F463741

General Info

Members Datasets Scaffolds Average Seq Length
560 206 1120 191

Family's Representative Sequence

Representative Sequence 3300046689|Ga0495613_0317571|Ga0495613_0317571_93_776
Length 227
Sequence MKMTNDKFPAPVPFNFSRAVNPPDRIFVYTHVKPAAASEMIAIQMDSPDTRPKAGIADFDAVVRQHWPKIYRFVLASIRDRDAAETLTQDCFLRAYQARHQFRGDASVSTWLMQIAINLVRDFARSRRIRFWQRVKDTAVDCASLNDGLAGHGISPEAQAVAKEQIEAVWRATGNLSERQRTVFLLRFVEDMDLLEIANVMGVSEGAVKVHLFRAVHTVRERIGGMR

Samples

Sample ID Description Type Environment
1 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
2 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
4 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
14 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
15 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
16 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
17 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
18 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
19 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
20 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
21 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
22 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
23 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
24 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
25 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
26 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
27 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
28 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
29 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
30 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
31 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
32 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
33 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
34 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
35 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
36 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
37 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
38 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
39 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
40 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
41 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
42 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
43 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
44 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
45 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
46 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
47 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
48 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
49 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
50 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
51 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
52 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
53 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
54 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
55 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
56 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
57 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
58 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
59 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
60 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
61 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
62 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
63 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
64 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
65 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
66 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
67 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
68 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
69 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
70 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
71 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
72 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
73 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
74 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
75 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
76 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
77 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
78 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
79 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
80 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
81 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
82 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
83 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
84 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
85 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
86 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
87 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
88 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
89 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
90 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
91 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
92 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
93 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
94 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
144 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
148 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
149 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
150 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
151 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
152 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
153 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
154 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
155 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
156 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
157 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
158 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
159 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
160 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
161 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
162 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
163 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
164 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
165 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
166 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
167 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
168 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
169 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
170 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
171 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
172 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
173 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
174 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
175 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
176 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
177 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
178 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
179 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
180 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
181 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
182 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
183 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
184 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
185 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
186 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
187 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
188 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
189 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
190 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
191 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
192 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
193 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
194 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
195 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
196 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
197 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
198 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
199 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
200 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
201 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
202 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
203 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
204 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
205 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
206 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.64
Metatranscriptomes 0.36
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.71
Rhizosphere 97.5
Stem 0
Stem Tuber 0
Unclassified 35

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495613_0317571 3300046689 Bacteria 1076
2 Ga0065714_10301243 3300005288 Unclassified 694
3 Ga0065712_10228114 3300005290 Bacteria 1020
4 Ga0065707_10424540 3300005295 Unclassified 827
5 Ga0070683_100022852 3300005329 Bacteria 5594
6 Ga0070690_100335523 3300005330 Bacteria 1093
7 Ga0068869_100130521 3300005334 Bacteria 1931
8 Ga0068869_100452931 3300005334 Unclassified 1064
9 Ga0068869_100954911 3300005334 Unclassified 744
10 Ga0068869_101171505 3300005334 Unclassified 674
11 Ga0070666_10000590 3300005335 Bacteria 21907
12 Ga0070666_10040759 3300005335 Bacteria 3101
13 Ga0070666_10064361 3300005335 Bacteria 2487
14 Ga0070680_100030030 3300005336 Bacteria 4365
15 Ga0068868_100022564 3300005338 Bacteria 4752
16 Ga0068868_100123080 3300005338 Bacteria 2116
17 Ga0070660_100987424 3300005339 Bacteria 711
18 Ga0070689_100030418 3300005340 Bacteria 4099
19 Ga0070689_100048898 3300005340 Bacteria 3263
20 Ga0070687_100265182 3300005343 Bacteria 1074
21 Ga0070661_100404309 3300005344 Unclassified 1080
22 Ga0070669_100020496 3300005353 Bacteria 4722
23 Ga0070669_100147216 3300005353 Unclassified 1820
24 Ga0070675_100002217 3300005354 Bacteria 14410
25 Ga0070675_100004248 3300005354 Bacteria 10904
26 Ga0070675_100006304 3300005354 Bacteria 9105
27 Ga0070675_100006824 3300005354 Bacteria 8767
28 Ga0070675_100094096 3300005354 Bacteria 2514
29 Ga0070675_100344147 3300005354 Bacteria 1321
30 Ga0070671_100009501 3300005355 Bacteria 7803
31 Ga0070671_100011954 3300005355 Bacteria 6984
32 Ga0070671_100013342 3300005355 Bacteria 6623
33 Ga0070671_100298305 3300005355 Bacteria 1372
34 Ga0070671_100930512 3300005355 Unclassified 760
35 Ga0070671_101020094 3300005355 Bacteria 725
36 Ga0070673_100016978 3300005364 Bacteria 5164
37 Ga0070673_100027896 3300005364 Unclassified 4191
38 Ga0070673_100116342 3300005364 Bacteria 2224
39 Ga0070673_100192465 3300005364 Bacteria 1753
40 Ga0070673_100483197 3300005364 Bacteria 1118
41 Ga0070673_100629991 3300005364 Unclassified 980
42 Ga0070673_100704676 3300005364 Unclassified 927
43 Ga0070688_100009433 3300005365 Bacteria 5338
44 Ga0070688_100026613 3300005365 Bacteria 3438
45 Ga0070688_100166956 3300005365 Bacteria 1516
46 Ga0070659_100230973 3300005366 Bacteria 1529
47 Ga0070667_100004649 3300005367 Bacteria 11527
48 Ga0070667_100007435 3300005367 Bacteria 9097
49 Ga0070667_100012684 3300005367 Bacteria 6968
50 Ga0070667_100026175 3300005367 Bacteria 4852
51 Ga0070667_100322108 3300005367 Bacteria 1395
52 Ga0070667_100521984 3300005367 Unclassified 1090
53 Ga0070709_10051439 3300005434 Bacteria 2585
54 Ga0070709_10544885 3300005434 Unclassified 887
55 Ga0070713_100074533 3300005436 Unclassified 2875
56 Ga0070713_100078091 3300005436 Bacteria 2817
57 Ga0070713_100482472 3300005436 Bacteria 1168
58 Ga0070701_10148159 3300005438 Bacteria 1349
59 Ga0070705_100158250 3300005440 Bacteria 1511
60 Ga0070705_100852378 3300005440 Unclassified 729
61 Ga0070678_100135515 3300005456 Unclassified 1963
62 Ga0070678_100306499 3300005456 Unclassified 1351
63 Ga0070662_100167346 3300005457 Unclassified 1724
64 Ga0070662_100382909 3300005457 Unclassified 1158
65 Ga0070662_100396512 3300005457 Bacteria 1138
66 Ga0070681_10047115 3300005458 Bacteria 4309
67 Ga0070681_10062478 3300005458 Unclassified 3698
68 Ga0070681_10111108 3300005458 Unclassified 2680
69 Ga0070681_10250042 3300005458 Unclassified 1686
70 Ga0068867_100009624 3300005459 Bacteria 6816
71 Ga0068867_100729435 3300005459 Unclassified 877
72 Ga0068867_100781887 3300005459 Bacteria 850
73 Ga0070685_10002786 3300005466 Bacteria 8941
74 Ga0070685_10003277 3300005466 Bacteria 8227
75 Ga0070685_10035069 3300005466 Bacteria 2829
76 Ga0070685_10401469 3300005466 Unclassified 949
77 Ga0070698_100647362 3300005471 Unclassified 998
78 Ga0070679_100057024 3300005530 Bacteria 3892
79 Ga0070679_100080421 3300005530 Bacteria 3248
80 Ga0070679_100408615 3300005530 Unclassified 1303
81 Ga0070679_100645366 3300005530 Unclassified 1001
82 Ga0070684_100010300 3300005535 Bacteria 7402
83 Ga0070684_100281265 3300005535 Bacteria 1524
84 Ga0070684_100490660 3300005535 Bacteria 1137
85 Ga0070684_100760796 3300005535 Bacteria 905
86 Ga0068853_100077454 3300005539 Bacteria 2905
87 Ga0068853_100136516 3300005539 Bacteria 2199
88 Ga0068853_100184080 3300005539 Bacteria 1895
89 Ga0070672_100014334 3300005543 Bacteria 5617
90 Ga0070672_101131504 3300005543 Unclassified 696
91 Ga0070686_100062176 3300005544 Unclassified 2415
92 Ga0070686_100074717 3300005544 Bacteria 2228
93 Ga0070686_100122802 3300005544 Bacteria 1785
94 Ga0070665_100039198 3300005548 Unclassified 4764
95 Ga0070665_100111788 3300005548 Bacteria 2734
96 Ga0070665_100417157 3300005548 Bacteria 1351
97 Ga0070704_100085951 3300005549 Bacteria 2329
98 Ga0068855_100012858 3300005563 Bacteria 10099
99 Ga0068855_100071369 3300005563 Bacteria 4038
100 Ga0068855_100129185 3300005563 Unclassified 2887
101 Ga0068855_100437432 3300005563 Unclassified 1429
102 Ga0070664_100001274 3300005564 Bacteria 20159
103 Ga0070664_100013117 3300005564 Bacteria 6744
104 Ga0070664_100016225 3300005564 Bacteria 6106
105 Ga0070664_100040293 3300005564 Bacteria 3937
106 Ga0070664_100054275 3300005564 Bacteria 3399
107 Ga0068857_100013491 3300005577 Bacteria 7118
108 Ga0068857_100021249 3300005577 Bacteria 5712
109 Ga0068857_100138622 3300005577 Bacteria 2198
110 Ga0068857_100141687 3300005577 Bacteria 2173
111 Ga0068854_100105405 3300005578 Bacteria 2119
112 Ga0068856_100025016 3300005614 Bacteria 5819
113 Ga0068856_100307179 3300005614 Unclassified 1604
114 Ga0068856_100589787 3300005614 Bacteria 1132
115 Ga0068856_100807199 3300005614 Unclassified 958
116 Ga0068856_100902644 3300005614 Unclassified 902
117 Ga0068852_101171930 3300005616 Unclassified 789
118 Ga0068852_101181747 3300005616 Bacteria 786
119 Ga0068859_100001701 3300005617 Bacteria 22411
120 Ga0068859_100004708 3300005617 Bacteria 13865
121 Ga0068859_100004745 3300005617 Bacteria 13815
122 Ga0068859_100074969 3300005617 Unclassified 3423
123 Ga0068859_100151547 3300005617 Unclassified 2394
124 Ga0068859_100176364 3300005617 Bacteria 2219
125 Ga0068859_100247270 3300005617 Unclassified 1873
126 Ga0068859_100572917 3300005617 Bacteria 1223
127 Ga0068859_101021296 3300005617 Bacteria 908
128 Ga0068864_100000763 3300005618 Bacteria 27075
129 Ga0068864_100012644 3300005618 Bacteria 6979
130 Ga0068864_100081371 3300005618 Bacteria 2839
131 Ga0068864_100156132 3300005618 Bacteria 2071
132 Ga0068864_100241289 3300005618 Bacteria 1674
133 Ga0068864_100289525 3300005618 Bacteria 1531
134 Ga0068864_100431483 3300005618 Unclassified 1257
135 Ga0068861_100288933 3300005719 Bacteria 1415
136 Ga0068870_10370404 3300005840 Unclassified 924
137 Ga0068863_100000602 3300005841 Bacteria 36546
138 Ga0068863_100005556 3300005841 Bacteria 12394
139 Ga0068863_100023792 3300005841 Bacteria 5845
140 Ga0068863_100039846 3300005841 Bacteria 4468
141 Ga0068863_100188469 3300005841 Bacteria 1982
142 Ga0068863_100259460 3300005841 Bacteria 1680
143 Ga0068863_100261872 3300005841 Unclassified 1672
144 Ga0068858_100001314 3300005842 Bacteria 25673
145 Ga0068858_100026717 3300005842 Bacteria 5362
146 Ga0068858_100043871 3300005842 Bacteria 4146
147 Ga0068858_100191830 3300005842 Bacteria 1931
148 Ga0068860_100002055 3300005843 Bacteria 21194
149 Ga0068860_100006372 3300005843 Bacteria 11845
150 Ga0068860_100010785 3300005843 Bacteria 9019
151 Ga0068862_100037674 3300005844 Unclassified 4099
152 Ga0068862_100362794 3300005844 Bacteria 1347
153 Ga0081455_10566920 3300005937 Unclassified 747
154 Ga0070717_10028369 3300006028 Unclassified 4480
155 Ga0070717_10046289 3300006028 Bacteria 3559
156 Ga0070717_10274536 3300006028 Unclassified 1494
157 Ga0097621_100005481 3300006237 Bacteria 8936
158 Ga0097621_100007924 3300006237 Bacteria 7622
159 Ga0097621_100015902 3300006237 Bacteria 5675
160 Ga0097621_100028910 3300006237 Unclassified 4374
161 Ga0097621_100099037 3300006237 Bacteria 2450
162 Ga0097621_100110722 3300006237 Bacteria 2320
163 Ga0097621_100130162 3300006237 Bacteria 2141
164 Ga0097621_100192394 3300006237 Bacteria 1767
165 Ga0068871_100008301 3300006358 Bacteria 7465
166 Ga0068871_100023708 3300006358 Bacteria 4751
167 Ga0068871_100035961 3300006358 Bacteria 3939
168 Ga0068871_100054464 3300006358 Bacteria 3245
169 Ga0068871_100061331 3300006358 Bacteria 3071
170 Ga0068871_100129482 3300006358 Bacteria 2139
171 Ga0075428_100444079 3300006844 Unclassified 1390
172 Ga0075430_100421224 3300006846 Unclassified 1102
173 Ga0075431_100047526 3300006847 Bacteria 4425
174 Ga0075431_100077766 3300006847 Bacteria 3424
175 Ga0075431_100200238 3300006847 Unclassified 2043
176 Ga0075433_10555766 3300006852 Unclassified 1009
177 Ga0075434_100044566 3300006871 Bacteria 4400
178 Ga0075434_100520199 3300006871 Bacteria 1210
179 Ga0068865_100007817 3300006881 Bacteria 6598
180 Ga0097620_100001701 3300006931 Bacteria 22411
181 Ga0097620_100004708 3300006931 Bacteria 13865
182 Ga0097620_100004744 3300006931 Bacteria 13815
183 Ga0097620_100074966 3300006931 Unclassified 3423
184 Ga0097620_100151553 3300006931 Unclassified 2394
185 Ga0097620_100176360 3300006931 Bacteria 2219
186 Ga0097620_100247272 3300006931 Unclassified 1873
187 Ga0097620_100572924 3300006931 Bacteria 1223
188 Ga0097620_101021316 3300006931 Bacteria 908
189 Ga0105240_10000408 3300009093 Bacteria 79917
190 Ga0105240_10017123 3300009093 Bacteria 9784
191 Ga0105240_10017899 3300009093 Bacteria 9533
192 Ga0105240_10083491 3300009093 Bacteria 3919
193 Ga0105240_11662815 3300009093 Unclassified 667
194 Ga0111539_10278980 3300009094 Bacteria 1945
195 Ga0111539_11823472 3300009094 Unclassified 705
196 Ga0105245_10000396 3300009098 Bacteria 40404
197 Ga0105245_10001876 3300009098 Bacteria 19071
198 Ga0105245_10019143 3300009098 Bacteria 5994
199 Ga0105245_10129874 3300009098 Bacteria 2362
200 Ga0105245_10405987 3300009098 Bacteria 1363
201 Ga0105245_10452969 3300009098 Unclassified 1292
202 Ga0105245_10493003 3300009098 Unclassified 1240
203 Ga0105245_10728006 3300009098 Unclassified 1027
204 Ga0105245_10763632 3300009098 Unclassified 1003
205 Ga0105247_10020751 3300009101 Bacteria 3950
206 Ga0114129_10062745 3300009147 Bacteria 5190
207 Ga0114129_10113598 3300009147 Bacteria 3734
208 Ga0114129_11287851 3300009147 Bacteria 906
209 Ga0114129_12013302 3300009147 Unclassified 698
210 Ga0105241_10022338 3300009174 Unclassified 4685
211 Ga0105241_10194037 3300009174 Bacteria 1692
212 Ga0105241_10320215 3300009174 Unclassified 1337
213 Ga0105242_10000408 3300009176 Bacteria 34230
214 Ga0105242_10001571 3300009176 Bacteria 17970
215 Ga0105242_10064946 3300009176 Bacteria 3010
216 Ga0105242_10074300 3300009176 Bacteria 2828
217 Ga0105242_10295390 3300009176 Unclassified 1477
218 Ga0105248_10000819 3300009177 Bacteria 34882
219 Ga0105248_10000962 3300009177 Bacteria 32074
220 Ga0105248_10004527 3300009177 Bacteria 15379
221 Ga0105248_10024286 3300009177 Bacteria 6739
222 Ga0105248_10033188 3300009177 Bacteria 5766
223 Ga0105248_10092444 3300009177 Bacteria 3407
224 Ga0105248_10162680 3300009177 Bacteria 2517
225 Ga0105248_10469745 3300009177 Bacteria 1418
226 Ga0105248_10552227 3300009177 Bacteria 1299
227 Ga0105248_10908975 3300009177 Unclassified 994
228 Ga0105248_11156773 3300009177 Unclassified 875
229 Ga0105248_11192283 3300009177 Unclassified 861
230 Ga0105248_11246450 3300009177 Unclassified 841
231 Ga0105237_10019793 3300009545 Bacteria 6949
232 Ga0105237_10148041 3300009545 Bacteria 2343
233 Ga0105237_10241642 3300009545 Bacteria 1807
234 Ga0105237_10425886 3300009545 Unclassified 1333
235 Ga0105237_10482986 3300009545 Unclassified 1245
236 Ga0105238_10003931 3300009551 Bacteria 14746
237 Ga0105238_10046825 3300009551 Unclassified 4361
238 Ga0105238_10064583 3300009551 Bacteria 3660
239 Ga0105238_10081752 3300009551 Unclassified 3220
240 Ga0105238_10281309 3300009551 Unclassified 1645
241 Ga0105249_10519758 3300009553 Bacteria 1237
242 Ga0105249_10576505 3300009553 Unclassified 1178
243 Ga0105249_11580041 3300009553 Unclassified 728
244 Ga0105239_10014771 3300010375 Bacteria 8661
245 Ga0105239_10141571 3300010375 Unclassified 2680
246 Ga0105246_10039459 3300011119 Unclassified 3181
247 Ga0105246_10234029 3300011119 Unclassified 1448
248 Ga0105246_10511993 3300011119 Unclassified 1021
249 Ga0157370_10001957 3300013104 Bacteria 25376
250 Ga0157370_10499590 3300013104 Bacteria 1117
251 Ga0157369_10031735 3300013105 Bacteria 5813
252 Ga0157369_10061703 3300013105 Bacteria 4040
253 Ga0157374_10023744 3300013296 Bacteria 5489
254 Ga0157374_10171149 3300013296 Bacteria 2119
255 Ga0157374_10179610 3300013296 Unclassified 2067
256 Ga0157374_10260161 3300013296 Unclassified 1709
257 Ga0157374_10308836 3300013296 Bacteria 1565
258 Ga0157374_10363818 3300013296 Unclassified 1439
259 Ga0157374_10675008 3300013296 Bacteria 1045
260 Ga0157374_11291084 3300013296 Unclassified 752
261 Ga0157378_10003139 3300013297 Bacteria 14687
262 Ga0157378_10006801 3300013297 Bacteria 9977
263 Ga0157378_10036241 3300013297 Bacteria 4366
264 Ga0157378_10040498 3300013297 Unclassified 4132
265 Ga0157378_10177899 3300013297 Bacteria 1999
266 Ga0163162_10001353 3300013306 Bacteria 22813
267 Ga0163162_10031713 3300013306 Bacteria 5243
268 Ga0163162_10033733 3300013306 Bacteria 5088
269 Ga0163162_10267817 3300013306 Unclassified 1840
270 Ga0163162_10422096 3300013306 Unclassified 1466
271 Ga0163162_10507288 3300013306 Unclassified 1336
272 Ga0163162_10702056 3300013306 Bacteria 1133
273 Ga0157372_10009180 3300013307 Bacteria 10511
274 Ga0157372_10096230 3300013307 Bacteria 3374
275 Ga0157375_10003906 3300013308 Bacteria 12927
276 Ga0157375_10008517 3300013308 Bacteria 8980
277 Ga0157375_10213716 3300013308 Bacteria 2086
278 Ga0157375_10500896 3300013308 Unclassified 1379
279 Ga0157375_10585281 3300013308 Bacteria 1276
280 Ga0157375_11218958 3300013308 Unclassified 883
281 Ga0163163_10006233 3300014325 Bacteria 10405
282 Ga0163163_10006652 3300014325 Bacteria 10127
283 Ga0163163_10018834 3300014325 Bacteria 6474
284 Ga0163163_10021651 3300014325 Bacteria 6070
285 Ga0163163_10022010 3300014325 Bacteria 6027
286 Ga0163163_10026647 3300014325 Bacteria 5528
287 Ga0163163_10065454 3300014325 Unclassified 3608
288 Ga0163163_10076450 3300014325 Unclassified 3343
289 Ga0163163_10178506 3300014325 Bacteria 2170
290 Ga0163163_10327703 3300014325 Bacteria 1585
291 Ga0157380_10050560 3300014326 Unclassified 3284
292 Ga0157380_10404476 3300014326 Bacteria 1296
293 Ga0157380_11438377 3300014326 Bacteria 741
294 Ga0157377_10061318 3300014745 Bacteria 2149
295 Ga0157377_10142855 3300014745 Unclassified 1472
296 Ga0157377_10181176 3300014745 Unclassified 1325
297 Ga0157379_10000296 3300014968 Bacteria 39507
298 Ga0157379_10000700 3300014968 Bacteria 27183
299 Ga0157379_10062473 3300014968 Unclassified 3331
300 Ga0157379_10613159 3300014968 Unclassified 1016
301 Ga0157376_10086720 3300014969 Bacteria 2699
302 Ga0157376_10489315 3300014969 Unclassified 1207
303 Ga0163161_10048436 3300017792 Bacteria 3069
304 Ga0206349_1050718 3300020075 Unclassified 1069
305 Ga0154015_1169972 3300020610 Bacteria 2043
306 Ga0213874_10003238 3300021377 Unclassified 3589
307 Ga0213876_10072217 3300021384 Bacteria 1822
308 Ga0213876_10093954 3300021384 Unclassified 1589
309 Ga0207682_10175846 3300025893 Unclassified 976
310 Ga0207710_10043666 3300025900 Unclassified 1994
311 Ga0207680_10003515 3300025903 Bacteria 7371
312 Ga0207680_10009468 3300025903 Bacteria 4835
313 Ga0207680_10026856 3300025903 Bacteria 3196
314 Ga0207699_10280072 3300025906 Unclassified 1158
315 Ga0207645_10413834 3300025907 Unclassified 908
316 Ga0207654_10016510 3300025911 Bacteria 3846
317 Ga0207654_10225179 3300025911 Unclassified 1246
318 Ga0207707_10053207 3300025912 Unclassified 3524
319 Ga0207707_10095794 3300025912 Bacteria 2594
320 Ga0207707_10248568 3300025912 Unclassified 1545
321 Ga0207695_10086666 3300025913 Unclassified 3158
322 Ga0207671_10007883 3300025914 Bacteria 9144
323 Ga0207671_10070645 3300025914 Bacteria 2603
324 Ga0207671_10515065 3300025914 Unclassified 954
325 Ga0207660_10205296 3300025917 Bacteria 1541
326 Ga0207660_10625644 3300025917 Unclassified 877
327 Ga0207662_10021368 3300025918 Unclassified 3699
328 Ga0207662_10060658 3300025918 Bacteria 2269
329 Ga0207657_10186040 3300025919 Bacteria 1677
330 Ga0207649_10010353 3300025920 Bacteria 5120
331 Ga0207649_10176953 3300025920 Unclassified 1491
332 Ga0207649_10299674 3300025920 Bacteria 1175
333 Ga0207652_11023989 3300025921 Unclassified 725
334 Ga0207681_10031697 3300025923 Unclassified 3454
335 Ga0207681_10399831 3300025923 Unclassified 1109
336 Ga0207681_10637180 3300025923 Unclassified 883
337 Ga0207681_10663840 3300025923 Unclassified 865
338 Ga0207694_10002199 3300025924 Bacteria 16029
339 Ga0207694_10027878 3300025924 Unclassified 4304
340 Ga0207694_10056241 3300025924 Unclassified 3055
341 Ga0207694_10091464 3300025924 Bacteria 2401
342 Ga0207650_10001300 3300025925 Bacteria 18113
343 Ga0207650_10388278 3300025925 Bacteria 1154
344 Ga0207659_10001005 3300025926 Bacteria 16772
345 Ga0207659_10003062 3300025926 Bacteria 9983
346 Ga0207659_10003372 3300025926 Bacteria 9575
347 Ga0207659_10004857 3300025926 Bacteria 8145
348 Ga0207659_10136966 3300025926 Unclassified 1896
349 Ga0207659_10248104 3300025926 Bacteria 1443
350 Ga0207687_10016201 3300025927 Unclassified 4893
351 Ga0207687_10072626 3300025927 Bacteria 2462
352 Ga0207687_10141744 3300025927 Unclassified 1824
353 Ga0207687_10154045 3300025927 Bacteria 1757
354 Ga0207687_10541983 3300025927 Unclassified 975
355 Ga0207700_10296242 3300025928 Bacteria 1395
356 Ga0207644_10006341 3300025931 Bacteria 7703
357 Ga0207644_10117833 3300025931 Unclassified 2017
358 Ga0207644_10139665 3300025931 Bacteria 1864
359 Ga0207644_10143760 3300025931 Unclassified 1839
360 Ga0207644_10507361 3300025931 Unclassified 995
361 Ga0207644_10609464 3300025931 Bacteria 907
362 Ga0207644_10879992 3300025931 Bacteria 750
363 Ga0207690_10142887 3300025932 Bacteria 1766
364 Ga0207706_10012116 3300025933 Bacteria 7853
365 Ga0207706_10204138 3300025933 Bacteria 1733
366 Ga0207686_10010311 3300025934 Bacteria 5084
367 Ga0207686_10030400 3300025934 Unclassified 3197
368 Ga0207709_10631291 3300025935 Unclassified 851
369 Ga0207670_10010579 3300025936 Bacteria 5321
370 Ga0207670_10025445 3300025936 Bacteria 3715
371 Ga0207670_10029395 3300025936 Bacteria 3501
372 Ga0207670_10889991 3300025936 Unclassified 745
373 Ga0207669_10543051 3300025937 Unclassified 937
374 Ga0207704_10658664 3300025938 Unclassified 863
375 Ga0207691_10010552 3300025940 Bacteria 8863
376 Ga0207691_10105684 3300025940 Bacteria 2508
377 Ga0207711_10001292 3300025941 Bacteria 23730
378 Ga0207711_10002705 3300025941 Bacteria 15655
379 Ga0207711_10003834 3300025941 Bacteria 12934
380 Ga0207711_10006585 3300025941 Bacteria 9781
381 Ga0207711_10027477 3300025941 Bacteria 4779
382 Ga0207711_10082519 3300025941 Unclassified 2810
383 Ga0207711_10360514 3300025941 Unclassified 1347
384 Ga0207711_11133589 3300025941 Bacteria 723
385 Ga0207689_10068722 3300025942 Bacteria 2911
386 Ga0207661_10065643 3300025944 Bacteria 2947
387 Ga0207679_10003639 3300025945 Bacteria 9549
388 Ga0207679_10027957 3300025945 Unclassified 3907
389 Ga0207679_10047993 3300025945 Bacteria 3106
390 Ga0207679_10449663 3300025945 Bacteria 1142
391 Ga0207679_10741372 3300025945 Bacteria 893
392 Ga0207667_10010997 3300025949 Bacteria 10545
393 Ga0207667_10039760 3300025949 Bacteria 5010
394 Ga0207667_10241071 3300025949 Bacteria 1850
395 Ga0207667_10380198 3300025949 Bacteria 1439
396 Ga0207651_10003600 3300025960 Bacteria 7629
397 Ga0207651_10053524 3300025960 Bacteria 2760
398 Ga0207651_10204656 3300025960 Bacteria 1584
399 Ga0207712_10516166 3300025961 Unclassified 1023
400 Ga0207712_10684518 3300025961 Unclassified 894
401 Ga0207640_10286059 3300025981 Unclassified 1297
402 Ga0207658_10025540 3300025986 Bacteria 4137
403 Ga0207658_10084924 3300025986 Unclassified 2437
404 Ga0207658_10257992 3300025986 Unclassified 1484
405 Ga0207658_10277304 3300025986 Bacteria 1436
406 Ga0207658_10423528 3300025986 Unclassified 1174
407 Ga0207677_10023750 3300026023 Bacteria 3793
408 Ga0207677_10056146 3300026023 Bacteria 2696
409 Ga0207703_10005085 3300026035 Bacteria 10640
410 Ga0207703_10005383 3300026035 Bacteria 10306
411 Ga0207703_10009321 3300026035 Bacteria 7715
412 Ga0207703_10221010 3300026035 Bacteria 1693
413 Ga0207639_10049223 3300026041 Bacteria 3194
414 Ga0207702_10108756 3300026078 Bacteria 2460
415 Ga0207702_10648433 3300026078 Bacteria 1038
416 Ga0207702_11331198 3300026078 Unclassified 712
417 Ga0207641_10007494 3300026088 Bacteria 9084
418 Ga0207641_10041162 3300026088 Unclassified 3871
419 Ga0207641_10057096 3300026088 Bacteria 3319
420 Ga0207641_10082955 3300026088 Bacteria 2786
421 Ga0207641_10252203 3300026088 Unclassified 1648
422 Ga0207641_10348233 3300026088 Bacteria 1411
423 Ga0207641_10349240 3300026088 Bacteria 1409
424 Ga0207648_10022815 3300026089 Bacteria 5616
425 Ga0207648_10113781 3300026089 Unclassified 2377
426 Ga0207648_10347018 3300026089 Bacteria 1337
427 Ga0207648_10454942 3300026089 Bacteria 1166
428 Ga0207676_10005833 3300026095 Bacteria 8705
429 Ga0207676_10055643 3300026095 Bacteria 3107
430 Ga0207676_10067598 3300026095 Bacteria 2855
431 Ga0207676_10213657 3300026095 Bacteria 1713
432 Ga0207676_10473129 3300026095 Bacteria 1185
433 Ga0207676_10621801 3300026095 Unclassified 1039
434 Ga0207674_10000372 3300026116 Bacteria 58411
435 Ga0207674_10022633 3300026116 Bacteria 6745
436 Ga0207675_100184958 3300026118 Bacteria 1996
437 Ga0207675_100315003 3300026118 Unclassified 1526
438 Ga0207683_10506755 3300026121 Unclassified 1115
439 Ga0207698_10448525 3300026142 Unclassified 1245
440 Ga0207698_11051523 3300026142 Bacteria 826
441 Ga0207428_10109343 3300027907 Bacteria 2129
442 Ga0268266_10011367 3300028379 Bacteria 7741
443 Ga0268266_10029961 3300028379 Unclassified 4625
444 Ga0268266_10456625 3300028379 Bacteria 1215
445 Ga0268265_10032922 3300028380 Unclassified 3763
446 Ga0268264_10001104 3300028381 Bacteria 26660
447 Ga0268264_10007145 3300028381 Bacteria 9357
448 Ga0268264_10481606 3300028381 Bacteria 1207
449 Ga0268264_10577133 3300028381 Unclassified 1106
450 Ga0265338_10246171 3300028800 Bacteria 1321
451 Ga0265338_10387999 3300028800 Bacteria 998
452 Ga0265338_10803631 3300028800 Unclassified 644
453 Ga0265325_10234382 3300031241 Unclassified 836
454 Ga0265339_10183091 3300031249 Bacteria 1042
455 Ga0265316_10000650 3300031344 Bacteria 38648
456 Ga0265316_10010587 3300031344 Bacteria 8392
457 Ga0265316_10024021 3300031344 Bacteria 5118
458 Ga0265316_10702803 3300031344 Unclassified 713
459 Ga0265314_10001891 3300031711 Bacteria 22431
460 Ga0265342_10057908 3300031712 Bacteria 2292
461 Ga0265342_10078863 3300031712 Bacteria 1905
462 Ga0373934_0000676 3300035086 Bacteria 12086
463 Ga0373944_0011589 3300035089 Bacteria 2418
464 Ga0373936_0232089 3300035113 Bacteria 821
465 Ga0373953_0027253 3300035117 Bacteria 2195
466 Ga0373953_0220487 3300035117 Unclassified 822
467 Ga0373954_0002526 3300035118 Bacteria 7679
468 Ga0373956_0031522 3300035119 Unclassified 2324
469 Ga0373957_0073907 3300035120 Unclassified 1337
470 Ga0373955_0016210 3300035172 Bacteria 3664
471 Ga0373935_0070598 3300035692 Bacteria 2252
472 Ga0373935_0918042 3300035692 Unclassified 649
473 Ga0373927_0178662 3300035695 Bacteria 1392
474 Ga0373933_0248632 3300035724 Unclassified 1145
475 Ga0373937_0003372 3300036401 Bacteria 13404
476 Ga0373937_0005962 3300036401 Bacteria 10491
477 Ga0373937_0013634 3300036401 Bacteria 7162
478 Ga0373937_0022262 3300036401 Bacteria 5697
479 Ga0373937_0578799 3300036401 Bacteria 1066
480 Ga0373925_0009355 3300037068 Bacteria 7135
481 Ga0373925_0218268 3300037068 Bacteria 1521
482 Ga0373925_0275631 3300037068 Unclassified 1354
483 Ga0436364_0151563 3300037853 Unclassified 1304
484 Ga0436364_0649589 3300037853 Unclassified 3820
485 Ga0436364_0993843 3300037853 Unclassified 1321
486 Ga0436364_1007562 3300037853 Unclassified 1171
487 Ga0436365_1784984 3300039437 Unclassified 1984
488 Ga0436363_0548126 3300039450 Bacteria 10411
489 Ga0436363_1206264 3300039450 Bacteria 858
490 Ga0451800_0451903 3300041459 Bacteria 951
491 Ga0451576_0259034 3300045051 Bacteria 1818
492 Ga0495592_0396365 3300046454 Unclassified 875
493 Ga0495629_0092249 3300046459 Unclassified 2114
494 Ga0495580_0001989 3300046472 Bacteria 17975
495 Ga0495580_0010543 3300046472 Bacteria 7195
496 Ga0495580_0166872 3300046472 Bacteria 1522
497 Ga0495580_0211072 3300046472 Unclassified 1336
498 Ga0495580_0245797 3300046472 Bacteria 1226
499 Ga0495582_0105524 3300046473 Bacteria 1580
500 Ga0495639_0132802 3300046475 Unclassified 1193
501 Ga0495639_0148095 3300046475 Unclassified 1131
502 Ga0495662_0190536 3300046476 Unclassified 1011
503 Ga0495594_0087989 3300046499 Bacteria 1739
504 Ga0495608_0077246 3300046511 Unclassified 2167
505 Ga0495618_0118730 3300046514 Unclassified 1694
506 Ga0495618_0152767 3300046514 Unclassified 1474
507 Ga0495628_0152143 3300046516 Bacteria 1762
508 Ga0495652_0020664 3300046529 Bacteria 5853
509 Ga0495652_0199661 3300046529 Unclassified 1519
510 Ga0495652_0470932 3300046529 Unclassified 876
511 Ga0495665_0104236 3300046531 Bacteria 1488
512 Ga0495665_0282139 3300046531 Unclassified 852
513 Ga0495586_0017680 3300046535 Unclassified 3792
514 Ga0495586_0020890 3300046535 Bacteria 3489
515 Ga0495586_0519976 3300046535 Unclassified 687
516 Ga0495645_0024112 3300046543 Bacteria 4412
517 Ga0495667_0000175 3300046559 Bacteria 43286
518 Ga0495634_0101275 3300046642 Unclassified 1861
519 Ga0495635_0067042 3300046663 Bacteria 2462
520 Ga0495657_0002111 3300046675 Bacteria 16895
521 Ga0495657_0321286 3300046675 Bacteria 920
522 Ga0495599_0016814 3300046678 Bacteria 4544
523 Ga0495599_0059492 3300046678 Bacteria 2390
524 Ga0495599_0092896 3300046678 Unclassified 1882
525 Ga0495658_0066189 3300046683 Bacteria 2087
526 Ga0495658_0258408 3300046683 Bacteria 1096
527 Ga0495658_0288459 3300046683 Bacteria 1037
528 Ga0495613_0017755 3300046689 Bacteria 5302
529 Ga0495613_0042387 3300046689 Bacteria 3368
530 Ga0495613_0053700 3300046689 Bacteria 2964
531 Ga0495600_0482353 3300046809 Bacteria 764
532 Ga0495604_0533313 3300047317 Unclassified 758
533 Ga0495636_0068779 3300047318 Bacteria 1508
534 Ga0495636_0256956 3300047318 Unclassified 809
535 Ga0495674_0054696 3300047319 Unclassified 3504
536 Ga0495674_0101969 3300047319 Bacteria 2441
537 Ga0495674_0260761 3300047319 Bacteria 1424
538 Ga0495676_0404280 3300047321 Unclassified 906
539 Ga0495675_0056224 3300047444 Bacteria 2495
540 Ga0495675_0167683 3300047444 Unclassified 1350
541 Ga0495675_0219349 3300047444 Bacteria 1152
542 Ga0495684_0031828 3300047471 Bacteria 4052
543 Ga0495684_0072419 3300047471 Bacteria 2618
544 Ga0495684_0319020 3300047471 Unclassified 1111
545 Ga0495684_0373979 3300047471 Unclassified 1007
546 Ga0495684_0563992 3300047471 Unclassified 773
547 Ga0496102_0115645 3300048905 Bacteria 2503
548 Ga0496112_0568295 3300048915 Unclassified 1067
549 Ga0496115_0299820 3300048918 Bacteria 1317
550 nmdc:mga05p37_1347176_c1 3300050507 Unclassified 723
551 nmdc:mga05p37_234281_c1 3300050507 Unclassified 2211
552 nmdc:mga05p37_384527_c1 3300050507 Bacteria 1643
553 nmdc:mga05p37_675839_c1 3300050507 Bacteria 1152
554 nmdc:mga06r32_101680_c1 3300050510 Bacteria 2821
555 nmdc:mga06r32_341399_c1 3300050510 Unclassified 1482
556 nmdc:mga08y16_14127_c1 3300050511 Bacteria 8406
557 nmdc:mga08y16_452365_c1 3300050511 Unclassified 1309
558 nmdc:mga0rr50_537319_c1 3300050513 Unclassified 995
559 nmdc:mga0a205_585556_c1 3300050515 Unclassified 969
560 Ga0501082_0588921 3300060353 Bacteria 973
561 Ga0495613_0317571
562 Ga0065714_10301243
563 Ga0065712_10228114
564 Ga0065707_10424540
565 Ga0070683_100022852
566 Ga0070690_100335523
567 Ga0068869_100130521
568 Ga0068869_100452931
569 Ga0068869_100954911
570 Ga0068869_101171505
571 Ga0070666_10000590
572 Ga0070666_10040759
573 Ga0070666_10064361
574 Ga0070680_100030030
575 Ga0068868_100022564
576 Ga0068868_100123080
577 Ga0070660_100987424
578 Ga0070689_100030418
579 Ga0070689_100048898
580 Ga0070687_100265182
581 Ga0070661_100404309
582 Ga0070669_100020496
583 Ga0070669_100147216
584 Ga0070675_100002217
585 Ga0070675_100004248
586 Ga0070675_100006304
587 Ga0070675_100006824
588 Ga0070675_100094096
589 Ga0070675_100344147
590 Ga0070671_100009501
591 Ga0070671_100011954
592 Ga0070671_100013342
593 Ga0070671_100298305
594 Ga0070671_100930512
595 Ga0070671_101020094
596 Ga0070673_100016978
597 Ga0070673_100027896
598 Ga0070673_100116342
599 Ga0070673_100192465
600 Ga0070673_100483197
601 Ga0070673_100629991
602 Ga0070673_100704676
603 Ga0070688_100009433
604 Ga0070688_100026613
605 Ga0070688_100166956
606 Ga0070659_100230973
607 Ga0070667_100004649
608 Ga0070667_100007435
609 Ga0070667_100012684
610 Ga0070667_100026175
611 Ga0070667_100322108
612 Ga0070667_100521984
613 Ga0070709_10051439
614 Ga0070709_10544885
615 Ga0070713_100074533
616 Ga0070713_100078091
617 Ga0070713_100482472
618 Ga0070701_10148159
619 Ga0070705_100158250
620 Ga0070705_100852378
621 Ga0070678_100135515
622 Ga0070678_100306499
623 Ga0070662_100167346
624 Ga0070662_100382909
625 Ga0070662_100396512
626 Ga0070681_10047115
627 Ga0070681_10062478
628 Ga0070681_10111108
629 Ga0070681_10250042
630 Ga0068867_100009624
631 Ga0068867_100729435
632 Ga0068867_100781887
633 Ga0070685_10002786
634 Ga0070685_10003277
635 Ga0070685_10035069
636 Ga0070685_10401469
637 Ga0070698_100647362
638 Ga0070679_100057024
639 Ga0070679_100080421
640 Ga0070679_100408615
641 Ga0070679_100645366
642 Ga0070684_100010300
643 Ga0070684_100281265
644 Ga0070684_100490660
645 Ga0070684_100760796
646 Ga0068853_100077454
647 Ga0068853_100136516
648 Ga0068853_100184080
649 Ga0070672_100014334
650 Ga0070672_101131504
651 Ga0070686_100062176
652 Ga0070686_100074717
653 Ga0070686_100122802
654 Ga0070665_100039198
655 Ga0070665_100111788
656 Ga0070665_100417157
657 Ga0070704_100085951
658 Ga0068855_100012858
659 Ga0068855_100071369
660 Ga0068855_100129185
661 Ga0068855_100437432
662 Ga0070664_100001274
663 Ga0070664_100013117
664 Ga0070664_100016225
665 Ga0070664_100040293
666 Ga0070664_100054275
667 Ga0068857_100013491
668 Ga0068857_100021249
669 Ga0068857_100138622
670 Ga0068857_100141687
671 Ga0068854_100105405
672 Ga0068856_100025016
673 Ga0068856_100307179
674 Ga0068856_100589787
675 Ga0068856_100807199
676 Ga0068856_100902644
677 Ga0068852_101171930
678 Ga0068852_101181747
679 Ga0068859_100001701
680 Ga0068859_100004708
681 Ga0068859_100004745
682 Ga0068859_100074969
683 Ga0068859_100151547
684 Ga0068859_100176364
685 Ga0068859_100247270
686 Ga0068859_100572917
687 Ga0068859_101021296
688 Ga0068864_100000763
689 Ga0068864_100012644
690 Ga0068864_100081371
691 Ga0068864_100156132
692 Ga0068864_100241289
693 Ga0068864_100289525
694 Ga0068864_100431483
695 Ga0068861_100288933
696 Ga0068870_10370404
697 Ga0068863_100000602
698 Ga0068863_100005556
699 Ga0068863_100023792
700 Ga0068863_100039846
701 Ga0068863_100188469
702 Ga0068863_100259460
703 Ga0068863_100261872
704 Ga0068858_100001314
705 Ga0068858_100026717
706 Ga0068858_100043871
707 Ga0068858_100191830
708 Ga0068860_100002055
709 Ga0068860_100006372
710 Ga0068860_100010785
711 Ga0068862_100037674
712 Ga0068862_100362794
713 Ga0081455_10566920
714 Ga0070717_10028369
715 Ga0070717_10046289
716 Ga0070717_10274536
717 Ga0097621_100005481
718 Ga0097621_100007924
719 Ga0097621_100015902
720 Ga0097621_100028910
721 Ga0097621_100099037
722 Ga0097621_100110722
723 Ga0097621_100130162
724 Ga0097621_100192394
725 Ga0068871_100008301
726 Ga0068871_100023708
727 Ga0068871_100035961
728 Ga0068871_100054464
729 Ga0068871_100061331
730 Ga0068871_100129482
731 Ga0075428_100444079
732 Ga0075430_100421224
733 Ga0075431_100047526
734 Ga0075431_100077766
735 Ga0075431_100200238
736 Ga0075433_10555766
737 Ga0075434_100044566
738 Ga0075434_100520199
739 Ga0068865_100007817
740 Ga0097620_100001701
741 Ga0097620_100004708
742 Ga0097620_100004744
743 Ga0097620_100074966
744 Ga0097620_100151553
745 Ga0097620_100176360
746 Ga0097620_100247272
747 Ga0097620_100572924
748 Ga0097620_101021316
749 Ga0105240_10000408
750 Ga0105240_10017123
751 Ga0105240_10017899
752 Ga0105240_10083491
753 Ga0105240_11662815
754 Ga0111539_10278980
755 Ga0111539_11823472
756 Ga0105245_10000396
757 Ga0105245_10001876
758 Ga0105245_10019143
759 Ga0105245_10129874
760 Ga0105245_10405987
761 Ga0105245_10452969
762 Ga0105245_10493003
763 Ga0105245_10728006
764 Ga0105245_10763632
765 Ga0105247_10020751
766 Ga0114129_10062745
767 Ga0114129_10113598
768 Ga0114129_11287851
769 Ga0114129_12013302
770 Ga0105241_10022338
771 Ga0105241_10194037
772 Ga0105241_10320215
773 Ga0105242_10000408
774 Ga0105242_10001571
775 Ga0105242_10064946
776 Ga0105242_10074300
777 Ga0105242_10295390
778 Ga0105248_10000819
779 Ga0105248_10000962
780 Ga0105248_10004527
781 Ga0105248_10024286
782 Ga0105248_10033188
783 Ga0105248_10092444
784 Ga0105248_10162680
785 Ga0105248_10469745
786 Ga0105248_10552227
787 Ga0105248_10908975
788 Ga0105248_11156773
789 Ga0105248_11192283
790 Ga0105248_11246450
791 Ga0105237_10019793
792 Ga0105237_10148041
793 Ga0105237_10241642
794 Ga0105237_10425886
795 Ga0105237_10482986
796 Ga0105238_10003931
797 Ga0105238_10046825
798 Ga0105238_10064583
799 Ga0105238_10081752
800 Ga0105238_10281309
801 Ga0105249_10519758
802 Ga0105249_10576505
803 Ga0105249_11580041
804 Ga0105239_10014771
805 Ga0105239_10141571
806 Ga0105246_10039459
807 Ga0105246_10234029
808 Ga0105246_10511993
809 Ga0157370_10001957
810 Ga0157370_10499590
811 Ga0157369_10031735
812 Ga0157369_10061703
813 Ga0157374_10023744
814 Ga0157374_10171149
815 Ga0157374_10179610
816 Ga0157374_10260161
817 Ga0157374_10308836
818 Ga0157374_10363818
819 Ga0157374_10675008
820 Ga0157374_11291084
821 Ga0157378_10003139
822 Ga0157378_10006801
823 Ga0157378_10036241
824 Ga0157378_10040498
825 Ga0157378_10177899
826 Ga0163162_10001353
827 Ga0163162_10031713
828 Ga0163162_10033733
829 Ga0163162_10267817
830 Ga0163162_10422096
831 Ga0163162_10507288
832 Ga0163162_10702056
833 Ga0157372_10009180
834 Ga0157372_10096230
835 Ga0157375_10003906
836 Ga0157375_10008517
837 Ga0157375_10213716
838 Ga0157375_10500896
839 Ga0157375_10585281
840 Ga0157375_11218958
841 Ga0163163_10006233
842 Ga0163163_10006652
843 Ga0163163_10018834
844 Ga0163163_10021651
845 Ga0163163_10022010
846 Ga0163163_10026647
847 Ga0163163_10065454
848 Ga0163163_10076450
849 Ga0163163_10178506
850 Ga0163163_10327703
851 Ga0157380_10050560
852 Ga0157380_10404476
853 Ga0157380_11438377
854 Ga0157377_10061318
855 Ga0157377_10142855
856 Ga0157377_10181176
857 Ga0157379_10000296
858 Ga0157379_10000700
859 Ga0157379_10062473
860 Ga0157379_10613159
861 Ga0157376_10086720
862 Ga0157376_10489315
863 Ga0163161_10048436
864 Ga0206349_1050718
865 Ga0154015_1169972
866 Ga0213874_10003238
867 Ga0213876_10072217
868 Ga0213876_10093954
869 Ga0207682_10175846
870 Ga0207710_10043666
871 Ga0207680_10003515
872 Ga0207680_10009468
873 Ga0207680_10026856
874 Ga0207699_10280072
875 Ga0207645_10413834
876 Ga0207654_10016510
877 Ga0207654_10225179
878 Ga0207707_10053207
879 Ga0207707_10095794
880 Ga0207707_10248568
881 Ga0207695_10086666
882 Ga0207671_10007883
883 Ga0207671_10070645
884 Ga0207671_10515065
885 Ga0207660_10205296
886 Ga0207660_10625644
887 Ga0207662_10021368
888 Ga0207662_10060658
889 Ga0207657_10186040
890 Ga0207649_10010353
891 Ga0207649_10176953
892 Ga0207649_10299674
893 Ga0207652_11023989
894 Ga0207681_10031697
895 Ga0207681_10399831
896 Ga0207681_10637180
897 Ga0207681_10663840
898 Ga0207694_10002199
899 Ga0207694_10027878
900 Ga0207694_10056241
901 Ga0207694_10091464
902 Ga0207650_10001300
903 Ga0207650_10388278
904 Ga0207659_10001005
905 Ga0207659_10003062
906 Ga0207659_10003372
907 Ga0207659_10004857
908 Ga0207659_10136966
909 Ga0207659_10248104
910 Ga0207687_10016201
911 Ga0207687_10072626
912 Ga0207687_10141744
913 Ga0207687_10154045
914 Ga0207687_10541983
915 Ga0207700_10296242
916 Ga0207644_10006341
917 Ga0207644_10117833
918 Ga0207644_10139665
919 Ga0207644_10143760
920 Ga0207644_10507361
921 Ga0207644_10609464
922 Ga0207644_10879992
923 Ga0207690_10142887
924 Ga0207706_10012116
925 Ga0207706_10204138
926 Ga0207686_10010311
927 Ga0207686_10030400
928 Ga0207709_10631291
929 Ga0207670_10010579
930 Ga0207670_10025445
931 Ga0207670_10029395
932 Ga0207670_10889991
933 Ga0207669_10543051
934 Ga0207704_10658664
935 Ga0207691_10010552
936 Ga0207691_10105684
937 Ga0207711_10001292
938 Ga0207711_10002705
939 Ga0207711_10003834
940 Ga0207711_10006585
941 Ga0207711_10027477
942 Ga0207711_10082519
943 Ga0207711_10360514
944 Ga0207711_11133589
945 Ga0207689_10068722
946 Ga0207661_10065643
947 Ga0207679_10003639
948 Ga0207679_10027957
949 Ga0207679_10047993
950 Ga0207679_10449663
951 Ga0207679_10741372
952 Ga0207667_10010997
953 Ga0207667_10039760
954 Ga0207667_10241071
955 Ga0207667_10380198
956 Ga0207651_10003600
957 Ga0207651_10053524
958 Ga0207651_10204656
959 Ga0207712_10516166
960 Ga0207712_10684518
961 Ga0207640_10286059
962 Ga0207658_10025540
963 Ga0207658_10084924
964 Ga0207658_10257992
965 Ga0207658_10277304
966 Ga0207658_10423528
967 Ga0207677_10023750
968 Ga0207677_10056146
969 Ga0207703_10005085
970 Ga0207703_10005383
971 Ga0207703_10009321
972 Ga0207703_10221010
973 Ga0207639_10049223
974 Ga0207702_10108756
975 Ga0207702_10648433
976 Ga0207702_11331198
977 Ga0207641_10007494
978 Ga0207641_10041162
979 Ga0207641_10057096
980 Ga0207641_10082955
981 Ga0207641_10252203
982 Ga0207641_10348233
983 Ga0207641_10349240
984 Ga0207648_10022815
985 Ga0207648_10113781
986 Ga0207648_10347018
987 Ga0207648_10454942
988 Ga0207676_10005833
989 Ga0207676_10055643
990 Ga0207676_10067598
991 Ga0207676_10213657
992 Ga0207676_10473129
993 Ga0207676_10621801
994 Ga0207674_10000372
995 Ga0207674_10022633
996 Ga0207675_100184958
997 Ga0207675_100315003
998 Ga0207683_10506755
999 Ga0207698_10448525
1000 Ga0207698_11051523
1001 Ga0207428_10109343
1002 Ga0268266_10011367
1003 Ga0268266_10029961
1004 Ga0268266_10456625
1005 Ga0268265_10032922
1006 Ga0268264_10001104
1007 Ga0268264_10007145
1008 Ga0268264_10481606
1009 Ga0268264_10577133
1010 Ga0265338_10246171
1011 Ga0265338_10387999
1012 Ga0265338_10803631
1013 Ga0265325_10234382
1014 Ga0265339_10183091
1015 Ga0265316_10000650
1016 Ga0265316_10010587
1017 Ga0265316_10024021
1018 Ga0265316_10702803
1019 Ga0265314_10001891
1020 Ga0265342_10057908
1021 Ga0265342_10078863
1022 Ga0373934_0000676
1023 Ga0373944_0011589
1024 Ga0373936_0232089
1025 Ga0373953_0027253
1026 Ga0373953_0220487
1027 Ga0373954_0002526
1028 Ga0373956_0031522
1029 Ga0373957_0073907
1030 Ga0373955_0016210
1031 Ga0373935_0070598
1032 Ga0373935_0918042
1033 Ga0373927_0178662
1034 Ga0373933_0248632
1035 Ga0373937_0003372
1036 Ga0373937_0005962
1037 Ga0373937_0013634
1038 Ga0373937_0022262
1039 Ga0373937_0578799
1040 Ga0373925_0009355
1041 Ga0373925_0218268
1042 Ga0373925_0275631
1043 Ga0436364_0151563
1044 Ga0436364_0649589
1045 Ga0436364_0993843
1046 Ga0436364_1007562
1047 Ga0436365_1784984
1048 Ga0436363_0548126
1049 Ga0436363_1206264
1050 Ga0451800_0451903
1051 Ga0451576_0259034
1052 Ga0495592_0396365
1053 Ga0495629_0092249
1054 Ga0495580_0001989
1055 Ga0495580_0010543
1056 Ga0495580_0166872
1057 Ga0495580_0211072
1058 Ga0495580_0245797
1059 Ga0495582_0105524
1060 Ga0495639_0132802
1061 Ga0495639_0148095
1062 Ga0495662_0190536
1063 Ga0495594_0087989
1064 Ga0495608_0077246
1065 Ga0495618_0118730
1066 Ga0495618_0152767
1067 Ga0495628_0152143
1068 Ga0495652_0020664
1069 Ga0495652_0199661
1070 Ga0495652_0470932
1071 Ga0495665_0104236
1072 Ga0495665_0282139
1073 Ga0495586_0017680
1074 Ga0495586_0020890
1075 Ga0495586_0519976
1076 Ga0495645_0024112
1077 Ga0495667_0000175
1078 Ga0495634_0101275
1079 Ga0495635_0067042
1080 Ga0495657_0002111
1081 Ga0495657_0321286
1082 Ga0495599_0016814
1083 Ga0495599_0059492
1084 Ga0495599_0092896
1085 Ga0495658_0066189
1086 Ga0495658_0258408
1087 Ga0495658_0288459
1088 Ga0495613_0017755
1089 Ga0495613_0042387
1090 Ga0495613_0053700
1091 Ga0495600_0482353
1092 Ga0495604_0533313
1093 Ga0495636_0068779
1094 Ga0495636_0256956
1095 Ga0495674_0054696
1096 Ga0495674_0101969
1097 Ga0495674_0260761
1098 Ga0495676_0404280
1099 Ga0495675_0056224
1100 Ga0495675_0167683
1101 Ga0495675_0219349
1102 Ga0495684_0031828
1103 Ga0495684_0072419
1104 Ga0495684_0319020
1105 Ga0495684_0373979
1106 Ga0495684_0563992
1107 Ga0496102_0115645
1108 Ga0496112_0568295
1109 Ga0496115_0299820
1110 nmdc:mga05p37_1347176_c1
1111 nmdc:mga05p37_234281_c1
1112 nmdc:mga05p37_384527_c1
1113 nmdc:mga05p37_675839_c1
1114 nmdc:mga06r32_101680_c1
1115 nmdc:mga06r32_341399_c1
1116 nmdc:mga08y16_14127_c1
1117 nmdc:mga08y16_452365_c1
1118 nmdc:mga0rr50_537319_c1
1119 nmdc:mga0a205_585556_c1
1120 Ga0501082_0588921

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04542

Sigma70_r2

Sigma-70 region 2

62

130

0.97

PF04545

Sigma70_r4

Sigma-70, region 4

174

221

0.97

PF08281

Sigma70_r4_2

Sigma-70, region 4

166

218

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
2o7g-assembly1.cif.gz_A crystal structure of the pribnow box recognition region of sigc from mycobacterium tuberculosis 0.9462 16 81
3vfz-assembly3.cif.gz_A crystal structure of -35 promoter binding domain of sigd of mycobacterium tuberculosis 0.9449 121 179
5fgm-assembly1.cif.gz_A streptomyces coelicolor sigr region 4 0.9384 123 184
8hnp-assembly1.cif.gz_B archaeal transcription factor mutant 0.9242 132 177
6jhe-assembly1.cif.gz_A crystal structure of bacillus subtilis sigw domain 4 in complexed with -35 element dna 0.9143 131 180
ID Description Score Start End Superfamily
af_P9WGH1_1_91_1.10.1740.10 Mainly Alpha;Orthogonal Bundle;Rna Polymerase Sigma Factor; Chain: A;RNA polymerase sigma factor, region 2, helix turn helix motif 0.9662 16 81 1.10.1740.10
3vfzA00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9597 127 179 1.10.10.10
2w48B01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9545 135 170 1.10.10.60
4go1B01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9483 134 173 1.10.10.10
2o7gA00 Mainly Alpha;Orthogonal Bundle;Rna Polymerase Sigma Factor; Chain: A;RNA polymerase sigma factor, region 2, helix turn helix motif 0.9462 16 81 1.10.1740.10
ID Description Score Start End GO Terms
AF-Q024P1-F1-model_v4 RNA polymerase, sigma-24 subunit, ECF subfamily 0.8749 5 182 GO:0003677
GO:0006352
GO:0016987
AF-A0A2N5JY03-F1-model_v4 deleted 0.8717 13 175
AF-Q024P1-F1-model_v4 RNA polymerase, sigma-24 subunit, ECF subfamily 0.8658 5 182 GO:0003677
GO:0006352
GO:0016987
AF-A0A7C3RL95-F1-model_v4 Sigma-70 family RNA polymerase sigma factor 0.8654 15 183 GO:0003677
GO:0006352
GO:0016987
AF-A0A1H9F1T8-F1-model_v4 RNA polymerase sigma-70 factor, ECF subfamily 0.861 15 181 GO:0003677
GO:0006352
GO:0016987

Map