864_100248952 3300005618 Bacteria 1649
145 Ga0068866_10003960 3300005718 Bacteria 6080
146 Ga0068866_10014119 3300005718 Unclassified 3519
147 Ga0068866_10063861 3300005718 Bacteria 1920
148 Ga0068861_100100849 3300005719 Bacteria 2295
149 Ga0068851_10028713 3300005834 Bacteria 2748
150 Ga0068870_10006415 3300005840 Bacteria 5184
151 Ga0068870_10039062 3300005840 Bacteria 2454
152 Ga0068863_100012976 3300005841 Bacteria 8035
153 Ga0068863_100080022 3300005841 Unclassified 3095
154 Ga0068863_100148475 3300005841 Bacteria 2243
155 Ga0068863_100290043 3300005841 Bacteria 1586
156 Ga0068858_100001221 3300005842 Bacteria 26605
157 Ga0068858_100010190 3300005842 Bacteria 8922
158 Ga0068858_100018673 3300005842 Bacteria 6491
159 Ga0068858_100056602 3300005842 Bacteria 3623
160 Ga0068858_100213043 3300005842 Bacteria 1828
161 Ga0068860_100053366 3300005843 Unclassified 3843
162 Ga0068860_100086935 3300005843 Bacteria 2976
163 Ga0068862_100017239 3300005844 Bacteria 6011
164 Ga0068862_100074042 3300005844 Bacteria 2944
165 Ga0068862_100139600 3300005844 Bacteria 2150
166 Ga0070717_10000434 3300006028 Bacteria 26649
167 Ga0070717_10001900 3300006028 Bacteria 14613
168 Ga0070717_10002031 3300006028 Bacteria 14168
169 Ga0070717_10004595 3300006028 Bacteria 9996
170 Ga0070717_10009346 3300006028 Bacteria 7367
171 Ga0070717_10014111 3300006028 Bacteria 6140
172 Ga0070717_10049287 3300006028 Bacteria 3457
173 Ga0070717_10080474 3300006028 Bacteria 2733
174 Ga0070717_10085014 3300006028 Bacteria 2662
175 Ga0070717_10085403 3300006028 Bacteria 2656
176 Ga0070717_10147174 3300006028 Bacteria 2035
177 Ga0070717_10264818 3300006028 Unclassified 1521
178 Ga0070715_10062964 3300006163 Unclassified 1634
179 Ga0070716_100003028 3300006173 Bacteria 7840
180 Ga0070716_100014105 3300006173 Bacteria 4088
181 Ga0070716_100014511 3300006173 Bacteria 4035
182 Ga0070716_100222895 3300006173 Bacteria 1268
183 Ga0070712_100001721 3300006175 Bacteria 13392
184 Ga0070712_100001995 3300006175 Bacteria 12494
185 Ga0070712_100005936 3300006175 Bacteria 7551
186 Ga0070712_100015869 3300006175 Bacteria 4856
187 Ga0070712_100017275 3300006175 Bacteria 4668
188 Ga0070712_100052120 3300006175 Bacteria 2852
189 Ga0070712_100060780 3300006175 Bacteria 2666
190 Ga0097621_100000429 3300006237 Bacteria 29289
191 Ga0097621_100004346 3300006237 Bacteria 9853
192 Ga0097621_100063789 3300006237 Bacteria 3028
193 Ga0068871_100000253 3300006358 Bacteria 37196
194 Ga0068871_100001029 3300006358 Bacteria 18670
195 Ga0068871_100013150 3300006358 Bacteria 6137
196 Ga0068871_100013157 3300006358 Bacteria 6136
197 Ga0068871_100070222 3300006358 Bacteria 2878
198 Ga0068871_100417625 3300006358 Bacteria 1197
199 Ga0075434_100000016 3300006871 Bacteria 75294
200 Ga0075434_100001835 3300006871 Bacteria 18336
201 Ga0068865_100005497 3300006881 Bacteria 7689
202 Ga0068865_100010510 3300006881 Bacteria 5764
203 Ga0068865_100094050 3300006881 Bacteria 2180
204 Ga0075436_100000459 3300006914 Bacteria 26338
205 Ga0075436_100091960 3300006914 Bacteria 2109
206 Ga0097620_100004449 3300006931 Bacteria 14303
207 Ga0097620_100007294 3300006931 Bacteria 11215
208 Ga0097620_100014485 3300006931 Bacteria 7916
209 Ga0075435_100000506 3300007076 Bacteria 23788
210 Ga0075435_100405235 3300007076 Unclassified 1173
211 Ga0099795_10016008 3300007788 Bacteria 2363
212 Ga0105240_10017591 3300009093 Bacteria 9631
213 Ga0105240_10030768 3300009093 Bacteria 6972
214 Ga0105240_10032933 3300009093 Bacteria 6702
215 Ga0105240_10248398 3300009093 Bacteria 2059
216 Ga0105240_10338625 3300009093 Bacteria 1709
217 Ga0105245_10020080 3300009098 Bacteria 5857
218 Ga0105247_10002792 3300009101 Bacteria 11684
219 Ga0105247_10084525 3300009101 Bacteria 2005
220 Ga0114129_10388833 3300009147 Unclassified 1840
221 Ga0105243_10015513 3300009148 Bacteria 5761
222 Ga0105241_10182318 3300009174 Bacteria 1742
223 Ga0105242_10021612 3300009176 Bacteria 5054
224 Ga0105248_10009328 3300009177 Bacteria 10807
225 Ga0105248_10031889 3300009177 Bacteria 5888
226 Ga0105248_10057819 3300009177 Bacteria 4354
227 Ga0105237_10072019 3300009545 Bacteria 3450
228 Ga0105237_10107925 3300009545 Unclassified 2776
229 Ga0105237_10185612 3300009545 Bacteria 2080
230 Ga0105238_10010053 3300009551 Bacteria 9493
231 Ga0105238_10013565 3300009551 Bacteria 8226
232 Ga0105238_10033787 3300009551 Bacteria 5204
233 Ga0105238_10232257 3300009551 Bacteria 1821
234 Ga0105238_10250666 3300009551 Bacteria 1749
235 Ga0105249_10010222 3300009553 Bacteria 8242
236 Ga0105249_10035076 3300009553 Bacteria 4547
237 Ga0105249_10059070 3300009553 Bacteria 3516
238 Ga0105239_10033287 3300010375 Bacteria 5661
239 Ga0105239_10046762 3300010375 Bacteria 4743
240 Ga0105239_10829982 3300010375 Bacteria 1059
241 Ga0105246_10044926 3300011119 Bacteria 3005
242 Ga0105246_10174869 3300011119 Bacteria 1648
243 Ga0157373_10010490 3300013100 Bacteria 6816
244 Ga0157373_10056764 3300013100 Bacteria 2779
245 Ga0157373_10088812 3300013100 Unclassified 2177
246 Ga0157373_10101489 3300013100 Unclassified 2024
247 Ga0157371_10013907 3300013102 Bacteria 6095
248 Ga0157371_10015643 3300013102 Bacteria 5683
249 Ga0157370_10034655 3300013104 Bacteria 4911
250 Ga0157370_10058075 3300013104 Bacteria 3677
251 Ga0157369_10000497 3300013105 Bacteria 52025
252 Ga0157369_10006632 3300013105 Bacteria 13387
253 Ga0157369_10031256 3300013105 Bacteria 5865
254 Ga0157369_10105983 3300013105 Unclassified 2992
255 Ga0157369_10169138 3300013105 Unclassified 2304
256 Ga0157374_10000735 3300013296 Bacteria 28588
257 Ga0157374_10000866 3300013296 Bacteria 26455
258 Ga0157374_10007513 3300013296 Bacteria 9297
259 Ga0157374_10011216 3300013296 Bacteria 7750
260 Ga0157374_10014756 3300013296 Bacteria 6842
261 Ga0157374_10017931 3300013296 Bacteria 6239
262 Ga0157374_10022644 3300013296 Bacteria 5606
263 Ga0157374_10047547 3300013296 Unclassified 3978
264 Ga0157374_10125769 3300013296 Bacteria 2478
265 Ga0157378_10000055 3300013297 Bacteria 97875
266 Ga0157378_10000397 3300013297 Bacteria 42878
267 Ga0157378_10011282 3300013297 Bacteria 7820
268 Ga0157378_10229193 3300013297 Bacteria 1769
269 Ga0163162_10021429 3300013306 Bacteria 6365
270 Ga0163162_10032005 3300013306 Bacteria 5220
271 Ga0163162_10042171 3300013306 Bacteria 4566
272 Ga0163162_10168535 3300013306 Bacteria 2314
273 Ga0157372_10000390 3300013307 Bacteria 48665
274 Ga0157372_10003595 3300013307 Bacteria 16685
275 Ga0157372_10010189 3300013307 Bacteria 9981
276 Ga0157372_10019569 3300013307 Bacteria 7297
277 Ga0157372_10020727 3300013307 Bacteria 7096
278 Ga0157372_10031391 3300013307 Bacteria 5817
279 Ga0157372_10040501 3300013307 Bacteria 5147
280 Ga0157372_10095177 3300013307 Bacteria 3393
281 Ga0157372_10329375 3300013307 Bacteria 1778
282 Ga0157375_10013298 3300013308 Bacteria 7319
283 Ga0163163_10028075 3300014325 Bacteria 5399
284 Ga0163163_10101760 3300014325 Unclassified 2896
285 Ga0163163_10234752 3300014325 Unclassified 1883
286 Ga0157380_10336692 3300014326 Bacteria 1406
287 Ga0182008_10026088 3300014497 Bacteria 2964
288 Ga0157377_10000793 3300014745 Bacteria 13059
289 Ga0157376_10039435 3300014969 Bacteria 3852
290 Ga0157376_10071122 3300014969 Bacteria 2955
291 Ga0157376_10117002 3300014969 Bacteria 2356
292 Ga0182006_1073403 3300015261 Unclassified 1263
293 Ga0182005_1010249 3300015265 Bacteria 2701
294 Ga0224570_100787 3300022730 Bacteria 2531
295 Ga0228598_1001230 3300024227 Bacteria 5659
296 Ga0207656_10045208 3300025321 Unclassified 1884
297 Ga0207692_10003093 3300025898 Bacteria 6465
298 Ga0207692_10050828 3300025898 Bacteria 2098
299 Ga0207692_10121424 3300025898 Bacteria 1464
300 Ga0207710_10039052 3300025900 Bacteria 2100
301 Ga0207688_10002244 3300025901 Bacteria 10414
302 Ga0207680_10064450 3300025903 Bacteria 2246
303 Ga0207647_10002049 3300025904 Bacteria 15401
304 Ga0207647_10007573 3300025904 Bacteria 7832
305 Ga0207685_10008498 3300025905 Unclassified 2927
306 Ga0207699_10001011 3300025906 Bacteria 13313
307 Ga0207699_10012598 3300025906 Bacteria 4306
308 Ga0207699_10012880 3300025906 Bacteria 4262
309 Ga0207699_10106233 3300025906 Bacteria 1791
310 Ga0207645_10005280 3300025907 Bacteria 9406
311 Ga0207645_10005800 3300025907 Bacteria 8910
312 Ga0207643_10002087 3300025908 Bacteria 11007
313 Ga0207705_10073049 3300025909 Bacteria 2488
314 Ga0207684_10003282 3300025910 Bacteria 15868
315 Ga0207684_10003387 3300025910 Bacteria 15613
316 Ga0207684_10003840 3300025910 Bacteria 14465
317 Ga0207684_10027260 3300025910 Bacteria 4870
318 Ga0207684_10030971 3300025910 Bacteria 4553
319 Ga0207684_10044026 3300025910 Bacteria 3785
320 Ga0207684_10157956 3300025910 Bacteria 1952
321 Ga0207654_10012826 3300025911 Bacteria 4301
322 Ga0207654_10080119 3300025911 Bacteria 1963
323 Ga0207707_10006958 3300025912 Bacteria 9863
324 Ga0207695_10023518 3300025913 Bacteria 6958
325 Ga0207695_10030023 3300025913 Bacteria 5994
326 Ga0207695_10049304 3300025913 Bacteria 4441
327 Ga0207695_10093664 3300025913 Bacteria 3013
328 Ga0207695_10167812 3300025913 Bacteria 2122
329 Ga0207695_10198452 3300025913 Bacteria 1922
330 Ga0207695_10279273 3300025913 Bacteria 1564
331 Ga0207671_10057747 3300025914 Bacteria 2876
332 Ga0207671_10102741 3300025914 Bacteria 2167
333 Ga0207693_10000154 3300025915 Bacteria 63487
334 Ga0207693_10000257 3300025915 Bacteria 48954
335 Ga0207693_10002662 3300025915 Bacteria 15515
336 Ga0207693_10016780 3300025915 Bacteria 5845
337 Ga0207693_10019973 3300025915 Bacteria 5328
338 Ga0207693_10058590 3300025915 Bacteria 3017
339 Ga0207693_10167654 3300025915 Bacteria 1729
340 Ga0207663_10012509 3300025916 Bacteria 4589
341 Ga0207663_10178137 3300025916 Bacteria 1516
342 Ga0207660_10136652 3300025917 Bacteria 1871
343 Ga0207660_10212230 3300025917 Bacteria 1516
344 Ga0207657_10002191 3300025919 Bacteria 21170
345 Ga0207657_10002806 3300025919 Bacteria 18750
346 Ga0207657_10029291 3300025919 Bacteria 5014
347 Ga0207649_10000232 3300025920 Bacteria 45423
348 Ga0207649_10051286 3300025920 Unclassified 2555
349 Ga0207649_10108869 3300025920 Bacteria 1847
350 Ga0207646_10000348 3300025922 Bacteria 62738
351 Ga0207646_10001451 3300025922 Bacteria 29389
352 Ga0207646_10053568 3300025922 Bacteria 3609
353 Ga0207646_10190237 3300025922 Bacteria 1854
354 Ga0207694_10005870 3300025924 Bacteria 9411
355 Ga0207694_10058792 3300025924 Unclassified 2990
356 Ga0207694_10066688 3300025924 Bacteria 2808
357 Ga0207694_10087685 3300025924 Unclassified 2452
358 Ga0207650_10000122 3300025925 Bacteria 99309
359 Ga0207650_10068423 3300025925 Bacteria 2666
360 Ga0207650_10117807 3300025925 Bacteria 2064
361 Ga0207700_10000152 3300025928 Bacteria 41334
362 Ga0207700_10011063 3300025928 Bacteria 5736
363 Ga0207700_10044133 3300025928 Unclassified 3280
364 Ga0207700_10083210 3300025928 Bacteria 2505
365 Ga0207700_10309675 3300025928 Unclassified 1366
366 Ga0207664_10000076 3300025929 Bacteria 102019
367 Ga0207664_10005832 3300025929 Bacteria 8422
368 Ga0207664_10046224 3300025929 Bacteria 3416
369 Ga0207664_10077242 3300025929 Bacteria 2698
370 Ga0207664_10087075 3300025929 Bacteria 2553
371 Ga0207664_10393943 3300025929 Bacteria 1231
372 Ga0207644_10094917 3300025931 Bacteria 2229
373 Ga0207644_10111902 3300025931 Bacteria 2066
374 Ga0207706_10004321 3300025933 Bacteria 13348
375 Ga0207706_10004432 3300025933 Bacteria 13196
376 Ga0207686_10210267 3300025934 Bacteria 1398
377 Ga0207709_10141552 3300025935 Unclassified 1654
378 Ga0207669_10154967 3300025937 Bacteria 1610
379 Ga0207704_10003411 3300025938 Bacteria 7218
380 Ga0207704_10018131 3300025938 Bacteria 3667
381 Ga0207665_10002806 3300025939 Bacteria 11676
382 Ga0207665_10005963 3300025939 Bacteria 8106
383 Ga0207665_10011906 3300025939 Bacteria 5713
384 Ga0207665_10016864 3300025939 Bacteria 4797
385 Ga0207665_10017266 3300025939 Bacteria 4741
386 Ga0207665_10017346 3300025939 Bacteria 4731
387 Ga0207665_10043225 3300025939 Bacteria 3012
388 Ga0207691_10000716 3300025940 Bacteria 32735
389 Ga0207691_10222085 3300025940 Unclassified 1638
390 Ga0207689_10000382 3300025942 Bacteria 41581
391 Ga0207689_10003174 3300025942 Bacteria 15080
392 Ga0207689_10090479 3300025942 Bacteria 2515
393 Ga0207661_10012659 3300025944 Bacteria 6141
394 Ga0207661_10055578 3300025944 Bacteria 3176
395 Ga0207679_10000070 3300025945 Bacteria 91501
396 Ga0207679_10010001 3300025945 Bacteria 6094
397 Ga0207679_10280468 3300025945 Bacteria 1429
398 Ga0207667_10005322 3300025949 Bacteria 15684
399 Ga0207667_10012067 3300025949 Bacteria 9992
400 Ga0207667_10045590 3300025949 Bacteria 4642
401 Ga0207667_10142023 3300025949 Bacteria 2472
402 Ga0207651_10000872 3300025960 Bacteria 13212
403 Ga0207712_10085254 3300025961 Bacteria 2311
404 Ga0207668_10029719 3300025972 Unclassified 3584
405 Ga0207640_10048444 3300025981 Bacteria 2747
406 Ga0207658_10073369 3300025986 Bacteria 2597
407 Ga0207658_10137583 3300025986 Bacteria 1972
408 Ga0207677_10018649 3300026023 Unclassified 4168
409 Ga0207703_10003794 3300026035 Bacteria 12562
410 Ga0207703_10009189 3300026035 Bacteria 7776
411 Ga0207703_10014402 3300026035 Bacteria 6166
412 Ga0207703_10039225 3300026035 Bacteria 3784
413 Ga0207703_10136228 3300026035 Bacteria 2126
414 Ga0207639_10034160 3300026041 Bacteria 3757
415 Ga0207639_10091992 3300026041 Bacteria 2430
416 Ga0207639_10215537 3300026041 Unclassified 1655
417 Ga0207639_10272625 3300026041 Bacteria 1485
418 Ga0207678_10000551 3300026067 Bacteria 34210
419 Ga0207678_10003533 3300026067 Bacteria 14064
420 Ga0207702_10000660 3300026078 Bacteria 37577
421 Ga0207702_10002946 3300026078 Bacteria 15895
422 Ga0207702_10004480 3300026078 Bacteria 12400
423 Ga0207702_10019578 3300026078 Bacteria 5601
424 Ga0207641_10000020 3300026088 Bacteria 286415
425 Ga0207641_10013337 3300026088 Bacteria 6740
426 Ga0207641_10018753 3300026088 Bacteria 5674
427 Ga0207641_10136240 3300026088 Unclassified 2210
428 Ga0207648_10010231 3300026089 Bacteria 8913
429 Ga0207648_10074482 3300026089 Bacteria 2959
430 Ga0207676_10000101 3300026095 Bacteria 77252
431 Ga0207676_10075849 3300026095 Bacteria 2714
432 Ga0207676_10384949 3300026095 Unclassified 1307
433 Ga0207674_10001286 3300026116 Bacteria 32737
434 Ga0207674_10006072 3300026116 Bacteria 14279
435 Ga0207674_10012608 3300026116 Bacteria 9447
436 Ga0207674_10130404 3300026116 Unclassified 2478
437 Ga0207675_100042546 3300026118 Bacteria 4242
438 Ga0207683_10052126 3300026121 Bacteria 3585
439 Ga0265356_1006148 3300028017 Bacteria 1410
440 Ga0268266_10084174 3300028379 Unclassified 2777
441 Ga0268265_10049504 3300028380 Bacteria 3160
442 Ga0268265_10068458 3300028380 Bacteria 2753
443 Ga0268265_10117813 3300028380 Bacteria 2182
444 Ga0268264_10092382 3300028381 Bacteria 2612
445 Ga0265338_10034381 3300028800 Bacteria 4900
446 Ga0265338_10095914 3300028800 Bacteria 2435
447 Ga0265338_10187701 3300028800 Bacteria 1570
448 Ga0265762_1000940 3300030760 Bacteria 5215
449 Ga0265770_1003734 3300030878 Bacteria 2071
450 Ga0265765_1006182 3300030879 Unclassified 1268
451 Ga0265760_10001203 3300031090 Bacteria 7586
452 Ga0265760_10006459 3300031090 Bacteria 3353
453 Ga0265760_10009844 3300031090 Bacteria 2728
454 Ga0265760_10024787 3300031090 Unclassified 1749
455 Ga0265325_10022728 3300031241 Bacteria 3431
456 Ga0265339_10138745 3300031249 Bacteria 1238
457 Ga0265316_10002112 3300031344 Bacteria 20889
458 Ga0265342_10020396 3300031712 Bacteria 4252
459 Ga0373926_0007166 3300035083 Bacteria 3714
460 Ga0373934_0041804 3300035086 Bacteria 1810
461 Ga0373923_0000470 3300035111 Bacteria 9599
462 Ga0373936_0032572 3300035113 Unclassified 2062
463 Ga0373945_0012389 3300035116 Bacteria 2832
464 Ga0373956_0021373 3300035119 Unclassified 2761
465 Ga0373943_0000342 3300035170 Bacteria 19549
466 Ga0373943_0010107 3300035170 Bacteria 4233
467 Ga0373943_0036542 3300035170 Bacteria 2353
468 Ga0373946_0001082 3300035171 Bacteria 9393
469 Ga0373955_0016064 3300035172 Unclassified 3678
470 Ga0373955_0071852 3300035172 Bacteria 1937
471 Ga0373961_0024034 3300035241 Bacteria 1645
472 Ga0373931_0158915 3300035691 Bacteria 1323
473 Ga0373935_0000485 3300035692 Bacteria 20557
474 Ga0373935_0113784 3300035692 Unclassified 1799
475 Ga0373927_0000340 3300035695 Bacteria 36716
476 Ga0373927_0017636 3300035695 Bacteria 4697
477 Ga0373927_0020409 3300035695 Bacteria 4345
478 Ga0373933_0038190 3300035724 Unclassified 2821
479 Ga0373947_0000058 3300035725 Bacteria 55174
480 Ga0373947_0006461 3300035725 Bacteria 6809
481 Ga0373937_0110761 3300036401 Unclassified 2553
482 Ga0373937_0141301 3300036401 Bacteria 2253
483 Ga0373937_0365564 3300036401 Unclassified 1368
484 Ga0373937_0388931 3300036401 Unclassified 1323
485 Ga0373925_0004264 3300037068 Bacteria 10831
486 Ga0373925_0009727 3300037068 Bacteria 6990
487 Ga0373925_0051180 3300037068 Bacteria 3082
488 Ga0373925_0115639 3300037068 Bacteria 2077
489 Ga0436364_0278679 3300037853 Bacteria 3337
490 Ga0436363_0234178 3300039450 Unclassified 2342
491 Ga0436363_0879313 3300039450 Bacteria 3432
492 Ga0466963_0012373 3300044694 Bacteria 5221
493 Ga0466964_0012009 3300044706 Bacteria 3276
494 Ga0451576_0401694 3300045051 Bacteria 1437
495 Ga0466958_0212617 3300045836 Bacteria 1233
496 Ga0466967_0134156 3300045976 Bacteria 2301
497 Ga0495603_0106787 3300046455 Unclassified 1634
498 Ga0495629_0049156 3300046459 Bacteria 2956
499 Ga0495651_0126171 3300046462 Bacteria 1874
500 Ga0495580_0000098 3300046472 Bacteria 57956
501 Ga0495580_0003401 3300046472 Bacteria 13571
502 Ga0495580_0003909 3300046472 Bacteria 12587
503 Ga0495580_0005258 3300046472 Bacteria 10753
504 Ga0495580_0017554 3300046472 Bacteria 5349
505 Ga0495580_0061141 3300046472 Bacteria 2646
506 Ga0495582_0001538 3300046473 Bacteria 13026
507 Ga0495582_0001575 3300046473 Bacteria 12866
508 Ga0495630_0009790 3300046517 Bacteria 6900
509 Ga0495630_0326976 3300046517 Unclassified 1172
510 Ga0495666_0101581 3300046526 Unclassified 1355
511 Ga0495665_0003014 3300046531 Bacteria 9103
512 Ga0495665_0016283 3300046531 Bacteria 4006
513 Ga0495665_0089787 3300046531 Bacteria 1614
514 Ga0495645_0133188 3300046543 Unclassified 1740
515 Ga0495674_0004162 3300047319 Bacteria 13963
516 Ga0495674_0013659 3300047319 Bacteria 7630
517 Ga0495602_0084135 3300048088 Unclassified 2662
518 Ga0495602_0138247 3300048088 Bacteria 1932
519 Ga0495602_0263666 3300048088 Bacteria 1277
520 Ga0496100_0047103 3300048903 Bacteria 2776
521 Ga0496100_0110331 3300048903 Unclassified 1910
522 Ga0496100_0186189 3300048903 Bacteria 1504
523 Ga0496102_0015409 3300048905 Bacteria 6658
524 Ga0496102_0039838 3300048905 Bacteria 4248
525 Ga0496102_0053842 3300048905 Bacteria 3668
526 Ga0496102_0222450 3300048905 Bacteria 1780
527 Ga0496103_0041018 3300048906 Bacteria 2845
528 Ga0496103_0049311 3300048906 Bacteria 2603
529 Ga0496104_0310578 3300048907 Bacteria 1489
530 Ga0496104_0368532 3300048907 Unclassified 1349
531 Ga0496105_0048088 3300048908 Bacteria 3521
532 Ga0496106_0119542 3300048909 Bacteria 2058
533 Ga0496106_0415304 3300048909 Unclassified 1081
534 Ga0496107_0064247 3300048910 Bacteria 2661
535 Ga0496108_0000559 3300048911 Bacteria 29177
536 Ga0496108_0401169 3300048911 Unclassified 1198
537 Ga0496109_0000018 3300048912 Bacteria 191977
538 Ga0496110_0000049 3300048913 Bacteria 59257
539 Ga0496110_0076400 3300048913 Bacteria 2978
540 Ga0496110_0155174 3300048913 Unclassified 2074
541 Ga0496111_0005638 3300048914 Bacteria 8056
542 Ga0496111_0021355 3300048914 Bacteria 4520
543 Ga0496112_0000058 3300048915 Bacteria 76327
544 Ga0496112_0003222 3300048915 Bacteria 13438
545 Ga0496112_0016987 3300048915 Bacteria 6830
546 Ga0496112_0025067 3300048915 Bacteria 5722
547 Ga0496112_0025220 3300048915 Bacteria 5707
548 Ga0496112_0178303 3300048915 Unclassified 2089
549 Ga0496113_0016889 3300048916 Bacteria 5052
550 Ga0496114_0048795 3300048917 Bacteria 3522
551 Ga0496115_0059316 3300048918 Bacteria 3081
552 Ga0496115_0166489 3300048918 Bacteria 1823
553 Ga0496115_0379262 3300048918 Bacteria 1150
554 nmdc:mga0n895_16452_c1 3300050512 Bacteria 6788
555 nmdc:mga0n895_231_c1 3300050512 Bacteria 35337
556 nmdc:mga0rr50_10004_c1 3300050513 Bacteria 5998
557 nmdc:mga0rr50_42762_c1 3300050513 Unclassified 3311
558 nmdc:mga0rr50_9705_c1 3300050513 Bacteria 6070
559 nmdc:mga08x19_5640_c1 3300050514 Bacteria 7396
560 nmdc:mga0a205_225_c1 3300050515 Bacteria 39886
561 Ga0495619_0018987 3300053085 Bacteria 4367
562 Ga0207654_10032274
563 LJNas_1003006
564 JGI24751J29686_10003429
565 Ga0070658_10081821
566 Ga0070676_10025864
567 Ga0070683_100018324
568 Ga0070683_100023492
569 Ga0070683_100024117
570 Ga0070683_100052543
571 Ga0070670_100027685
572 Ga0070670_100054588
573 Ga0070670_100470003
574 Ga0070677_10002404
575 Ga0068869_100002204
576 Ga0068869_100312386
577 Ga0070680_100159343
578 Ga0070680_100167303
579 Ga0068868_100020989
580 Ga0068868_100023084
581 Ga0068868_100025396
582 Ga0068868_100064127
583 Ga0068868_100070792
584 Ga0068868_100100585
585 Ga0068868_100105500
586 Ga0070660_100007536
587 Ga0070660_100025125
588 Ga0070660_100084745
589 Ga0070689_100020369
590 Ga0070687_100098200
591 Ga0070661_100010313
592 Ga0070661_100041719
593 Ga0070668_100020879
594 Ga0070668_100041307
595 Ga0070669_100028398
596 Ga0070671_100059308
597 Ga0070674_100010264
598 Ga0070659_100018381
599 Ga0070659_100150790
600 Ga0070667_100106558
601 Ga0070709_10000485
602 Ga0070709_10025278
603 Ga0070709_10049384
604 Ga0070709_10053840
605 Ga0070709_10136578
606 Ga0070709_10267630
607 Ga0070714_100007931
608 Ga0070714_100082097
609 Ga0070714_100183996
610 Ga0070713_100000163
611 Ga0070713_100000820
612 Ga0070713_100058988
613 Ga0070713_100086136
614 Ga0070713_100144437
615 Ga0070710_10006894
616 Ga0070710_10027233
617 Ga0070711_100008538
618 Ga0070694_100052640
619 Ga0070708_100000415
620 Ga0070708_100000611
621 Ga0070708_100004519
622 Ga0070708_100014892
623 Ga0070708_100045758
624 Ga0070708_100396191
625 Ga0070678_100331065
626 Ga0070662_100007633
627 Ga0070662_100019596
628 Ga0070681_10000134
629 Ga0070681_10066174
630 Ga0070681_10342455
631 Ga0068867_100006250
632 Ga0068867_100184384
633 Ga0068867_100195140
634 Ga0070685_10019709
635 Ga0070685_10030771
636 Ga0070706_100002374
637 Ga0070706_100002562
638 Ga0070706_100003656
639 Ga0070706_100028654
640 Ga0070706_100033860
641 Ga0070706_100034180
642 Ga0070706_100301430
643 Ga0070707_100000278
644 Ga0070707_100000663
645 Ga0070707_100020358
646 Ga0070707_100290833
647 Ga0070707_100316685
648 Ga0070707_100413076
649 Ga0070698_100000203
650 Ga0070698_100007473
651 Ga0070698_100019203
652 Ga0070699_100000706
653 Ga0070699_100001034
654 Ga0070699_100025461
655 Ga0070699_100045693
656 Ga0070699_100284135
657 Ga0070679_100034387
658 Ga0070679_100157477
659 Ga0070684_100007884
660 Ga0070684_100074922
661 Ga0070684_100124573
662 Ga0070697_100000053
663 Ga0070697_100000375
664 Ga0070697_100001907
665 Ga0070697_100004705
666 Ga0070697_100010820
667 Ga0070697_100020303
668 Ga0070697_100049833
669 Ga0068853_100025237
670 Ga0068853_100046851
671 Ga0068853_100065296
672 Ga0068853_100081989
673 Ga0068853_100111089
674 Ga0070672_100279759
675 Ga0070686_100017387
676 Ga0070686_100029466
677 Ga0070693_100078478
678 Ga0070665_100003957
679 Ga0068855_100009417
680 Ga0068855_100013448
681 Ga0068855_100058499
682 Ga0068855_100126740
683 Ga0068855_100259029
684 Ga0070664_100000499
685 Ga0070664_100046454
686 Ga0070664_100156519
687 Ga0070664_100224011
688 Ga0070664_100346174
689 Ga0068857_100000884
690 Ga0068857_100004174
691 Ga0068857_100007990
692 Ga0068857_100064556
693 Ga0068856_100001233
694 Ga0068856_100003730
695 Ga0068856_100003905
696 Ga0068856_100010421
697 Ga0068856_100055393
698 Ga0068856_100090171
699 Ga0068856_100156594
700 Ga0068852_100046020
701 Ga0068852_100151687
702 Ga0068859_100004449
703 Ga0068859_100007294
704 Ga0068859_100014487
705 Ga0068864_100248952
706 Ga0068866_10003960
707 Ga0068866_10014119
708 Ga0068866_10063861
709 Ga0068861_100100849
710 Ga0068851_10028713
711 Ga0068870_10006415
712 Ga0068870_10039062
713 Ga0068863_100012976
714 Ga0068863_100080022
715 Ga0068863_100148475
716 Ga0068863_100290043
717 Ga0068858_100001221
718 Ga0068858_100010190
719 Ga0068858_100018673
720 Ga0068858_100056602
721 Ga0068858_100213043
722 Ga0068860_100053366
723 Ga0068860_100086935
724 Ga0068862_100017239
725 Ga0068862_100074042
726 Ga0068862_100139600
727 Ga0070717_10000434
728 Ga0070717_10001900
729 Ga0070717_10002031
730 Ga0070717_10004595
731 Ga0070717_10009346
732 Ga0070717_10014111
733 Ga0070717_10049287
734 Ga0070717_10080474
735 Ga0070717_10085014
736 Ga0070717_10085403
737 Ga0070717_10147174
738 Ga0070717_10264818
739 Ga0070715_10062964
740 Ga0070716_100003028
741 Ga0070716_100014105
742 Ga0070716_100014511
743 Ga0070716_100222895
744 Ga0070712_100001721
745 Ga0070712_100001995
746 Ga0070712_100005936
747 Ga0070712_100015869
748 Ga0070712_100017275
749 Ga0070712_100052120
750 Ga0070712_100060780
751 Ga0097621_100000429
752 Ga0097621_100004346
753 Ga0097621_100063789
754 Ga0068871_100000253
755 Ga0068871_100001029
756 Ga0068871_100013150
757 Ga0068871_100013157
758 Ga0068871_100070222
759 Ga0068871_100417625
760 Ga0075434_100000016
761 Ga0075434_100001835
762 Ga0068865_100005497
763 Ga0068865_100010510
764 Ga0068865_100094050
765 Ga0075436_100000459
766 Ga0075436_100091960
767 Ga0097620_100004449
768 Ga0097620_100007294
769 Ga0097620_100014485
770 Ga0075435_100000506
771 Ga0075435_100405235
772 Ga0099795_10016008
773 Ga0105240_10017591
774 Ga0105240_10030768
775 Ga0105240_10032933
776 Ga0105240_10248398
777 Ga0105240_10338625
778 Ga0105245_10020080
779 Ga0105247_10002792
780 Ga0105247_10084525
781 Ga0114129_10388833
782 Ga0105243_10015513
783 Ga0105241_10182318
784 Ga0105242_10021612
785 Ga0105248_10009328
786 Ga0105248_10031889
787 Ga0105248_10057819
788 Ga0105237_10072019
789 Ga0105237_10107925
790 Ga0105237_10185612
791 Ga0105238_10010053
792 Ga0105238_10013565
793 Ga0105238_10033787
794 Ga0105238_10232257
795 Ga0105238_10250666
796 Ga0105249_10010222
797 Ga0105249_10035076
798 Ga0105249_10059070
799 Ga0105239_10033287
800 Ga0105239_10046762
801 Ga0105239_10829982
802 Ga0105246_10044926
803 Ga0105246_10174869
804 Ga0157373_10010490
805 Ga0157373_10056764
806 Ga0157373_10088812
807 Ga0157373_10101489
808 Ga0157371_10013907
809 Ga0157371_10015643
810 Ga0157370_10034655
811 Ga0157370_10058075
812 Ga0157369_10000497
813 Ga0157369_10006632
814 Ga0157369_10031256
815 Ga0157369_10105983
816 Ga0157369_10169138
817 Ga0157374_10000735
818 Ga0157374_10000866
819 Ga0157374_10007513
820 Ga0157374_10011216
821 Ga0157374_10014756
822 Ga0157374_10017931
823 Ga0157374_10022644
824 Ga0157374_10047547
825 Ga0157374_10125769
826 Ga0157378_10000055
827 Ga0157378_10000397
828 Ga0157378_10011282
829 Ga0157378_10229193
830 Ga0163162_10021429
831 Ga0163162_10032005
832 Ga0163162_10042171
833 Ga0163162_10168535
834 Ga0157372_10000390
835 Ga0157372_10003595
836 Ga0157372_10010189
837 Ga0157372_10019569
838 Ga0157372_10020727
839 Ga0157372_10031391
840 Ga0157372_10040501
841 Ga0157372_10095177
842 Ga0157372_10329375
843 Ga0157375_10013298
844 Ga0163163_10028075
845 Ga0163163_10101760
846 Ga0163163_10234752
847 Ga0157380_10336692
848 Ga0182008_10026088
849 Ga0157377_10000793
850 Ga0157376_10039435
851 Ga0157376_10071122
852 Ga0157376_10117002
853 Ga0182006_1073403
854 Ga0182005_1010249
855 Ga0224570_100787
856 Ga0228598_1001230
857 Ga0207656_10045208
858 Ga0207692_10003093
859 Ga0207692_10050828
860 Ga0207692_10121424
861 Ga0207710_10039052
862 Ga0207688_10002244
863 Ga0207680_10064450
864 Ga0207647_10002049
865 Ga0207647_10007573
866 Ga0207685_10008498
867 Ga0207699_10001011
868 Ga0207699_10012598
869 Ga0207699_10012880
870 Ga0207699_10106233
871 Ga0207645_10005280
872 Ga0207645_10005800
873 Ga0207643_10002087
874 Ga0207705_10073049
875 Ga0207684_10003282
876 Ga0207684_10003387
877 Ga0207684_10003840
878 Ga0207684_10027260
879 Ga0207684_10030971
880 Ga0207684_10044026
881 Ga0207684_10157956
882 Ga0207654_10012826
883 Ga0207654_10080119
884 Ga0207707_10006958
885 Ga0207695_10023518
886 Ga0207695_10030023
887 Ga0207695_10049304
888 Ga0207695_10093664
889 Ga0207695_10167812
890 Ga0207695_10198452
891 Ga0207695_10279273
892 Ga0207671_10057747
893 Ga0207671_10102741
894 Ga0207693_10000154
895 Ga0207693_10000257
896 Ga0207693_10002662
897 Ga0207693_10016780
898 Ga0207693_10019973
899 Ga0207693_10058590
900 Ga0207693_10167654
901 Ga0207663_10012509
902 Ga0207663_10178137
903 Ga0207660_10136652
904 Ga0207660_10212230
905 Ga0207657_10002191
906 Ga0207657_10002806
907 Ga0207657_10029291
908 Ga0207649_10000232
909 Ga0207649_10051286
910 Ga0207649_10108869
911 Ga0207646_10000348
912 Ga0207646_10001451
913 Ga0207646_10053568
914 Ga0207646_10190237
915 Ga0207694_10005870
916 Ga0207694_10058792
917 Ga0207694_10066688
918 Ga0207694_10087685
919 Ga0207650_10000122
920 Ga0207650_10068423
921 Ga0207650_10117807
922 Ga0207700_10000152
923 Ga0207700_10011063
924 Ga0207700_10044133
925 Ga0207700_10083210
926 Ga0207700_10309675
927 Ga0207664_10000076
928 Ga0207664_10005832
929 Ga0207664_10046224
930 Ga0207664_10077242
931 Ga0207664_10087075
932 Ga0207664_10393943
933 Ga0207644_10094917
934 Ga0207644_10111902
935 Ga0207706_10004321
936 Ga0207706_10004432
937 Ga0207686_10210267
938 Ga0207709_10141552
939 Ga0207669_10154967
940 Ga0207704_10003411
941 Ga0207704_10018131
942 Ga0207665_10002806
943 Ga0207665_10005963
944 Ga0207665_10011906
945 Ga0207665_10016864
946 Ga0207665_10017266
947 Ga0207665_10017346
948 Ga0207665_10043225
949 Ga0207691_10000716
950 Ga0207691_10222085
951 Ga0207689_10000382
952 Ga0207689_10003174
953 Ga0207689_10090479
954 Ga0207661_10012659
955 Ga0207661_10055578
956 Ga0207679_10000070
957 Ga0207679_10010001
958 Ga0207679_10280468
959 Ga0207667_10005322
960 Ga0207667_10012067
961 Ga0207667_10045590
962 Ga0207667_10142023
963 Ga0207651_10000872
964 Ga0207712_10085254
965 Ga0207668_10029719
966 Ga0207640_10048444
967 Ga0207658_10073369
968 Ga0207658_10137583
969 Ga0207677_10018649
970 Ga0207703_10003794
971 Ga0207703_10009189
972 Ga0207703_10014402
973 Ga0207703_10039225
974 Ga0207703_10136228
975 Ga0207639_10034160
976 Ga0207639_10091992
977 Ga0207639_10215537
978 Ga0207639_10272625
979 Ga0207678_10000551
980 Ga0207678_10003533
981 Ga0207702_10000660
982 Ga0207702_10002946
983 Ga0207702_10004480
984 Ga0207702_10019578
985 Ga0207641_10000020
986 Ga0207641_10013337
987 Ga0207641_10018753
988 Ga0207641_10136240
989 Ga0207648_10010231
990 Ga0207648_10074482
991 Ga0207676_10000101
992 Ga0207676_10075849
993 Ga0207676_10384949
994 Ga0207674_10001286
995 Ga0207674_10006072
996 Ga0207674_10012608
997 Ga0207674_10130404
998 Ga0207675_100042546
999 Ga0207683_10052126
1000 Ga0265356_1006148
1001 Ga0268266_10084174
1002 Ga0268265_10049504
1003 Ga0268265_10068458
1004 Ga0268265_10117813
1005 Ga0268264_10092382
1006 Ga0265338_10034381
1007 Ga0265338_10095914
1008 Ga0265338_10187701
1009 Ga0265762_1000940
1010 Ga0265770_1003734
1011 Ga0265765_1006182
1012 Ga0265760_10001203
1013 Ga0265760_10006459
1014 Ga0265760_10009844
1015 Ga0265760_10024787
1016 Ga0265325_10022728
1017 Ga0265339_10138745
1018 Ga0265316_10002112
1019 Ga0265342_10020396
1020 Ga0373926_0007166
1021 Ga0373934_0041804
1022 Ga0373923_0000470
1023 Ga0373936_0032572
1024 Ga0373945_0012389
1025 Ga0373956_0021373
1026 Ga0373943_0000342
1027 Ga0373943_0010107
1028 Ga0373943_0036542
1029 Ga0373946_0001082
1030 Ga0373955_0016064
1031 Ga0373955_0071852
1032 Ga0373961_0024034
1033 Ga0373931_0158915
1034 Ga0373935_0000485
1035 Ga0373935_0113784
1036 Ga0373927_0000340
1037 Ga0373927_0017636
1038 Ga0373927_0020409
1039 Ga0373933_0038190
1040 Ga0373947_0000058
1041 Ga0373947_0006461
1042 Ga0373937_0110761
1043 Ga0373937_0141301
1044 Ga0373937_0365564
1045 Ga0373937_0388931
1046 Ga0373925_0004264
1047 Ga0373925_0009727
1048 Ga0373925_0051180
1049 Ga0373925_0115639
1050 Ga0436364_0278679
1051 Ga0436363_0234178
1052 Ga0436363_0879313
1053 Ga0466963_0012373
1054 Ga0466964_0012009
1055 Ga0451576_0401694
1056 Ga0466958_0212617
1057 Ga0466967_0134156
1058 Ga0495603_0106787
1059 Ga0495629_0049156
1060 Ga0495651_0126171
1061 Ga0495580_0000098
1062 Ga0495580_0003401
1063 Ga0495580_0003909
1064 Ga0495580_0005258
1065 Ga0495580_0017554
1066 Ga0495580_0061141
1067 Ga0495582_0001538
1068 Ga0495582_0001575
1069 Ga0495630_0009790
1070 Ga0495630_0326976
1071 Ga0495666_0101581
1072 Ga0495665_0003014
1073 Ga0495665_0016283
1074 Ga0495665_0089787
1075 Ga0495645_0133188
1076 Ga0495674_0004162
1077 Ga0495674_0013659
1078 Ga0495602_0084135
1079 Ga0495602_0138247
1080 Ga0495602_0263666
1081 Ga0496100_0047103
1082 Ga0496100_0110331
1083 Ga0496100_0186189
1084 Ga0496102_0015409
1085 Ga0496102_0039838
1086 Ga0496102_0053842
1087 Ga0496102_0222450
1088 Ga0496103_0041018
1089 Ga0496103_0049311
1090 Ga0496104_0310578
1091 Ga0496104_0368532
1092 Ga0496105_0048088
1093 Ga0496106_0119542
1094 Ga0496106_0415304
1095 Ga0496107_0064247
1096 Ga0496108_0000559
1097 Ga0496108_0401169
1098 Ga0496109_0000018
1099 Ga0496110_0000049
1100 Ga0496110_0076400
1101 Ga0496110_0155174
1102 Ga0496111_0005638
1103 Ga0496111_0021355
1104 Ga0496112_0000058
1105 Ga0496112_0003222
1106 Ga0496112_0016987
1107 Ga0496112_0025067
1108 Ga0496112_0025220
1109 Ga0496112_0178303
1110 Ga0496113_0016889
1111 Ga0496114_0048795
1112 Ga0496115_0059316
1113 Ga0496115_0166489
1114 Ga0496115_0379262
1115 nmdc:mga0n895_16452_c1
1116 nmdc:mga0n895_231_c1
1117 nmdc:mga0rr50_10004_c1
1118 nmdc:mga0rr50_42762_c1
1119 nmdc:mga0rr50_9705_c1
1120 nmdc:mga08x19_5640_c1
1121 nmdc:mga0a205_225_c1
1122 Ga0495619_0018987

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00962

A_deaminase

Adenosine deaminase

13

323

0.94

PF19326

AMP_deaminase

AMP deaminase

177

321

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
3pbm-assembly1.cif.gz_A the crystal structure of adenosine deaminase in complex with chloropurine from pseudomonas aeruginosa 0.9483 9 316
3rys-assembly2.cif.gz_B the crystal structure of adenine deaminase (aaur1117) from arthrobacter aurescens 0.9476 15 337
7rtg-assembly1.cif.gz_A crystal structure of the human adenosine deaminase 1 0.9362 15 337
3rys-assembly2.cif.gz_B the crystal structure of adenine deaminase (aaur1117) from arthrobacter aurescens 0.9336 15 337
3pbm-assembly1.cif.gz_A the crystal structure of adenosine deaminase in complex with chloropurine from pseudomonas aeruginosa 0.9308 9 316
ID Description Score Start End Superfamily
3rysB00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases 0.9476 15 337 3.20.20.140
af_Q54KF3_1_358_3.20.20.140 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases 0.942 5 336 3.20.20.140
af_Q9P6J8_2_337_3.20.20.140 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases 0.9351 11 337 3.20.20.140
3rysB00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases 0.9336 15 337 3.20.20.140
af_Q5FVI8_1_213_3.20.20.140 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Metal-dependent hydrolases 0.9336 140 333 3.20.20.140
ID Description Score Start End GO Terms
AF-A0A2V9YBK4-F1-model_v4 Adenosine deaminase 0.9962 61 337 GO:0019239
AF-A0A2V9YBK4-F1-model_v4 Adenosine deaminase 0.989 61 337 GO:0019239
AF-A0A359IHG7-F1-model_v4 Adenosine deaminase 0.987 219 333 GO:0019239
AF-A0A564Q7V8-F1-model_v4 Adenosine deaminase 0.9865 195 333 GO:0019239
AF-A0A3B8VPT3-F1-model_v4 Adenosine deaminase 0.984 233 331 GO:0019239

Map