F463568

General Info

Members Datasets Scaffolds Average Seq Length
559 243 1118 289

Family's Representative Sequence

Representative Sequence 3300025941|Ga0207711_10075582|Ga0207711_100755824
Length 317
Sequence VASDWWLEGSSTRPVTRNQPLATSLYMRNAVLLMAHGTPASLDDMPEYLRLVRGGRPPSPELVAEMRHNYAAIGGRSPLTDITLAQADALRARLRDSASVAVGMRTWRPFIKDALTDLAAGGHTRVIGIPMAPQFSSVSVQKYVDAAVAALPGHMQFQAVRSFSTHPLLVRAFAEKLRAAQPAHDELVVFTAHSVPLRVIEGGDAYAEEVSATASAVAAEAGVTQFALGYQSAGRTPEPWIGPELGELIAQRSAAGVQRFLIVPIGFVCDHTEILFDIDIQAASVARERGASLRRTESLNTSPTFIAMLEDLVRGML

Samples

Sample ID Description Type Environment
1 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
3 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
15 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
16 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
17 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
18 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
19 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
20 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
21 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
22 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
23 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
24 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
25 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
26 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
27 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
28 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
29 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
30 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
31 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
32 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
33 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
34 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
35 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
36 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
37 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
38 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
39 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
40 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
41 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
42 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
43 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
44 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
45 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
46 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
47 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
48 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
49 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
50 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
51 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
52 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
53 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
54 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
55 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
56 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
57 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
58 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
59 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
60 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
61 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
62 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
63 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
64 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
65 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
66 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
67 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
68 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
69 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
70 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
71 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
72 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
73 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
74 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
75 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
76 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
77 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
78 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
79 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
80 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
81 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
82 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
83 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
84 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
85 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
86 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
87 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
88 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
89 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
90 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
91 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
92 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
93 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
94 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
95 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
96 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
97 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
98 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
99 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
100 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
101 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
102 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
103 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
146 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
147 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
151 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
152 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
153 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
154 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
155 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
156 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
157 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
158 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
159 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
160 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
161 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
162 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
163 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
164 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
165 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
166 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
167 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
168 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
169 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
170 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
171 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
172 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
173 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
174 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
175 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
176 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
177 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
178 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
179 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
180 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
181 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
182 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
183 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
184 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
185 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
186 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
187 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
188 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
189 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
190 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
191 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
192 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
193 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
194 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
195 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
196 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
197 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
198 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
199 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
200 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
201 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
202 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
203 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
204 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
205 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
206 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
207 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
208 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
209 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
210 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
211 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
212 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
213 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
214 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
215 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
216 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
217 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
218 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
219 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
220 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
221 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
222 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
223 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
224 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
225 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
226 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
227 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
228 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
229 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
230 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
231 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
232 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
233 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
234 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
235 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
236 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
237 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
238 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
239 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
240 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
241 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
242 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
243 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.61
Nodule 0
Rhizoplane 2.5
Rhizosphere 95.89
Stem 0
Stem Tuber 0
Unclassified 9.66

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207711_10075582 3300025941 Bacteria 2932
2 Ga0065704_10014354 3300005289 Bacteria 2349
3 Ga0065712_10081924 3300005290 Bacteria 2963
4 Ga0065715_10101837 3300005293 Unclassified 3166
5 Ga0065715_10324391 3300005293 Unclassified 996
6 Ga0065707_10007249 3300005295 Bacteria 4108
7 Ga0070658_10020544 3300005327 Bacteria 5294
8 Ga0070676_10004539 3300005328 Bacteria 7314
9 Ga0070676_10303671 3300005328 Bacteria 1083
10 Ga0070676_10317668 3300005328 Bacteria 1061
11 Ga0070683_100546148 3300005329 Unclassified 1108
12 Ga0070690_100049064 3300005330 Bacteria 2690
13 Ga0070670_100017684 3300005331 Bacteria 6116
14 Ga0070670_100239071 3300005331 Bacteria 1581
15 Ga0068869_100225879 3300005334 Bacteria 1486
16 Ga0070666_10014454 3300005335 Bacteria 5026
17 Ga0070666_10047706 3300005335 Unclassified 2876
18 Ga0070666_10068302 3300005335 Unclassified 2415
19 Ga0068868_100054469 3300005338 Bacteria 3152
20 Ga0068868_100129526 3300005338 Bacteria 2064
21 Ga0068868_100170026 3300005338 Unclassified 1804
22 Ga0070660_100025972 3300005339 Bacteria 4358
23 Ga0070689_100025889 3300005340 Bacteria 4411
24 Ga0070689_100034083 3300005340 Bacteria 3883
25 Ga0070689_100038631 3300005340 Bacteria 3653
26 Ga0070691_10000274 3300005341 Bacteria 18037
27 Ga0070687_100017413 3300005343 Bacteria 3303
28 Ga0070661_100037927 3300005344 Bacteria 3507
29 Ga0070692_10023588 3300005345 Bacteria 3016
30 Ga0070692_10076979 3300005345 Bacteria 1789
31 Ga0070668_100015978 3300005347 Bacteria 5615
32 Ga0070668_100210168 3300005347 Bacteria 1600
33 Ga0070669_100073930 3300005353 Bacteria 2526
34 Ga0070669_100170803 3300005353 Bacteria 1695
35 Ga0070675_100004928 3300005354 Bacteria 10178
36 Ga0070675_100180122 3300005354 Bacteria 1827
37 Ga0070675_100318894 3300005354 Bacteria 1373
38 Ga0070675_100420011 3300005354 Bacteria 1196
39 Ga0070671_100051679 3300005355 Bacteria 3418
40 Ga0070671_100327242 3300005355 Bacteria 1306
41 Ga0070674_100011077 3300005356 Bacteria 5474
42 Ga0070674_100055322 3300005356 Bacteria 2747
43 Ga0070674_100216908 3300005356 Bacteria 1486
44 Ga0070673_100019928 3300005364 Bacteria 4827
45 Ga0070673_100067748 3300005364 Bacteria 2856
46 Ga0070688_100005782 3300005365 Bacteria 6538
47 Ga0070688_100008705 3300005365 Bacteria 5520
48 Ga0070688_100034522 3300005365 Bacteria 3064
49 Ga0070688_100063590 3300005365 Bacteria 2339
50 Ga0070667_100009819 3300005367 Bacteria 7934
51 Ga0070667_100214229 3300005367 Bacteria 1713
52 Ga0070703_10010060 3300005406 Bacteria 2668
53 Ga0070703_10017728 3300005406 Bacteria 2052
54 Ga0070703_10077739 3300005406 Bacteria 1123
55 Ga0070709_10034351 3300005434 Bacteria 3074
56 Ga0070713_100035047 3300005436 Bacteria 4038
57 Ga0070701_10001571 3300005438 Bacteria 8487
58 Ga0070701_10006090 3300005438 Bacteria 5046
59 Ga0070700_100002015 3300005441 Bacteria 10319
60 Ga0070700_100016335 3300005441 Bacteria 4227
61 Ga0070694_100011154 3300005444 Bacteria 5566
62 Ga0070694_100012519 3300005444 Bacteria 5276
63 Ga0070708_100048006 3300005445 Bacteria 3773
64 Ga0070708_100304795 3300005445 Bacteria 1500
65 Ga0070663_100152004 3300005455 Bacteria 1776
66 Ga0070678_100281447 3300005456 Bacteria 1407
67 Ga0070662_100194721 3300005457 Bacteria 1605
68 Ga0070662_100255968 3300005457 Bacteria 1409
69 Ga0070662_100312798 3300005457 Bacteria 1279
70 Ga0070681_10491781 3300005458 Bacteria 1140
71 Ga0068867_100052213 3300005459 Bacteria 3016
72 Ga0068867_100155632 3300005459 Bacteria 1799
73 Ga0070685_10040027 3300005466 Bacteria 2666
74 Ga0070685_10146479 3300005466 Unclassified 1492
75 Ga0070706_100018306 3300005467 Bacteria 6464
76 Ga0070706_100072481 3300005467 Bacteria 3187
77 Ga0070706_100600094 3300005467 Unclassified 1023
78 Ga0070707_100012986 3300005468 Bacteria 7782
79 Ga0070707_100047956 3300005468 Bacteria 4091
80 Ga0070698_100033253 3300005471 Bacteria 5341
81 Ga0070698_100088617 3300005471 Bacteria 3079
82 Ga0070698_100354386 3300005471 Bacteria 1399
83 Ga0070699_100004418 3300005518 Bacteria 12429
84 Ga0070699_100343002 3300005518 Bacteria 1345
85 Ga0070679_100086742 3300005530 Bacteria 3117
86 Ga0070679_100144840 3300005530 Bacteria 2354
87 Ga0070679_100212496 3300005530 Bacteria 1898
88 Ga0070697_100011554 3300005536 Bacteria 6898
89 Ga0070697_100063158 3300005536 Bacteria 3024
90 Ga0070672_100029038 3300005543 Bacteria 4143
91 Ga0070672_100210341 3300005543 Unclassified 1629
92 Ga0070672_100319680 3300005543 Bacteria 1319
93 Ga0070672_100374092 3300005543 Bacteria 1218
94 Ga0070686_100040577 3300005544 Unclassified 2904
95 Ga0070686_100041254 3300005544 Bacteria 2884
96 Ga0070686_100404471 3300005544 Bacteria 1039
97 Ga0070695_100002600 3300005545 Bacteria 10428
98 Ga0070695_100007879 3300005545 Bacteria 6307
99 Ga0070695_100075314 3300005545 Unclassified 2220
100 Ga0070696_100009271 3300005546 Bacteria 6589
101 Ga0070665_100007922 3300005548 Bacteria 10770
102 Ga0070665_100020938 3300005548 Bacteria 6572
103 Ga0070665_100044139 3300005548 Bacteria 4477
104 Ga0070704_100023462 3300005549 Bacteria 4030
105 Ga0070704_100173075 3300005549 Bacteria 1719
106 Ga0068855_100066898 3300005563 Bacteria 4188
107 Ga0068855_100262159 3300005563 Unclassified 1925
108 Ga0070664_100195701 3300005564 Bacteria 1802
109 Ga0068857_100113972 3300005577 Bacteria 2431
110 Ga0068856_100066705 3300005614 Bacteria 3556
111 Ga0068859_100007252 3300005617 Bacteria 11245
112 Ga0068859_100140632 3300005617 Bacteria 2487
113 Ga0068859_100323608 3300005617 Bacteria 1636
114 Ga0068859_100859880 3300005617 Bacteria 993
115 Ga0068864_100008563 3300005618 Bacteria 8442
116 Ga0068864_100174096 3300005618 Bacteria 1964
117 Ga0068864_100276544 3300005618 Bacteria 1566
118 Ga0068866_10008777 3300005718 Bacteria 4272
119 Ga0068866_10068985 3300005718 Bacteria 1861
120 Ga0068861_100023858 3300005719 Bacteria 4417
121 Ga0068861_100076205 3300005719 Bacteria 2613
122 Ga0068861_100128147 3300005719 Bacteria 2056
123 Ga0068861_100163866 3300005719 Bacteria 1836
124 Ga0068851_10038577 3300005834 Bacteria 2397
125 Ga0068863_100094489 3300005841 Unclassified 2838
126 Ga0068863_100171654 3300005841 Bacteria 2080
127 Ga0068863_100507728 3300005841 Bacteria 1188
128 Ga0068858_100012005 3300005842 Bacteria 8166
129 Ga0068858_100054555 3300005842 Bacteria 3695
130 Ga0068858_100090169 3300005842 Bacteria 2853
131 Ga0068858_100114481 3300005842 Bacteria 2520
132 Ga0068858_100216047 3300005842 Bacteria 1815
133 Ga0068858_100240155 3300005842 Bacteria 1719
134 Ga0068858_100267889 3300005842 Unclassified 1625
135 Ga0068858_100374353 3300005842 Bacteria 1366
136 Ga0068860_100064023 3300005843 Bacteria 3493
137 Ga0068860_100073390 3300005843 Bacteria 3252
138 Ga0068860_100086709 3300005843 Bacteria 2980
139 Ga0068860_100249492 3300005843 Unclassified 1728
140 Ga0068860_100512190 3300005843 Unclassified 1199
141 Ga0068860_100599346 3300005843 Bacteria 1107
142 Ga0068862_100034766 3300005844 Bacteria 4266
143 Ga0068862_100074342 3300005844 Bacteria 2937
144 Ga0068862_100097437 3300005844 Bacteria 2568
145 Ga0068862_100196426 3300005844 Bacteria 1818
146 Ga0081539_10012417 3300005985 Bacteria 6566
147 Ga0075365_10224997 3300006038 Bacteria 1316
148 Ga0075363_100138521 3300006048 Bacteria 1369
149 Ga0070712_100212302 3300006175 Bacteria 1527
150 Ga0075367_10067146 3300006178 Bacteria 2150
151 Ga0075366_10036344 3300006195 Bacteria 2904
152 Ga0097621_100155449 3300006237 Bacteria 1963
153 Ga0097621_100309655 3300006237 Bacteria 1397
154 Ga0068871_100002793 3300006358 Bacteria 11934
155 Ga0068871_100003046 3300006358 Bacteria 11499
156 Ga0068871_100007740 3300006358 Bacteria 7693
157 Ga0068871_100056343 3300006358 Bacteria 3195
158 Ga0068871_100361633 3300006358 Bacteria 1285
159 Ga0075428_100019003 3300006844 Bacteria 7601
160 Ga0075428_100048963 3300006844 Bacteria 4637
161 Ga0075428_100504861 3300006844 Bacteria 1294
162 Ga0075431_100002975 3300006847 Bacteria 16397
163 Ga0075431_100158747 3300006847 Bacteria 2326
164 Ga0075433_10009293 3300006852 Bacteria 7861
165 Ga0075433_10026002 3300006852 Bacteria 4952
166 Ga0075433_10031623 3300006852 Bacteria 4525
167 Ga0075433_10083085 3300006852 Bacteria 2826
168 Ga0075433_10117990 3300006852 Bacteria 2355
169 Ga0075433_10172689 3300006852 Bacteria 1923
170 Ga0075433_10297312 3300006852 Bacteria 1430
171 Ga0075434_100002495 3300006871 Bacteria 16216
172 Ga0075434_100003115 3300006871 Bacteria 14769
173 Ga0075434_100089678 3300006871 Bacteria 3076
174 Ga0075434_100122620 3300006871 Bacteria 2615
175 Ga0075434_100191136 3300006871 Bacteria 2068
176 Ga0075434_100234453 3300006871 Bacteria 1855
177 Ga0075434_100257746 3300006871 Bacteria 1763
178 Ga0075434_100292667 3300006871 Bacteria 1648
179 Ga0075434_100504963 3300006871 Bacteria 1230
180 Ga0075434_100611590 3300006871 Bacteria 1109
181 Ga0075429_100005439 3300006880 Bacteria 10969
182 Ga0075429_100007300 3300006880 Bacteria 9590
183 Ga0075429_100249524 3300006880 Bacteria 1554
184 Ga0068865_100005193 3300006881 Bacteria 7874
185 Ga0068865_100043609 3300006881 Bacteria 3066
186 Ga0068865_100059897 3300006881 Bacteria 2664
187 Ga0068865_100112597 3300006881 Bacteria 2010
188 Ga0068865_100329734 3300006881 Bacteria 1230
189 Ga0075436_100001718 3300006914 Bacteria 14994
190 Ga0075436_100023449 3300006914 Bacteria 4238
191 Ga0075436_100024319 3300006914 Bacteria 4163
192 Ga0075436_100123605 3300006914 Unclassified 1812
193 Ga0075436_100135912 3300006914 Bacteria 1726
194 Ga0075436_100143818 3300006914 Bacteria 1677
195 Ga0097620_100007252 3300006931 Bacteria 11245
196 Ga0097620_100140635 3300006931 Bacteria 2487
197 Ga0097620_100323588 3300006931 Bacteria 1636
198 Ga0097620_100859914 3300006931 Bacteria 993
199 Ga0075435_100000189 3300007076 Bacteria 36888
200 Ga0075435_100004108 3300007076 Bacteria 9977
201 Ga0075435_100006656 3300007076 Bacteria 8190
202 Ga0075435_100041383 3300007076 Bacteria 3683
203 Ga0075435_100062151 3300007076 Bacteria 3030
204 Ga0075435_100124593 3300007076 Bacteria 2153
205 Ga0075435_100157128 3300007076 Bacteria 1914
206 Ga0075435_100267729 3300007076 Bacteria 1457
207 Ga0105240_10007971 3300009093 Bacteria 15273
208 Ga0105240_10044110 3300009093 Bacteria 5669
209 Ga0105240_10251276 3300009093 Unclassified 2045
210 Ga0111539_10000113 3300009094 Bacteria 89042
211 Ga0111539_10001163 3300009094 Bacteria 34801
212 Ga0111539_10005541 3300009094 Bacteria 16324
213 Ga0111539_10015377 3300009094 Bacteria 9524
214 Ga0111539_10041743 3300009094 Bacteria 5513
215 Ga0111539_10063221 3300009094 Bacteria 4380
216 Ga0111539_10481695 3300009094 Unclassified 1445
217 Ga0111539_10548251 3300009094 Bacteria 1347
218 Ga0105245_10172751 3300009098 Bacteria 2059
219 Ga0105245_10350831 3300009098 Bacteria 1462
220 Ga0105245_10450860 3300009098 Bacteria 1295
221 Ga0105245_10668891 3300009098 Bacteria 1070
222 Ga0105247_10020269 3300009101 Bacteria 3998
223 Ga0105247_10061636 3300009101 Bacteria 2326
224 Ga0114129_10000304 3300009147 Bacteria 57173
225 Ga0114129_10000973 3300009147 Bacteria 37498
226 Ga0114129_10001441 3300009147 Bacteria 32078
227 Ga0114129_10008836 3300009147 Bacteria 14376
228 Ga0114129_10010838 3300009147 Bacteria 12990
229 Ga0114129_10028157 3300009147 Bacteria 7961
230 Ga0114129_10032236 3300009147 Bacteria 7406
231 Ga0114129_10076604 3300009147 Bacteria 4656
232 Ga0114129_10093085 3300009147 Bacteria 4176
233 Ga0114129_10111041 3300009147 Bacteria 3784
234 Ga0114129_10175097 3300009147 Bacteria 2923
235 Ga0114129_10186811 3300009147 Bacteria 2816
236 Ga0114129_10194362 3300009147 Bacteria 2753
237 Ga0114129_10248595 3300009147 Bacteria 2388
238 Ga0114129_10249543 3300009147 Bacteria 2383
239 Ga0114129_10812831 3300009147 Unclassified 1192
240 Ga0114129_10961935 3300009147 Bacteria 1078
241 Ga0114129_11085990 3300009147 Unclassified 1003
242 Ga0105243_10023948 3300009148 Bacteria 4652
243 Ga0105243_10091083 3300009148 Bacteria 2511
244 Ga0105243_10581861 3300009148 Bacteria 1075
245 Ga0105241_10288400 3300009174 Bacteria 1404
246 Ga0105242_10007403 3300009176 Bacteria 8452
247 Ga0105242_10019556 3300009176 Bacteria 5308
248 Ga0105242_10078318 3300009176 Bacteria 2759
249 Ga0105242_10136644 3300009176 Bacteria 2123
250 Ga0105242_10147674 3300009176 Bacteria 2047
251 Ga0105242_10189993 3300009176 Bacteria 1818
252 Ga0105248_10012470 3300009177 Bacteria 9374
253 Ga0105248_10018908 3300009177 Bacteria 7618
254 Ga0105248_10027872 3300009177 Bacteria 6289
255 Ga0105248_10048116 3300009177 Bacteria 4783
256 Ga0105248_10124011 3300009177 Bacteria 2914
257 Ga0105248_10125905 3300009177 Bacteria 2891
258 Ga0105248_10142530 3300009177 Unclassified 2703
259 Ga0105248_10312655 3300009177 Bacteria 1769
260 Ga0105238_10282816 3300009551 Bacteria 1640
261 Ga0105249_10121234 3300009553 Bacteria 2485
262 Ga0105249_10197217 3300009553 Unclassified 1968
263 Ga0105249_10541655 3300009553 Bacteria 1214
264 Ga0157374_10552587 3300013296 Unclassified 1159
265 Ga0157378_10116970 3300013297 Bacteria 2452
266 Ga0157378_10422239 3300013297 Bacteria 1318
267 Ga0163162_10115562 3300013306 Bacteria 2784
268 Ga0163162_10165603 3300013306 Unclassified 2334
269 Ga0163162_10371105 3300013306 Bacteria 1564
270 Ga0163162_10715711 3300013306 Unclassified 1122
271 Ga0157375_10083553 3300013308 Bacteria 3238
272 Ga0157375_10086789 3300013308 Bacteria 3181
273 Ga0163163_10083922 3300014325 Bacteria 3191
274 Ga0157380_10044104 3300014326 Bacteria 3493
275 Ga0157380_10082179 3300014326 Bacteria 2636
276 Ga0157377_10103805 3300014745 Bacteria 1698
277 Ga0157379_10010988 3300014968 Bacteria 7895
278 Ga0157379_10074736 3300014968 Bacteria 3033
279 Ga0157376_10012899 3300014969 Bacteria 6218
280 Ga0157376_10016785 3300014969 Bacteria 5569
281 Ga0157376_10029287 3300014969 Bacteria 4386
282 Ga0157376_10029487 3300014969 Bacteria 4370
283 Ga0157376_10115996 3300014969 Bacteria 2365
284 Ga0157376_10253122 3300014969 Bacteria 1646
285 Ga0207656_10160819 3300025321 Unclassified 1069
286 Ga0207653_10019824 3300025885 Bacteria 2123
287 Ga0207642_10003940 3300025899 Bacteria 4735
288 Ga0207710_10009810 3300025900 Bacteria 4024
289 Ga0207688_10049142 3300025901 Unclassified 2357
290 Ga0207680_10215415 3300025903 Unclassified 1314
291 Ga0207699_10029078 3300025906 Bacteria 3078
292 Ga0207645_10009489 3300025907 Bacteria 6725
293 Ga0207684_10476332 3300025910 Bacteria 1071
294 Ga0207707_10273751 3300025912 Bacteria 1463
295 Ga0207695_10147777 3300025913 Bacteria 2292
296 Ga0207662_10021170 3300025918 Unclassified 3713
297 Ga0207662_10059719 3300025918 Unclassified 2286
298 Ga0207657_10006081 3300025919 Bacteria 12554
299 Ga0207652_10044663 3300025921 Bacteria 3776
300 Ga0207652_10052787 3300025921 Bacteria 3491
301 Ga0207646_10008996 3300025922 Bacteria 9929
302 Ga0207646_10029177 3300025922 Bacteria 5016
303 Ga0207646_10138982 3300025922 Bacteria 2187
304 Ga0207646_10197216 3300025922 Bacteria 1818
305 Ga0207646_10225558 3300025922 Bacteria 1692
306 Ga0207681_10153492 3300025923 Unclassified 1728
307 Ga0207681_10298786 3300025923 Bacteria 1273
308 Ga0207650_10202942 3300025925 Bacteria 1589
309 Ga0207659_10000637 3300025926 Bacteria 20834
310 Ga0207687_10056811 3300025927 Bacteria 2746
311 Ga0207644_10006773 3300025931 Bacteria 7466
312 Ga0207706_10156859 3300025933 Bacteria 2001
313 Ga0207706_10183201 3300025933 Bacteria 1839
314 Ga0207670_10014648 3300025936 Bacteria 4662
315 Ga0207670_10018420 3300025936 Bacteria 4244
316 Ga0207670_10120912 3300025936 Bacteria 1903
317 Ga0207670_10250889 3300025936 Bacteria 1368
318 Ga0207704_10025513 3300025938 Bacteria 3226
319 Ga0207704_10312898 3300025938 Eukaryota 1208
320 Ga0207691_10041284 3300025940 Bacteria 4260
321 Ga0207691_10049047 3300025940 Bacteria 3869
322 Ga0207691_10104183 3300025940 Bacteria 2529
323 Ga0207691_10108565 3300025940 Bacteria 2469
324 Ga0207691_10185676 3300025940 Unclassified 1815
325 Ga0207691_10356303 3300025940 Bacteria 1251
326 Ga0207711_10021266 3300025941 Bacteria 5419
327 Ga0207711_10064776 3300025941 Bacteria 3157
328 Ga0207711_10104539 3300025941 Unclassified 2510
329 Ga0207711_10176089 3300025941 Bacteria 1943
330 Ga0207711_10197396 3300025941 Bacteria 1835
331 Ga0207711_10200636 3300025941 Bacteria 1820
332 Ga0207689_10083758 3300025942 Bacteria 2622
333 Ga0207661_10413208 3300025944 Unclassified 1225
334 Ga0207667_10032095 3300025949 Bacteria 5661
335 Ga0207651_10023585 3300025960 Bacteria 3789
336 Ga0207712_10279397 3300025961 Bacteria 1362
337 Ga0207668_10082952 3300025972 Bacteria 2331
338 Ga0207668_10112464 3300025972 Unclassified 2046
339 Ga0207658_10070304 3300025986 Bacteria 2648
340 Ga0207677_10268525 3300026023 Unclassified 1394
341 Ga0207703_10035321 3300026035 Bacteria 3972
342 Ga0207703_10100775 3300026035 Bacteria 2448
343 Ga0207703_10119294 3300026035 Bacteria 2262
344 Ga0207703_10123739 3300026035 Bacteria 2224
345 Ga0207703_10152783 3300026035 Bacteria 2014
346 Ga0207703_10215820 3300026035 Unclassified 1713
347 Ga0207703_10223506 3300026035 Bacteria 1685
348 Ga0207639_10518701 3300026041 Bacteria 1091
349 Ga0207678_10121146 3300026067 Bacteria 2232
350 Ga0207708_10014526 3300026075 Bacteria 5893
351 Ga0207708_10022163 3300026075 Bacteria 4797
352 Ga0207708_10053907 3300026075 Bacteria 3065
353 Ga0207708_10078054 3300026075 Bacteria 2542
354 Ga0207708_10330531 3300026075 Bacteria 1246
355 Ga0207641_10001439 3300026088 Bacteria 23394
356 Ga0207641_10233301 3300026088 Bacteria 1711
357 Ga0207641_10465942 3300026088 Bacteria 1223
358 Ga0207648_10047251 3300026089 Bacteria 3774
359 Ga0207648_10105001 3300026089 Bacteria 2478
360 Ga0207648_10122503 3300026089 Bacteria 2287
361 Ga0207648_10129684 3300026089 Bacteria 2219
362 Ga0207648_10181037 3300026089 Bacteria 1865
363 Ga0207648_10186136 3300026089 Bacteria 1839
364 Ga0207676_10038195 3300026095 Bacteria 3662
365 Ga0207676_10232968 3300026095 Bacteria 1647
366 Ga0207676_10501400 3300026095 Bacteria 1153
367 Ga0207674_10067564 3300026116 Bacteria 3599
368 Ga0207674_10190453 3300026116 Bacteria 2001
369 Ga0207675_100009897 3300026118 Bacteria 8920
370 Ga0207675_100015185 3300026118 Bacteria 7183
371 Ga0207675_100127048 3300026118 Bacteria 2416
372 Ga0207675_100145097 3300026118 Bacteria 2256
373 Ga0207675_100222697 3300026118 Bacteria 1818
374 Ga0207675_100478040 3300026118 Bacteria 1238
375 Ga0207683_10370443 3300026121 Bacteria 1316
376 Ga0209813_10049973 3300027866 Bacteria 1303
377 Ga0207428_10000197 3300027907 Bacteria 84315
378 Ga0207428_10006958 3300027907 Bacteria 10365
379 Ga0207428_10049506 3300027907 Unclassified 3367
380 Ga0268266_10027582 3300028379 Bacteria 4828
381 Ga0268266_10037300 3300028379 Bacteria 4141
382 Ga0268266_10234509 3300028379 Bacteria 1691
383 Ga0268265_10133297 3300028380 Bacteria 2068
384 Ga0268265_10288278 3300028380 Bacteria 1472
385 Ga0268265_10558858 3300028380 Bacteria 1087
386 Ga0268264_10049807 3300028381 Bacteria 3487
387 Ga0268264_10125572 3300028381 Bacteria 2267
388 Ga0268264_10127840 3300028381 Bacteria 2248
389 Ga0268264_10153185 3300028381 Unclassified 2069
390 Ga0268264_10366103 3300028381 Archaea 1377
391 Ga0268264_10429891 3300028381 Bacteria 1275
392 Ga0268264_10549416 3300028381 Bacteria 1133
393 Ga0265318_10030126 3300028577 Bacteria 2112
394 Ga0265332_10079164 3300031238 Bacteria 1395
395 Ga0307408_100314931 3300031548 Bacteria 1316
396 Ga0316579_10068388 3300031691 Bacteria 1680
397 Ga0316576_10053347 3300031727 Unclassified 2946
398 Ga0373948_0002304 3300034817 Bacteria 2801
399 Ga0373958_0001439 3300034819 Bacteria 3202
400 Ga0373958_0022102 3300034819 Unclassified 1186
401 Ga0373959_0002109 3300034820 Bacteria 3174
402 Ga0373928_0026791 3300035084 Bacteria 1250
403 Ga0373934_0029184 3300035086 Bacteria 2153
404 Ga0373944_0140014 3300035089 Bacteria 847
405 Ga0373949_0009791 3300035090 Bacteria 2098
406 Ga0373951_0000437 3300035091 Bacteria 12172
407 Ga0373932_0000260 3300035112 Bacteria 16071
408 Ga0373932_0100679 3300035112 Bacteria 940
409 Ga0373936_0015593 3300035113 Bacteria 2912
410 Ga0373939_0051116 3300035114 Unclassified 1284
411 Ga0373941_0001741 3300035115 Bacteria 4674
412 Ga0373945_0110471 3300035116 Bacteria 1084
413 Ga0373956_0083092 3300035119 Bacteria 1471
414 Ga0373960_0005132 3300035121 Bacteria 3020
415 Ga0373943_0016170 3300035170 Bacteria 3399
416 Ga0373955_0209365 3300035172 Bacteria 1162
417 Ga0373955_0433230 3300035172 Bacteria 801
418 Ga0373942_0021012 3300035207 Bacteria 1643
419 Ga0373961_0005667 3300035241 Bacteria 2998
420 Ga0373962_0018097 3300035242 Bacteria 1830
421 Ga0373924_0006482 3300035410 Bacteria 4193
422 Ga0373931_0000499 3300035691 Bacteria 16005
423 Ga0373935_0028970 3300035692 Bacteria 3425
424 Ga0373947_0036676 3300035725 Bacteria 2908
425 Ga0373937_0069370 3300036401 Bacteria 3250
426 Ga0373937_0232782 3300036401 Bacteria 1735
427 Ga0316582_0155596 3300036647 Bacteria 1547
428 Ga0373925_0032196 3300037068 Bacteria 3858
429 Ga0439435_0014072 3300042436 Bacteria 1971
430 Ga0439435_0048730 3300042436 Bacteria 1207
431 Ga0439460_0010280 3300042461 Bacteria 2392
432 Ga0451576_0042753 3300045051 Bacteria 4784
433 Ga0451576_0186552 3300045051 Bacteria 2166
434 Ga0495629_0091337 3300046459 Bacteria 2125
435 Ga0495629_0187549 3300046459 Bacteria 1432
436 Ga0495580_0060989 3300046472 Bacteria 2649
437 Ga0495582_0059879 3300046473 Bacteria 2101
438 Ga0495582_0318747 3300046473 Bacteria 894
439 Ga0495628_0093436 3300046516 Bacteria 2326
440 Ga0495630_0016635 3300046517 Bacteria 5379
441 Ga0495640_0103470 3300046533 Bacteria 1867
442 Ga0495586_0214363 3300046535 Bacteria 1093
443 Ga0495645_0045725 3300046543 Bacteria 3194
444 Ga0495645_0219238 3300046543 Bacteria 1280
445 Ga0495634_0066324 3300046642 Bacteria 2390
446 Ga0495659_0119147 3300046664 Bacteria 1038
447 Ga0495658_0010929 3300046683 Bacteria 4550
448 Ga0495658_0186868 3300046683 Bacteria 1287
449 Ga0495669_0000747 3300046684 Bacteria 13962
450 Ga0495613_0001615 3300046689 Bacteria 17153
451 Ga0495613_0216985 3300046689 Bacteria 1344
452 Ga0495600_0098037 3300046809 Bacteria 1911
453 Ga0495581_0101192 3300047315 Bacteria 1674
454 Ga0495604_0190262 3300047317 Bacteria 1430
455 Ga0495674_0221165 3300047319 Bacteria 1565
456 Ga0495684_0000581 3300047471 Bacteria 29549
457 Ga0496100_0095002 3300048903 Bacteria 2043
458 Ga0496102_0302435 3300048905 Bacteria 1508
459 Ga0496104_0127006 3300048907 Bacteria 2449
460 Ga0496104_0135810 3300048907 Bacteria 2363
461 Ga0496104_0450943 3300048907 Archaea 1198
462 Ga0496105_0246290 3300048908 Bacteria 1449
463 Ga0496106_0120833 3300048909 Bacteria 2048
464 Ga0496108_0103897 3300048911 Bacteria 2424
465 Ga0496109_0176107 3300048912 Bacteria 2008
466 Ga0496112_0020556 3300048915 Bacteria 6259
467 Ga0496112_0652549 3300048915 Unclassified 982
468 Ga0496113_0419995 3300048916 Bacteria 1074
469 Ga0496114_0000233 3300048917 Bacteria 40546
470 Ga0496115_0039023 3300048918 Unclassified 3771
471 Ga0501042_0197590 3300049578 Unclassified 1450
472 Ga0501046_0003192 3300049580 Bacteria 15097
473 Ga0501046_0331538 3300049580 Unclassified 1107
474 Ga0501048_0046658 3300049582 Bacteria 3092
475 Ga0501048_0079879 3300049582 Bacteria 2308
476 Ga0501071_0065675 3300049587 Bacteria 2635
477 Ga0501072_0102127 3300049588 Bacteria 2279
478 Ga0501072_0105104 3300049588 Bacteria 2245
479 Ga0501074_0055058 3300049590 Bacteria 2868
480 Ga0501075_0125828 3300049591 Bacteria 1951
481 Ga0501075_0216593 3300049591 Unclassified 1461
482 Ga0501076_0076141 3300049592 Bacteria 2691
483 Ga0501076_0158887 3300049592 Bacteria 1841
484 Ga0501079_0352405 3300049741 Bacteria 1153
485 Ga0501081_0001723 3300049743 Bacteria 13581
486 Ga0501081_0020512 3300049743 Bacteria 4404
487 Ga0501081_0173181 3300049743 Bacteria 1559
488 Ga0501081_0246133 3300049743 Bacteria 1304
489 Ga0501035_0052943 3300049822 Bacteria 3631
490 Ga0501045_0093692 3300049824 Unclassified 2221
491 Ga0501045_0235953 3300049824 Bacteria 1362
492 nmdc:mga03n38_71036_c1 3300050490 Bacteria 1611
493 nmdc:mga0yw44_5567_c1 3300050492 Bacteria 5976
494 nmdc:mga0k408_196_c1 3300050493 Bacteria 31871
495 nmdc:mga06z11_780_c1 3300050494 Bacteria 11625
496 nmdc:mga05p37_110685_c1 3300050507 Bacteria 3378
497 nmdc:mga05p37_11442_c1 3300050507 Bacteria 10566
498 nmdc:mga05p37_12782_c1 3300050507 Bacteria 10033
499 nmdc:mga05p37_1569_c2 3300050507 Bacteria 4882
500 nmdc:mga05p37_194227_c1 3300050507 Bacteria 2462
501 nmdc:mga05p37_251179_c1 3300050507 Bacteria 2121
502 nmdc:mga05p37_281364_c1 3300050507 Bacteria 1984
503 nmdc:mga05p37_33124_c1 3300050507 Bacteria 6328
504 nmdc:mga05p37_354068_c1 3300050507 Bacteria 1728
505 nmdc:mga05p37_6071_c1 3300050507 Bacteria 14221
506 nmdc:mga05p37_692388_c1 3300050507 Bacteria 1134
507 nmdc:mga09592_4461_c1 3300050508 Bacteria 11320
508 nmdc:mga06r32_223957_c1 3300050510 Bacteria 1869
509 nmdc:mga06r32_295814_c1 3300050510 Bacteria 1605
510 nmdc:mga06r32_3842_c1 3300050510 Bacteria 13442
511 nmdc:mga08y16_10700_c1 3300050511 Bacteria 9626
512 nmdc:mga08y16_136164_c1 3300050511 Unclassified 2553
513 nmdc:mga08y16_322284_c1 3300050511 Bacteria 1591
514 nmdc:mga08y16_3313_c1 3300050511 Bacteria 16684
515 nmdc:mga08y16_574404_c1 3300050511 Bacteria 1139
516 nmdc:mga0n895_121_c1 3300050512 Bacteria 46448
517 nmdc:mga0n895_128071_c1 3300050512 Bacteria 2563
518 nmdc:mga0n895_225816_c1 3300050512 Bacteria 1901
519 nmdc:mga0n895_27863_c1 3300050512 Bacteria 5368
520 nmdc:mga0n895_428595_c1 3300050512 Unclassified 1337
521 nmdc:mga0n895_451814_c1 3300050512 Unclassified 1297
522 nmdc:mga0n895_462583_c1 3300050512 Unclassified 1280
523 nmdc:mga0n895_552389_c1 3300050512 Bacteria 1157
524 nmdc:mga0n895_80056_c1 3300050512 Bacteria 3254
525 nmdc:mga0n895_91077_c1 3300050512 Bacteria 3051
526 nmdc:mga0rr50_107_c1 3300050513 Bacteria 46254
527 nmdc:mga0rr50_168574_c1 3300050513 Bacteria 1782
528 nmdc:mga0rr50_198153_c1 3300050513 Bacteria 1649
529 nmdc:mga0rr50_322070_c1 3300050513 Bacteria 1296
530 nmdc:mga0rr50_367782_c1 3300050513 Bacteria 1211
531 nmdc:mga0rr50_42030_c1 3300050513 Bacteria 3335
532 nmdc:mga0rr50_532376_c1 3300050513 Bacteria 1000
533 nmdc:mga0rr50_551305_c1 3300050513 Bacteria 982
534 nmdc:mga0rr50_673_c1 3300050513 Bacteria 18292
535 nmdc:mga0rr50_77998_c1 3300050513 Bacteria 2548
536 nmdc:mga08x19_122502_c1 3300050514 Bacteria 1744
537 nmdc:mga08x19_37494_c1 3300050514 Bacteria 3077
538 nmdc:mga08x19_967_c1 3300050514 Bacteria 17964
539 nmdc:mga0a205_110801_c1 3300050515 Bacteria 2644
540 nmdc:mga0a205_11152_c1 3300050515 Bacteria 8272
541 nmdc:mga0a205_13590_c1 3300050515 Bacteria 3984
542 nmdc:mga0a205_146602_c1 3300050515 Bacteria 2260
543 nmdc:mga0a205_244793_c1 3300050515 Bacteria 1674
544 nmdc:mga0a205_32323_c1 3300050515 Bacteria 5017
545 nmdc:mga0a205_340469_c1 3300050515 Unclassified 1368
546 nmdc:mga0a205_8826_c1 3300050515 Bacteria 9180
547 nmdc:mga0a205_9954_c1 3300050515 Bacteria 8722
548 Ga0495601_0005915 3300053077 Bacteria 7135
549 Ga0495601_0094773 3300053077 Bacteria 1924
550 Ga0495595_0032613 3300053084 Bacteria 2347
551 Ga0495595_0070600 3300053084 Bacteria 1650
552 Ga0495619_0000721 3300053085 Bacteria 21611
553 Ga0495619_0019689 3300053085 Bacteria 4293
554 Ga0495619_0038074 3300053085 Bacteria 3136
555 Ga0501084_0415332 3300054114 Bacteria 1137
556 Ga0501082_0029670 3300060353 Bacteria 4713
557 Ga0501082_0338397 3300060353 Bacteria 1311
558 Ga0530510_0226205 3300061734 Bacteria 1391
559 Ga0530510_0634211 3300061734 Bacteria 813
560 Ga0207711_10075582
561 Ga0065704_10014354
562 Ga0065712_10081924
563 Ga0065715_10101837
564 Ga0065715_10324391
565 Ga0065707_10007249
566 Ga0070658_10020544
567 Ga0070676_10004539
568 Ga0070676_10303671
569 Ga0070676_10317668
570 Ga0070683_100546148
571 Ga0070690_100049064
572 Ga0070670_100017684
573 Ga0070670_100239071
574 Ga0068869_100225879
575 Ga0070666_10014454
576 Ga0070666_10047706
577 Ga0070666_10068302
578 Ga0068868_100054469
579 Ga0068868_100129526
580 Ga0068868_100170026
581 Ga0070660_100025972
582 Ga0070689_100025889
583 Ga0070689_100034083
584 Ga0070689_100038631
585 Ga0070691_10000274
586 Ga0070687_100017413
587 Ga0070661_100037927
588 Ga0070692_10023588
589 Ga0070692_10076979
590 Ga0070668_100015978
591 Ga0070668_100210168
592 Ga0070669_100073930
593 Ga0070669_100170803
594 Ga0070675_100004928
595 Ga0070675_100180122
596 Ga0070675_100318894
597 Ga0070675_100420011
598 Ga0070671_100051679
599 Ga0070671_100327242
600 Ga0070674_100011077
601 Ga0070674_100055322
602 Ga0070674_100216908
603 Ga0070673_100019928
604 Ga0070673_100067748
605 Ga0070688_100005782
606 Ga0070688_100008705
607 Ga0070688_100034522
608 Ga0070688_100063590
609 Ga0070667_100009819
610 Ga0070667_100214229
611 Ga0070703_10010060
612 Ga0070703_10017728
613 Ga0070703_10077739
614 Ga0070709_10034351
615 Ga0070713_100035047
616 Ga0070701_10001571
617 Ga0070701_10006090
618 Ga0070700_100002015
619 Ga0070700_100016335
620 Ga0070694_100011154
621 Ga0070694_100012519
622 Ga0070708_100048006
623 Ga0070708_100304795
624 Ga0070663_100152004
625 Ga0070678_100281447
626 Ga0070662_100194721
627 Ga0070662_100255968
628 Ga0070662_100312798
629 Ga0070681_10491781
630 Ga0068867_100052213
631 Ga0068867_100155632
632 Ga0070685_10040027
633 Ga0070685_10146479
634 Ga0070706_100018306
635 Ga0070706_100072481
636 Ga0070706_100600094
637 Ga0070707_100012986
638 Ga0070707_100047956
639 Ga0070698_100033253
640 Ga0070698_100088617
641 Ga0070698_100354386
642 Ga0070699_100004418
643 Ga0070699_100343002
644 Ga0070679_100086742
645 Ga0070679_100144840
646 Ga0070679_100212496
647 Ga0070697_100011554
648 Ga0070697_100063158
649 Ga0070672_100029038
650 Ga0070672_100210341
651 Ga0070672_100319680
652 Ga0070672_100374092
653 Ga0070686_100040577
654 Ga0070686_100041254
655 Ga0070686_100404471
656 Ga0070695_100002600
657 Ga0070695_100007879
658 Ga0070695_100075314
659 Ga0070696_100009271
660 Ga0070665_100007922
661 Ga0070665_100020938
662 Ga0070665_100044139
663 Ga0070704_100023462
664 Ga0070704_100173075
665 Ga0068855_100066898
666 Ga0068855_100262159
667 Ga0070664_100195701
668 Ga0068857_100113972
669 Ga0068856_100066705
670 Ga0068859_100007252
671 Ga0068859_100140632
672 Ga0068859_100323608
673 Ga0068859_100859880
674 Ga0068864_100008563
675 Ga0068864_100174096
676 Ga0068864_100276544
677 Ga0068866_10008777
678 Ga0068866_10068985
679 Ga0068861_100023858
680 Ga0068861_100076205
681 Ga0068861_100128147
682 Ga0068861_100163866
683 Ga0068851_10038577
684 Ga0068863_100094489
685 Ga0068863_100171654
686 Ga0068863_100507728
687 Ga0068858_100012005
688 Ga0068858_100054555
689 Ga0068858_100090169
690 Ga0068858_100114481
691 Ga0068858_100216047
692 Ga0068858_100240155
693 Ga0068858_100267889
694 Ga0068858_100374353
695 Ga0068860_100064023
696 Ga0068860_100073390
697 Ga0068860_100086709
698 Ga0068860_100249492
699 Ga0068860_100512190
700 Ga0068860_100599346
701 Ga0068862_100034766
702 Ga0068862_100074342
703 Ga0068862_100097437
704 Ga0068862_100196426
705 Ga0081539_10012417
706 Ga0075365_10224997
707 Ga0075363_100138521
708 Ga0070712_100212302
709 Ga0075367_10067146
710 Ga0075366_10036344
711 Ga0097621_100155449
712 Ga0097621_100309655
713 Ga0068871_100002793
714 Ga0068871_100003046
715 Ga0068871_100007740
716 Ga0068871_100056343
717 Ga0068871_100361633
718 Ga0075428_100019003
719 Ga0075428_100048963
720 Ga0075428_100504861
721 Ga0075431_100002975
722 Ga0075431_100158747
723 Ga0075433_10009293
724 Ga0075433_10026002
725 Ga0075433_10031623
726 Ga0075433_10083085
727 Ga0075433_10117990
728 Ga0075433_10172689
729 Ga0075433_10297312
730 Ga0075434_100002495
731 Ga0075434_100003115
732 Ga0075434_100089678
733 Ga0075434_100122620
734 Ga0075434_100191136
735 Ga0075434_100234453
736 Ga0075434_100257746
737 Ga0075434_100292667
738 Ga0075434_100504963
739 Ga0075434_100611590
740 Ga0075429_100005439
741 Ga0075429_100007300
742 Ga0075429_100249524
743 Ga0068865_100005193
744 Ga0068865_100043609
745 Ga0068865_100059897
746 Ga0068865_100112597
747 Ga0068865_100329734
748 Ga0075436_100001718
749 Ga0075436_100023449
750 Ga0075436_100024319
751 Ga0075436_100123605
752 Ga0075436_100135912
753 Ga0075436_100143818
754 Ga0097620_100007252
755 Ga0097620_100140635
756 Ga0097620_100323588
757 Ga0097620_100859914
758 Ga0075435_100000189
759 Ga0075435_100004108
760 Ga0075435_100006656
761 Ga0075435_100041383
762 Ga0075435_100062151
763 Ga0075435_100124593
764 Ga0075435_100157128
765 Ga0075435_100267729
766 Ga0105240_10007971
767 Ga0105240_10044110
768 Ga0105240_10251276
769 Ga0111539_10000113
770 Ga0111539_10001163
771 Ga0111539_10005541
772 Ga0111539_10015377
773 Ga0111539_10041743
774 Ga0111539_10063221
775 Ga0111539_10481695
776 Ga0111539_10548251
777 Ga0105245_10172751
778 Ga0105245_10350831
779 Ga0105245_10450860
780 Ga0105245_10668891
781 Ga0105247_10020269
782 Ga0105247_10061636
783 Ga0114129_10000304
784 Ga0114129_10000973
785 Ga0114129_10001441
786 Ga0114129_10008836
787 Ga0114129_10010838
788 Ga0114129_10028157
789 Ga0114129_10032236
790 Ga0114129_10076604
791 Ga0114129_10093085
792 Ga0114129_10111041
793 Ga0114129_10175097
794 Ga0114129_10186811
795 Ga0114129_10194362
796 Ga0114129_10248595
797 Ga0114129_10249543
798 Ga0114129_10812831
799 Ga0114129_10961935
800 Ga0114129_11085990
801 Ga0105243_10023948
802 Ga0105243_10091083
803 Ga0105243_10581861
804 Ga0105241_10288400
805 Ga0105242_10007403
806 Ga0105242_10019556
807 Ga0105242_10078318
808 Ga0105242_10136644
809 Ga0105242_10147674
810 Ga0105242_10189993
811 Ga0105248_10012470
812 Ga0105248_10018908
813 Ga0105248_10027872
814 Ga0105248_10048116
815 Ga0105248_10124011
816 Ga0105248_10125905
817 Ga0105248_10142530
818 Ga0105248_10312655
819 Ga0105238_10282816
820 Ga0105249_10121234
821 Ga0105249_10197217
822 Ga0105249_10541655
823 Ga0157374_10552587
824 Ga0157378_10116970
825 Ga0157378_10422239
826 Ga0163162_10115562
827 Ga0163162_10165603
828 Ga0163162_10371105
829 Ga0163162_10715711
830 Ga0157375_10083553
831 Ga0157375_10086789
832 Ga0163163_10083922
833 Ga0157380_10044104
834 Ga0157380_10082179
835 Ga0157377_10103805
836 Ga0157379_10010988
837 Ga0157379_10074736
838 Ga0157376_10012899
839 Ga0157376_10016785
840 Ga0157376_10029287
841 Ga0157376_10029487
842 Ga0157376_10115996
843 Ga0157376_10253122
844 Ga0207656_10160819
845 Ga0207653_10019824
846 Ga0207642_10003940
847 Ga0207710_10009810
848 Ga0207688_10049142
849 Ga0207680_10215415
850 Ga0207699_10029078
851 Ga0207645_10009489
852 Ga0207684_10476332
853 Ga0207707_10273751
854 Ga0207695_10147777
855 Ga0207662_10021170
856 Ga0207662_10059719
857 Ga0207657_10006081
858 Ga0207652_10044663
859 Ga0207652_10052787
860 Ga0207646_10008996
861 Ga0207646_10029177
862 Ga0207646_10138982
863 Ga0207646_10197216
864 Ga0207646_10225558
865 Ga0207681_10153492
866 Ga0207681_10298786
867 Ga0207650_10202942
868 Ga0207659_10000637
869 Ga0207687_10056811
870 Ga0207644_10006773
871 Ga0207706_10156859
872 Ga0207706_10183201
873 Ga0207670_10014648
874 Ga0207670_10018420
875 Ga0207670_10120912
876 Ga0207670_10250889
877 Ga0207704_10025513
878 Ga0207704_10312898
879 Ga0207691_10041284
880 Ga0207691_10049047
881 Ga0207691_10104183
882 Ga0207691_10108565
883 Ga0207691_10185676
884 Ga0207691_10356303
885 Ga0207711_10021266
886 Ga0207711_10064776
887 Ga0207711_10104539
888 Ga0207711_10176089
889 Ga0207711_10197396
890 Ga0207711_10200636
891 Ga0207689_10083758
892 Ga0207661_10413208
893 Ga0207667_10032095
894 Ga0207651_10023585
895 Ga0207712_10279397
896 Ga0207668_10082952
897 Ga0207668_10112464
898 Ga0207658_10070304
899 Ga0207677_10268525
900 Ga0207703_10035321
901 Ga0207703_10100775
902 Ga0207703_10119294
903 Ga0207703_10123739
904 Ga0207703_10152783
905 Ga0207703_10215820
906 Ga0207703_10223506
907 Ga0207639_10518701
908 Ga0207678_10121146
909 Ga0207708_10014526
910 Ga0207708_10022163
911 Ga0207708_10053907
912 Ga0207708_10078054
913 Ga0207708_10330531
914 Ga0207641_10001439
915 Ga0207641_10233301
916 Ga0207641_10465942
917 Ga0207648_10047251
918 Ga0207648_10105001
919 Ga0207648_10122503
920 Ga0207648_10129684
921 Ga0207648_10181037
922 Ga0207648_10186136
923 Ga0207676_10038195
924 Ga0207676_10232968
925 Ga0207676_10501400
926 Ga0207674_10067564
927 Ga0207674_10190453
928 Ga0207675_100009897
929 Ga0207675_100015185
930 Ga0207675_100127048
931 Ga0207675_100145097
932 Ga0207675_100222697
933 Ga0207675_100478040
934 Ga0207683_10370443
935 Ga0209813_10049973
936 Ga0207428_10000197
937 Ga0207428_10006958
938 Ga0207428_10049506
939 Ga0268266_10027582
940 Ga0268266_10037300
941 Ga0268266_10234509
942 Ga0268265_10133297
943 Ga0268265_10288278
944 Ga0268265_10558858
945 Ga0268264_10049807
946 Ga0268264_10125572
947 Ga0268264_10127840
948 Ga0268264_10153185
949 Ga0268264_10366103
950 Ga0268264_10429891
951 Ga0268264_10549416
952 Ga0265318_10030126
953 Ga0265332_10079164
954 Ga0307408_100314931
955 Ga0316579_10068388
956 Ga0316576_10053347
957 Ga0373948_0002304
958 Ga0373958_0001439
959 Ga0373958_0022102
960 Ga0373959_0002109
961 Ga0373928_0026791
962 Ga0373934_0029184
963 Ga0373944_0140014
964 Ga0373949_0009791
965 Ga0373951_0000437
966 Ga0373932_0000260
967 Ga0373932_0100679
968 Ga0373936_0015593
969 Ga0373939_0051116
970 Ga0373941_0001741
971 Ga0373945_0110471
972 Ga0373956_0083092
973 Ga0373960_0005132
974 Ga0373943_0016170
975 Ga0373955_0209365
976 Ga0373955_0433230
977 Ga0373942_0021012
978 Ga0373961_0005667
979 Ga0373962_0018097
980 Ga0373924_0006482
981 Ga0373931_0000499
982 Ga0373935_0028970
983 Ga0373947_0036676
984 Ga0373937_0069370
985 Ga0373937_0232782
986 Ga0316582_0155596
987 Ga0373925_0032196
988 Ga0439435_0014072
989 Ga0439435_0048730
990 Ga0439460_0010280
991 Ga0451576_0042753
992 Ga0451576_0186552
993 Ga0495629_0091337
994 Ga0495629_0187549
995 Ga0495580_0060989
996 Ga0495582_0059879
997 Ga0495582_0318747
998 Ga0495628_0093436
999 Ga0495630_0016635
1000 Ga0495640_0103470
1001 Ga0495586_0214363
1002 Ga0495645_0045725
1003 Ga0495645_0219238
1004 Ga0495634_0066324
1005 Ga0495659_0119147
1006 Ga0495658_0010929
1007 Ga0495658_0186868
1008 Ga0495669_0000747
1009 Ga0495613_0001615
1010 Ga0495613_0216985
1011 Ga0495600_0098037
1012 Ga0495581_0101192
1013 Ga0495604_0190262
1014 Ga0495674_0221165
1015 Ga0495684_0000581
1016 Ga0496100_0095002
1017 Ga0496102_0302435
1018 Ga0496104_0127006
1019 Ga0496104_0135810
1020 Ga0496104_0450943
1021 Ga0496105_0246290
1022 Ga0496106_0120833
1023 Ga0496108_0103897
1024 Ga0496109_0176107
1025 Ga0496112_0020556
1026 Ga0496112_0652549
1027 Ga0496113_0419995
1028 Ga0496114_0000233
1029 Ga0496115_0039023
1030 Ga0501042_0197590
1031 Ga0501046_0003192
1032 Ga0501046_0331538
1033 Ga0501048_0046658
1034 Ga0501048_0079879
1035 Ga0501071_0065675
1036 Ga0501072_0102127
1037 Ga0501072_0105104
1038 Ga0501074_0055058
1039 Ga0501075_0125828
1040 Ga0501075_0216593
1041 Ga0501076_0076141
1042 Ga0501076_0158887
1043 Ga0501079_0352405
1044 Ga0501081_0001723
1045 Ga0501081_0020512
1046 Ga0501081_0173181
1047 Ga0501081_0246133
1048 Ga0501035_0052943
1049 Ga0501045_0093692
1050 Ga0501045_0235953
1051 nmdc:mga03n38_71036_c1
1052 nmdc:mga0yw44_5567_c1
1053 nmdc:mga0k408_196_c1
1054 nmdc:mga06z11_780_c1
1055 nmdc:mga05p37_110685_c1
1056 nmdc:mga05p37_11442_c1
1057 nmdc:mga05p37_12782_c1
1058 nmdc:mga05p37_1569_c2
1059 nmdc:mga05p37_194227_c1
1060 nmdc:mga05p37_251179_c1
1061 nmdc:mga05p37_281364_c1
1062 nmdc:mga05p37_33124_c1
1063 nmdc:mga05p37_354068_c1
1064 nmdc:mga05p37_6071_c1
1065 nmdc:mga05p37_692388_c1
1066 nmdc:mga09592_4461_c1
1067 nmdc:mga06r32_223957_c1
1068 nmdc:mga06r32_295814_c1
1069 nmdc:mga06r32_3842_c1
1070 nmdc:mga08y16_10700_c1
1071 nmdc:mga08y16_136164_c1
1072 nmdc:mga08y16_322284_c1
1073 nmdc:mga08y16_3313_c1
1074 nmdc:mga08y16_574404_c1
1075 nmdc:mga0n895_121_c1
1076 nmdc:mga0n895_128071_c1
1077 nmdc:mga0n895_225816_c1
1078 nmdc:mga0n895_27863_c1
1079 nmdc:mga0n895_428595_c1
1080 nmdc:mga0n895_451814_c1
1081 nmdc:mga0n895_462583_c1
1082 nmdc:mga0n895_552389_c1
1083 nmdc:mga0n895_80056_c1
1084 nmdc:mga0n895_91077_c1
1085 nmdc:mga0rr50_107_c1
1086 nmdc:mga0rr50_168574_c1
1087 nmdc:mga0rr50_198153_c1
1088 nmdc:mga0rr50_322070_c1
1089 nmdc:mga0rr50_367782_c1
1090 nmdc:mga0rr50_42030_c1
1091 nmdc:mga0rr50_532376_c1
1092 nmdc:mga0rr50_551305_c1
1093 nmdc:mga0rr50_673_c1
1094 nmdc:mga0rr50_77998_c1
1095 nmdc:mga08x19_122502_c1
1096 nmdc:mga08x19_37494_c1
1097 nmdc:mga08x19_967_c1
1098 nmdc:mga0a205_110801_c1
1099 nmdc:mga0a205_11152_c1
1100 nmdc:mga0a205_13590_c1
1101 nmdc:mga0a205_146602_c1
1102 nmdc:mga0a205_244793_c1
1103 nmdc:mga0a205_32323_c1
1104 nmdc:mga0a205_340469_c1
1105 nmdc:mga0a205_8826_c1
1106 nmdc:mga0a205_9954_c1
1107 Ga0495601_0005915
1108 Ga0495601_0094773
1109 Ga0495595_0032613
1110 Ga0495595_0070600
1111 Ga0495619_0000721
1112 Ga0495619_0019689
1113 Ga0495619_0038074
1114 Ga0501084_0415332
1115 Ga0501082_0029670
1116 Ga0501082_0338397
1117 Ga0530510_0226205
1118 Ga0530510_0634211

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00762

Ferrochelatase

Ferrochelatase

28

317

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
8ofl-assembly1.cif.gz_A coproporphyrin iii - lmcpfc complex soaked 4min with fe2+ 0.9548 3 290
8aw7-assembly1.cif.gz_A structure of coproporphyrin iii-lmcpfc r45l 0.9475 2 290
8ofl-assembly1.cif.gz_A coproporphyrin iii - lmcpfc complex soaked 4min with fe2+ 0.9421 3 290
8aw7-assembly1.cif.gz_A structure of coproporphyrin iii-lmcpfc r45l 0.9381 2 290
2q3j-assembly1.cif.gz_A crystal structure of the his183ala variant of bacillus subtilis ferrochelatase in complex with n-methyl mesoporphyrin 0.9315 3 290
ID Description Score Start End Superfamily
af_Q54IA8_246_365_3.40.50.1400 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9196 161 270 3.40.50.1400
af_Q2FXA4_3_239_3.40.50.1400 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9151 3 223 3.40.50.1400
af_Q9V9S8_189_328_3.40.50.1400 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.908 141 270 3.40.50.1400
af_D3ZBM3_64_420_3.40.50.1400 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9038 3 290 3.40.50.1400
1ak1A02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.902 141 271 3.40.50.1400
ID Description Score Start End GO Terms
AF-A0A2V8DR72-F1-model_v4 Ferrochelatase (EC 4.98.1.1) 0.9917 42 291 GO:0004325
GO:0005737
GO:0006783
AF-A0A3N5Z1G8-F1-model_v4 Ferrochelatase (EC 4.98.1.1) 0.9859 1 290 GO:0004325
GO:0005737
GO:0006783
AF-A0A2V8DR72-F1-model_v4 Ferrochelatase (EC 4.98.1.1) 0.98 42 291 GO:0004325
GO:0005737
GO:0006783
AF-A0A3N5Z1G8-F1-model_v4 Ferrochelatase (EC 4.98.1.1) 0.9792 1 290 GO:0004325
GO:0005737
GO:0006783
AF-A0A2V7UMP2-F1-model_v4 coproporphyrin ferrochelatase (EC 4.99.1.9) 0.9772 4 240 GO:0004325
GO:0004729
GO:0006783

Map