F463359
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 557 | 281 | 1114 | 171 |
Family's Representative Sequence
| Representative Sequence | 3300049569|Ga0501032_0796536|Ga0501032_0796536_38_556 |
| Length | 156 |
| Sequence | MMNGMKIVLVVAVGENGIIGRGGQLPWHLRSDLQHFKRLTLGKPVIMGRKTYESIGKPLPQRTNIVVTRDAGFSAPGVLFASDLPAAFAMARADADKRGVDEIMVIGGSDVHASPAGDVSFPPIDRNLWREVAREHHMRGPQDDCDFTTLTYTRAR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 2 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 3 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 4 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 5 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 6 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 14 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 16 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 17 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 20 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 23 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 24 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 25 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 26 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 27 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 28 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 32 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 33 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 34 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 35 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 36 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 37 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 39 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 40 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 41 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 42 | 3300006194 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 | Metagenome | Rhizosphere |
| 43 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 44 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 45 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 46 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 47 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 48 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 49 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 50 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 51 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 52 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 53 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 54 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 55 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 56 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 57 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 58 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 59 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 60 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 61 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 62 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 63 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 64 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 65 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 66 | 3300012481 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.1.yng.040610 | Metagenome | Rhizosphere |
| 67 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 68 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 69 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 70 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 71 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 72 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 73 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 74 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 75 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 76 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 77 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 78 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 79 | 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Metagenome | Rhizosphere |
| 80 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 81 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 82 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 114 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 115 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 116 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 117 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 118 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 119 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 120 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 121 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 122 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 123 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 124 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 125 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 126 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 127 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 128 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 129 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 130 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 131 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 132 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 133 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 134 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 135 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 136 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 137 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 138 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 139 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 140 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 141 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 142 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 143 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 144 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 145 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 146 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 147 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 148 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 149 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 150 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 151 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 152 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 153 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 154 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 155 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 156 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 157 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 158 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 159 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 160 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 161 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 164 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 166 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 210 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 211 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 212 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 213 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 214 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 215 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 216 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 217 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 218 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 219 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 220 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 221 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 222 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 223 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 224 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 225 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 226 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 227 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 228 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 229 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 230 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 231 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 232 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 233 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 234 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 235 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 236 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 237 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 238 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 239 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 240 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 241 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 242 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 243 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 244 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 245 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 246 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 247 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 248 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 249 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 250 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 251 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 252 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 253 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 254 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 255 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 256 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 257 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 258 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 259 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 260 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 261 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 262 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 267 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 268 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 269 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 270 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 271 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 272 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 273 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 274 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 275 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 276 | 3300053728 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 endosphere | Metagenome | Endosphere |
| 277 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 278 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 279 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 280 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 281 | 2643221547 | Pseudolabrys sp. Root1462 | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.64 |
| Metatranscriptomes | 0.18 |
| Isolates | 0.18 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 3.41 |
| Nodule | 0 |
| Rhizoplane | 5.57 |
| Rhizosphere | 90.31 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 6.1 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0501032_0796536 | 3300049569 | Bacteria | 597 |
| 2 | JGI25165J46597_1027022 | 3300003214 | Bacteria | 743 |
| 3 | Ga0070658_10744498 | 3300005327 | Bacteria | 851 |
| 4 | Ga0070666_10389827 | 3300005335 | Unclassified | 1001 |
| 5 | Ga0070680_100080171 | 3300005336 | Bacteria | 2692 |
| 6 | Ga0070680_100273597 | 3300005336 | Bacteria | 1430 |
| 7 | Ga0070661_100025924 | 3300005344 | Bacteria | 4213 |
| 8 | Ga0070675_100490587 | 3300005354 | Unclassified | 1106 |
| 9 | Ga0070671_100093988 | 3300005355 | Bacteria | 2513 |
| 10 | Ga0070674_100023567 | 3300005356 | Bacteria | 3985 |
| 11 | Ga0070673_100055154 | 3300005364 | Bacteria | 3130 |
| 12 | Ga0070659_100149379 | 3300005366 | Bacteria | 1905 |
| 13 | Ga0070667_100056374 | 3300005367 | Bacteria | 3319 |
| 14 | Ga0070709_10186142 | 3300005434 | Bacteria | 1461 |
| 15 | Ga0070714_100018468 | 3300005435 | Bacteria | 5664 |
| 16 | Ga0070713_100359474 | 3300005436 | Bacteria | 1352 |
| 17 | Ga0070710_10053105 | 3300005437 | Bacteria | 2282 |
| 18 | Ga0070711_100006095 | 3300005439 | Bacteria | 7247 |
| 19 | Ga0070711_100056739 | 3300005439 | Bacteria | 2710 |
| 20 | Ga0070711_100115912 | 3300005439 | Bacteria | 1973 |
| 21 | Ga0070711_100143246 | 3300005439 | Bacteria | 1794 |
| 22 | Ga0070705_100083905 | 3300005440 | Bacteria | 1964 |
| 23 | Ga0070694_100313833 | 3300005444 | Bacteria | 1205 |
| 24 | Ga0070663_100060818 | 3300005455 | Bacteria | 2718 |
| 25 | Ga0070663_100769096 | 3300005455 | Unclassified | 824 |
| 26 | Ga0070678_100020530 | 3300005456 | Bacteria | 4336 |
| 27 | Ga0070678_100065070 | 3300005456 | Bacteria | 2705 |
| 28 | Ga0070681_10072090 | 3300005458 | Bacteria | 3417 |
| 29 | Ga0070681_10746707 | 3300005458 | Unclassified | 895 |
| 30 | Ga0070681_10750695 | 3300005458 | Bacteria | 892 |
| 31 | Ga0070685_10359643 | 3300005466 | Bacteria | 997 |
| 32 | Ga0070679_100028116 | 3300005530 | Bacteria | 5541 |
| 33 | Ga0070679_100095983 | 3300005530 | Bacteria | 2952 |
| 34 | Ga0070684_100775423 | 3300005535 | Bacteria | 896 |
| 35 | Ga0068853_100580542 | 3300005539 | Bacteria | 1064 |
| 36 | Ga0070695_100222047 | 3300005545 | Bacteria | 1362 |
| 37 | Ga0070696_100135573 | 3300005546 | Bacteria | 1795 |
| 38 | Ga0070693_100143658 | 3300005547 | Bacteria | 1505 |
| 39 | Ga0070665_100807073 | 3300005548 | Bacteria | 951 |
| 40 | Ga0070704_100580587 | 3300005549 | Unclassified | 983 |
| 41 | Ga0068855_100284816 | 3300005563 | Bacteria | 1834 |
| 42 | Ga0068856_100244772 | 3300005614 | Bacteria | 1808 |
| 43 | Ga0068856_101449378 | 3300005614 | Unclassified | 701 |
| 44 | Ga0068864_100205596 | 3300005618 | Bacteria | 1811 |
| 45 | Ga0068866_10808707 | 3300005718 | Unclassified | 652 |
| 46 | Ga0081455_10011386 | 3300005937 | Bacteria | 8941 |
| 47 | Ga0081455_10379928 | 3300005937 | Archaea | 987 |
| 48 | Ga0070717_10855056 | 3300006028 | Unclassified | 828 |
| 49 | Ga0075364_10243097 | 3300006051 | Bacteria | 1223 |
| 50 | Ga0075432_10027682 | 3300006058 | Bacteria | 1952 |
| 51 | Ga0070712_101002826 | 3300006175 | Unclassified | 723 |
| 52 | Ga0075367_10629146 | 3300006178 | Bacteria | 682 |
| 53 | Ga0075427_10002688 | 3300006194 | Bacteria | 2409 |
| 54 | Ga0097621_100033091 | 3300006237 | Bacteria | 4114 |
| 55 | Ga0075370_10150693 | 3300006353 | Bacteria | 1363 |
| 56 | Ga0068871_100163007 | 3300006358 | Bacteria | 1907 |
| 57 | Ga0075428_100387900 | 3300006844 | Bacteria | 1497 |
| 58 | Ga0075430_100205099 | 3300006846 | Bacteria | 1636 |
| 59 | Ga0075433_10024260 | 3300006852 | Bacteria | 5116 |
| 60 | Ga0075433_10305073 | 3300006852 | Unclassified | 1410 |
| 61 | Ga0075434_100117871 | 3300006871 | Bacteria | 2668 |
| 62 | Ga0075434_100264412 | 3300006871 | Bacteria | 1739 |
| 63 | Ga0075434_100494638 | 3300006871 | Bacteria | 1244 |
| 64 | Ga0075429_100268413 | 3300006880 | Bacteria | 1494 |
| 65 | Ga0075435_100287796 | 3300007076 | Bacteria | 1403 |
| 66 | Ga0075435_100399027 | 3300007076 | Bacteria | 1183 |
| 67 | Ga0105250_10070270 | 3300009092 | Bacteria | 1414 |
| 68 | Ga0105240_10398598 | 3300009093 | Bacteria | 1550 |
| 69 | Ga0105240_10501462 | 3300009093 | Unclassified | 1349 |
| 70 | Ga0105240_11220412 | 3300009093 | Bacteria | 796 |
| 71 | Ga0111539_10445139 | 3300009094 | Bacteria | 1508 |
| 72 | Ga0105245_10094403 | 3300009098 | Bacteria | 2757 |
| 73 | Ga0105245_10216433 | 3300009098 | Bacteria | 1846 |
| 74 | Ga0105247_10239316 | 3300009101 | Unclassified | 1236 |
| 75 | Ga0105247_10303420 | 3300009101 | Bacteria | 1109 |
| 76 | Ga0114129_10550688 | 3300009147 | Bacteria | 1500 |
| 77 | Ga0114129_11129938 | 3300009147 | Bacteria | 979 |
| 78 | Ga0105241_10389840 | 3300009174 | Bacteria | 1219 |
| 79 | Ga0105241_10582389 | 3300009174 | Bacteria | 1009 |
| 80 | Ga0105242_10138984 | 3300009176 | Bacteria | 2105 |
| 81 | Ga0105248_10020734 | 3300009177 | Bacteria | 7281 |
| 82 | Ga0105237_10344850 | 3300009545 | Bacteria | 1494 |
| 83 | Ga0105237_10357353 | 3300009545 | Bacteria | 1465 |
| 84 | Ga0105238_10275243 | 3300009551 | Bacteria | 1664 |
| 85 | Ga0105249_10137200 | 3300009553 | Bacteria | 2342 |
| 86 | Ga0105249_10977786 | 3300009553 | Unclassified | 915 |
| 87 | Ga0105239_10075495 | 3300010375 | Bacteria | 3706 |
| 88 | Ga0105239_12306382 | 3300010375 | Bacteria | 626 |
| 89 | Ga0105246_10029143 | 3300011119 | Bacteria | 3632 |
| 90 | Ga0105246_10054987 | 3300011119 | Bacteria | 2745 |
| 91 | Ga0157320_1001827 | 3300012481 | Bacteria | 1131 |
| 92 | Ga0157370_10157941 | 3300013104 | Bacteria | 2110 |
| 93 | Ga0157369_10230640 | 3300013105 | Bacteria | 1936 |
| 94 | Ga0157374_10197690 | 3300013296 | Bacteria | 1968 |
| 95 | Ga0157374_10453939 | 3300013296 | Bacteria | 1283 |
| 96 | Ga0157378_10062983 | 3300013297 | Bacteria | 3313 |
| 97 | Ga0157378_10200944 | 3300013297 | Bacteria | 1885 |
| 98 | Ga0163162_10197819 | 3300013306 | Bacteria | 2139 |
| 99 | Ga0163162_10250363 | 3300013306 | Bacteria | 1904 |
| 100 | Ga0157372_10276386 | 3300013307 | Bacteria | 1952 |
| 101 | Ga0157372_11558496 | 3300013307 | Unclassified | 761 |
| 102 | Ga0157375_10096786 | 3300013308 | Bacteria | 3025 |
| 103 | Ga0157375_10434160 | 3300013308 | Bacteria | 1479 |
| 104 | Ga0157375_11843294 | 3300013308 | Unclassified | 717 |
| 105 | Ga0163163_10212474 | 3300014325 | Bacteria | 1984 |
| 106 | Ga0157379_10060733 | 3300014968 | Bacteria | 3380 |
| 107 | Ga0157379_10274728 | 3300014968 | Bacteria | 1533 |
| 108 | Ga0157376_10051396 | 3300014969 | Bacteria | 3423 |
| 109 | Ga0157376_10316154 | 3300014969 | Bacteria | 1483 |
| 110 | Ga0163161_10517249 | 3300017792 | Unclassified | 974 |
| 111 | Ga0206356_11792220 | 3300020070 | Unclassified | 625 |
| 112 | Ga0213873_10123836 | 3300021358 | Bacteria | 761 |
| 113 | Ga0213876_10089048 | 3300021384 | Bacteria | 1635 |
| 114 | Ga0209233_1006346 | 3300025261 | Bacteria | 3819 |
| 115 | Ga0207692_10235457 | 3300025898 | Unclassified | 1091 |
| 116 | Ga0207710_10168418 | 3300025900 | Bacteria | 1070 |
| 117 | Ga0207685_10029768 | 3300025905 | Bacteria | 1937 |
| 118 | Ga0207707_10215606 | 3300025912 | Bacteria | 1671 |
| 119 | Ga0207707_10766812 | 3300025912 | Bacteria | 806 |
| 120 | Ga0207695_10351540 | 3300025913 | Bacteria | 1361 |
| 121 | Ga0207671_10113007 | 3300025914 | Bacteria | 2068 |
| 122 | Ga0207693_10008546 | 3300025915 | Bacteria | 8380 |
| 123 | Ga0207693_10302440 | 3300025915 | Bacteria | 1253 |
| 124 | Ga0207663_10053001 | 3300025916 | Bacteria | 2532 |
| 125 | Ga0207663_10161182 | 3300025916 | Bacteria | 1583 |
| 126 | Ga0207663_10170232 | 3300025916 | Bacteria | 1546 |
| 127 | Ga0207660_10205885 | 3300025917 | Bacteria | 1538 |
| 128 | Ga0207657_10035581 | 3300025919 | Bacteria | 4464 |
| 129 | Ga0207652_10018220 | 3300025921 | Bacteria | 5757 |
| 130 | Ga0207694_10155401 | 3300025924 | Bacteria | 1845 |
| 131 | Ga0207694_10184587 | 3300025924 | Bacteria | 1692 |
| 132 | Ga0207659_10175202 | 3300025926 | Bacteria | 1695 |
| 133 | Ga0207659_10643771 | 3300025926 | Bacteria | 906 |
| 134 | Ga0207687_10060600 | 3300025927 | Bacteria | 2670 |
| 135 | Ga0207664_10025181 | 3300025929 | Bacteria | 4478 |
| 136 | Ga0207664_10039614 | 3300025929 | Bacteria | 3659 |
| 137 | Ga0207644_10007589 | 3300025931 | Bacteria | 7073 |
| 138 | Ga0207706_10009732 | 3300025933 | Bacteria | 8821 |
| 139 | Ga0207686_10102853 | 3300025934 | Bacteria | 1910 |
| 140 | Ga0207669_10084551 | 3300025937 | Bacteria | 2045 |
| 141 | Ga0207711_10214164 | 3300025941 | Bacteria | 1760 |
| 142 | Ga0207689_10721643 | 3300025942 | Unclassified | 841 |
| 143 | Ga0207667_10149652 | 3300025949 | Bacteria | 2403 |
| 144 | Ga0207667_10602655 | 3300025949 | Bacteria | 1107 |
| 145 | Ga0207651_10067000 | 3300025960 | Bacteria | 2525 |
| 146 | Ga0207712_10031556 | 3300025961 | Bacteria | 3570 |
| 147 | Ga0207640_10133241 | 3300025981 | Bacteria | 1799 |
| 148 | Ga0207658_10160460 | 3300025986 | Bacteria | 1842 |
| 149 | Ga0207678_10021192 | 3300026067 | Bacteria | 5697 |
| 150 | Ga0207678_10021441 | 3300026067 | Bacteria | 5664 |
| 151 | Ga0207678_10262635 | 3300026067 | Bacteria | 1480 |
| 152 | Ga0207676_10126913 | 3300026095 | Bacteria | 2162 |
| 153 | Ga0207674_10279119 | 3300026116 | Bacteria | 1619 |
| 154 | Ga0207683_10050440 | 3300026121 | Bacteria | 3645 |
| 155 | Ga0207683_10338002 | 3300026121 | Bacteria | 1381 |
| 156 | Ga0268266_10478079 | 3300028379 | Bacteria | 1187 |
| 157 | Ga0268266_10869257 | 3300028379 | Bacteria | 872 |
| 158 | Ga0265337_1001493 | 3300028556 | Bacteria | 11469 |
| 159 | Ga0265338_10017281 | 3300028800 | Bacteria | 7785 |
| 160 | Ga0265330_10069879 | 3300031235 | Bacteria | 1520 |
| 161 | Ga0265325_10022838 | 3300031241 | Bacteria | 3422 |
| 162 | Ga0265325_10043030 | 3300031241 | Bacteria | 2358 |
| 163 | Ga0265340_10020486 | 3300031247 | Bacteria | 3398 |
| 164 | Ga0265331_10174776 | 3300031250 | Bacteria | 971 |
| 165 | Ga0265316_10078554 | 3300031344 | Bacteria | 2533 |
| 166 | Ga0265316_10181305 | 3300031344 | Bacteria | 1568 |
| 167 | Ga0265316_10627074 | 3300031344 | Unclassified | 761 |
| 168 | Ga0265313_10000513 | 3300031595 | Bacteria | 40580 |
| 169 | Ga0265313_10001570 | 3300031595 | Bacteria | 21191 |
| 170 | Ga0265313_10008665 | 3300031595 | Bacteria | 6726 |
| 171 | Ga0265313_10012327 | 3300031595 | Bacteria | 5229 |
| 172 | Ga0316579_10022141 | 3300031691 | Bacteria | 2839 |
| 173 | Ga0265314_10000771 | 3300031711 | Bacteria | 38181 |
| 174 | Ga0265314_10007590 | 3300031711 | Bacteria | 9389 |
| 175 | Ga0307405_10987218 | 3300031731 | Bacteria | 718 |
| 176 | Ga0307413_10126431 | 3300031824 | Bacteria | 1742 |
| 177 | Ga0307413_10200169 | 3300031824 | Bacteria | 1442 |
| 178 | Ga0307407_10245837 | 3300031903 | Bacteria | 1223 |
| 179 | Ga0307407_10514003 | 3300031903 | Bacteria | 880 |
| 180 | Ga0307409_100068917 | 3300031995 | Bacteria | 2800 |
| 181 | Ga0373930_0011268 | 3300034816 | Bacteria | 1612 |
| 182 | Ga0373950_0008438 | 3300034818 | Bacteria | 1622 |
| 183 | Ga0373958_0002453 | 3300034819 | Bacteria | 2601 |
| 184 | Ga0373938_0000453 | 3300034957 | Bacteria | 6689 |
| 185 | Ga0373926_0013097 | 3300035083 | Bacteria | 2809 |
| 186 | Ga0373934_0033608 | 3300035086 | Bacteria | 2013 |
| 187 | Ga0373944_0032533 | 3300035089 | Bacteria | 1576 |
| 188 | Ga0373951_0015860 | 3300035091 | Bacteria | 1699 |
| 189 | Ga0373952_0138559 | 3300035092 | Unclassified | 674 |
| 190 | Ga0373923_0000792 | 3300035111 | Bacteria | 8234 |
| 191 | Ga0373936_0001246 | 3300035113 | Bacteria | 9176 |
| 192 | Ga0373936_0125776 | 3300035113 | Bacteria | 1099 |
| 193 | Ga0373945_0020052 | 3300035116 | Bacteria | 2285 |
| 194 | Ga0373953_0017642 | 3300035117 | Bacteria | 2628 |
| 195 | Ga0373954_0009128 | 3300035118 | Bacteria | 4363 |
| 196 | Ga0373954_0016323 | 3300035118 | Bacteria | 3322 |
| 197 | Ga0373954_0025519 | 3300035118 | Bacteria | 2702 |
| 198 | Ga0373956_0009309 | 3300035119 | Bacteria | 3993 |
| 199 | Ga0373956_0075068 | 3300035119 | Bacteria | 1546 |
| 200 | Ga0373957_0164136 | 3300035120 | Bacteria | 916 |
| 201 | Ga0373960_0012957 | 3300035121 | Bacteria | 2082 |
| 202 | Ga0373943_0007158 | 3300035170 | Bacteria | 5005 |
| 203 | Ga0373946_0001845 | 3300035171 | Bacteria | 7409 |
| 204 | Ga0373955_0008402 | 3300035172 | Bacteria | 4795 |
| 205 | Ga0373955_0016631 | 3300035172 | Bacteria | 3624 |
| 206 | Ga0373942_0048570 | 3300035207 | Bacteria | 1183 |
| 207 | Ga0373962_0002352 | 3300035242 | Bacteria | 4513 |
| 208 | Ga0373924_0004724 | 3300035410 | Bacteria | 4780 |
| 209 | Ga0373924_0023311 | 3300035410 | Bacteria | 2426 |
| 210 | Ga0373924_0123129 | 3300035410 | Bacteria | 1126 |
| 211 | Ga0373924_0156503 | 3300035410 | Bacteria | 998 |
| 212 | Ga0373931_0010698 | 3300035691 | Bacteria | 4415 |
| 213 | Ga0373931_0321215 | 3300035691 | Bacteria | 961 |
| 214 | Ga0373935_0003876 | 3300035692 | Bacteria | 8728 |
| 215 | Ga0373935_0005968 | 3300035692 | Bacteria | 7226 |
| 216 | Ga0373935_0181526 | 3300035692 | Bacteria | 1445 |
| 217 | Ga0373935_0271627 | 3300035692 | Unclassified | 1191 |
| 218 | Ga0373927_0004839 | 3300035695 | Bacteria | 9361 |
| 219 | Ga0373933_0004411 | 3300035724 | Bacteria | 7729 |
| 220 | Ga0373947_0126534 | 3300035725 | Bacteria | 1627 |
| 221 | Ga0373947_0188464 | 3300035725 | Bacteria | 1345 |
| 222 | Ga0373937_0002145 | 3300036401 | Bacteria | 16512 |
| 223 | Ga0373937_0006979 | 3300036401 | Bacteria | 9748 |
| 224 | Ga0373937_0030415 | 3300036401 | Bacteria | 4891 |
| 225 | Ga0373937_0080020 | 3300036401 | Bacteria | 3021 |
| 226 | Ga0373937_0144865 | 3300036401 | Bacteria | 2223 |
| 227 | Ga0316582_0117604 | 3300036647 | Bacteria | 1776 |
| 228 | Ga0373925_0008524 | 3300037068 | Bacteria | 7471 |
| 229 | Ga0373925_0023646 | 3300037068 | Bacteria | 4483 |
| 230 | Ga0436365_1873778 | 3300039437 | Bacteria | 12049 |
| 231 | Ga0436365_1904201 | 3300039437 | Bacteria | 1475 |
| 232 | Ga0436362_0723276 | 3300039453 | Bacteria | 1820 |
| 233 | Ga0495592_0006856 | 3300046454 | Bacteria | 8504 |
| 234 | Ga0495592_0041995 | 3300046454 | Bacteria | 3425 |
| 235 | Ga0495603_0062839 | 3300046455 | Bacteria | 2191 |
| 236 | Ga0495629_0001240 | 3300046459 | Bacteria | 20042 |
| 237 | Ga0495629_0075992 | 3300046459 | Bacteria | 2345 |
| 238 | Ga0495629_0738330 | 3300046459 | Unclassified | 652 |
| 239 | Ga0495641_0021394 | 3300046461 | Bacteria | 3255 |
| 240 | Ga0495641_0212811 | 3300046461 | Unclassified | 867 |
| 241 | Ga0495651_0006317 | 3300046462 | Bacteria | 9063 |
| 242 | Ga0495651_0029605 | 3300046462 | Bacteria | 4270 |
| 243 | Ga0495651_0287778 | 3300046462 | Bacteria | 1107 |
| 244 | Ga0495653_0010825 | 3300046463 | Bacteria | 7465 |
| 245 | Ga0495580_0015940 | 3300046472 | Bacteria | 5655 |
| 246 | Ga0495580_0367938 | 3300046472 | Bacteria | 972 |
| 247 | Ga0495580_0519527 | 3300046472 | Unclassified | 793 |
| 248 | Ga0495582_0003108 | 3300046473 | Bacteria | 9307 |
| 249 | Ga0495582_0324694 | 3300046473 | Bacteria | 885 |
| 250 | Ga0495639_0004976 | 3300046475 | Bacteria | 5700 |
| 251 | Ga0495662_0019363 | 3300046476 | Bacteria | 3291 |
| 252 | Ga0495662_0223913 | 3300046476 | Unclassified | 927 |
| 253 | Ga0495664_0028098 | 3300046477 | Bacteria | 3283 |
| 254 | Ga0495594_0010943 | 3300046499 | Bacteria | 4707 |
| 255 | Ga0495594_0144572 | 3300046499 | Bacteria | 1349 |
| 256 | Ga0495608_0001415 | 3300046511 | Bacteria | 17058 |
| 257 | Ga0495608_0176849 | 3300046511 | Bacteria | 1351 |
| 258 | Ga0495618_0017306 | 3300046514 | Bacteria | 4417 |
| 259 | Ga0495618_0038370 | 3300046514 | Bacteria | 3010 |
| 260 | Ga0495618_0306343 | 3300046514 | Bacteria | 986 |
| 261 | Ga0495628_0023939 | 3300046516 | Bacteria | 5005 |
| 262 | Ga0495630_0007589 | 3300046517 | Bacteria | 7754 |
| 263 | Ga0495630_0119338 | 3300046517 | Bacteria | 2000 |
| 264 | Ga0495630_0395837 | 3300046517 | Bacteria | 1058 |
| 265 | Ga0495644_0034753 | 3300046523 | Bacteria | 1903 |
| 266 | Ga0495666_0001193 | 3300046526 | Bacteria | 12527 |
| 267 | Ga0495652_0042527 | 3300046529 | Bacteria | 3917 |
| 268 | Ga0495665_0009870 | 3300046531 | Bacteria | 5168 |
| 269 | Ga0495665_0064381 | 3300046531 | Bacteria | 1935 |
| 270 | Ga0495665_0408723 | 3300046531 | Bacteria | 688 |
| 271 | Ga0495640_0034312 | 3300046533 | Bacteria | 3599 |
| 272 | Ga0495640_0077035 | 3300046533 | Bacteria | 2223 |
| 273 | Ga0495640_0291231 | 3300046533 | Unclassified | 1015 |
| 274 | Ga0495586_0035461 | 3300046535 | Bacteria | 2680 |
| 275 | Ga0495587_0004603 | 3300046536 | Bacteria | 9067 |
| 276 | Ga0495645_0052308 | 3300046543 | Bacteria | 2971 |
| 277 | Ga0495645_0060598 | 3300046543 | Bacteria | 2743 |
| 278 | Ga0495622_0004018 | 3300046557 | Bacteria | 6866 |
| 279 | Ga0495667_0001645 | 3300046559 | Bacteria | 14801 |
| 280 | Ga0495667_0020703 | 3300046559 | Bacteria | 4439 |
| 281 | Ga0495667_0037944 | 3300046559 | Bacteria | 3209 |
| 282 | Ga0495634_0097536 | 3300046642 | Bacteria | 1902 |
| 283 | Ga0495634_0104450 | 3300046642 | Bacteria | 1827 |
| 284 | Ga0495635_0022810 | 3300046663 | Bacteria | 4363 |
| 285 | Ga0495635_0024338 | 3300046663 | Bacteria | 4220 |
| 286 | Ga0495635_0032827 | 3300046663 | Bacteria | 3601 |
| 287 | Ga0495635_0072161 | 3300046663 | Bacteria | 2366 |
| 288 | Ga0495635_0191074 | 3300046663 | Bacteria | 1390 |
| 289 | Ga0495588_0024562 | 3300046674 | Bacteria | 2995 |
| 290 | Ga0495588_0512354 | 3300046674 | Unclassified | 629 |
| 291 | Ga0495657_0142120 | 3300046675 | Bacteria | 1495 |
| 292 | Ga0495599_0013019 | 3300046678 | Bacteria | 5133 |
| 293 | Ga0495623_0000629 | 3300046679 | Bacteria | 23493 |
| 294 | Ga0495646_0004584 | 3300046680 | Bacteria | 8710 |
| 295 | Ga0495646_0012772 | 3300046680 | Bacteria | 5338 |
| 296 | Ga0495647_0000801 | 3300046681 | Bacteria | 9394 |
| 297 | Ga0495647_0005629 | 3300046681 | Bacteria | 4116 |
| 298 | Ga0495658_0000745 | 3300046683 | Bacteria | 17569 |
| 299 | Ga0495658_0002290 | 3300046683 | Bacteria | 9656 |
| 300 | Ga0495658_0215811 | 3300046683 | Bacteria | 1200 |
| 301 | Ga0495613_0042153 | 3300046689 | Bacteria | 3378 |
| 302 | Ga0495613_0152323 | 3300046689 | Bacteria | 1648 |
| 303 | Ga0495624_0038700 | 3300046690 | Bacteria | 3062 |
| 304 | Ga0495600_0004235 | 3300046809 | Bacteria | 8567 |
| 305 | Ga0495600_0067886 | 3300046809 | Bacteria | 2330 |
| 306 | Ga0495600_0082507 | 3300046809 | Bacteria | 2098 |
| 307 | Ga0495581_0050728 | 3300047315 | Bacteria | 2396 |
| 308 | Ga0495581_0153046 | 3300047315 | Bacteria | 1347 |
| 309 | Ga0495581_0206366 | 3300047315 | Bacteria | 1149 |
| 310 | Ga0495604_0008684 | 3300047317 | Bacteria | 8030 |
| 311 | Ga0495604_0026165 | 3300047317 | Bacteria | 4645 |
| 312 | Ga0495636_0605883 | 3300047318 | Bacteria | 536 |
| 313 | Ga0495674_0019562 | 3300047319 | Bacteria | 6282 |
| 314 | Ga0495674_0020681 | 3300047319 | Bacteria | 6094 |
| 315 | Ga0495674_0074689 | 3300047319 | Bacteria | 2918 |
| 316 | Ga0495674_0495180 | 3300047319 | Bacteria | 978 |
| 317 | Ga0495676_0068957 | 3300047321 | Bacteria | 2730 |
| 318 | Ga0495680_0005762 | 3300047322 | Bacteria | 11598 |
| 319 | Ga0495680_0010131 | 3300047322 | Bacteria | 8423 |
| 320 | Ga0495680_0020742 | 3300047322 | Bacteria | 5518 |
| 321 | Ga0495680_0041210 | 3300047322 | Bacteria | 3673 |
| 322 | Ga0495680_0179768 | 3300047322 | Bacteria | 1528 |
| 323 | Ga0495675_0002358 | 3300047444 | Bacteria | 11271 |
| 324 | Ga0495684_0070444 | 3300047471 | Bacteria | 2658 |
| 325 | Ga0495684_0552712 | 3300047471 | Bacteria | 784 |
| 326 | Ga0495593_0005464 | 3300047673 | Bacteria | 7504 |
| 327 | Ga0495593_0055496 | 3300047673 | Bacteria | 2085 |
| 328 | Ga0495593_0163950 | 3300047673 | Bacteria | 1121 |
| 329 | Ga0495602_0028395 | 3300048088 | Bacteria | 5354 |
| 330 | Ga0495614_0018217 | 3300048089 | Bacteria | 3042 |
| 331 | Ga0496100_0057851 | 3300048903 | Bacteria | 2541 |
| 332 | Ga0496101_0066666 | 3300048904 | Bacteria | 2626 |
| 333 | Ga0496101_0201599 | 3300048904 | Bacteria | 1538 |
| 334 | Ga0496102_0058075 | 3300048905 | Bacteria | 3534 |
| 335 | Ga0496102_0069032 | 3300048905 | Bacteria | 3244 |
| 336 | Ga0496102_0129217 | 3300048905 | Bacteria | 2363 |
| 337 | Ga0496102_0195065 | 3300048905 | Bacteria | 1908 |
| 338 | Ga0496103_0039901 | 3300048906 | Bacteria | 2885 |
| 339 | Ga0496103_0054128 | 3300048906 | Bacteria | 2487 |
| 340 | Ga0496104_0011174 | 3300048907 | Bacteria | 8035 |
| 341 | Ga0496104_0083240 | 3300048907 | Bacteria | 3051 |
| 342 | Ga0496105_0013053 | 3300048908 | Bacteria | 6584 |
| 343 | Ga0496105_0072838 | 3300048908 | Bacteria | 2838 |
| 344 | Ga0496106_0059439 | 3300048909 | Bacteria | 2896 |
| 345 | Ga0496106_0138323 | 3300048909 | Bacteria | 1914 |
| 346 | Ga0496107_0005300 | 3300048910 | Bacteria | 8812 |
| 347 | Ga0496107_0109787 | 3300048910 | Bacteria | 2026 |
| 348 | Ga0496107_0183595 | 3300048910 | Bacteria | 1553 |
| 349 | Ga0496108_0087953 | 3300048911 | Bacteria | 2639 |
| 350 | Ga0496109_0051612 | 3300048912 | Bacteria | 3746 |
| 351 | Ga0496109_0105642 | 3300048912 | Bacteria | 2615 |
| 352 | Ga0496110_0268213 | 3300048913 | Bacteria | 1554 |
| 353 | Ga0496111_0029169 | 3300048914 | Bacteria | 3917 |
| 354 | Ga0496111_0384198 | 3300048914 | Bacteria | 1038 |
| 355 | Ga0496112_0102788 | 3300048915 | Bacteria | 2827 |
| 356 | Ga0496112_0422927 | 3300048915 | Bacteria | 1271 |
| 357 | Ga0496113_0064033 | 3300048916 | Bacteria | 2779 |
| 358 | Ga0496114_0029554 | 3300048917 | Bacteria | 4506 |
| 359 | Ga0496115_0062175 | 3300048918 | Bacteria | 3012 |
| 360 | Ga0496115_0170415 | 3300048918 | Bacteria | 1800 |
| 361 | Ga0496115_0408254 | 3300048918 | Bacteria | 1101 |
| 362 | Ga0501031_0005435 | 3300049568 | Bacteria | 8294 |
| 363 | Ga0501031_0052292 | 3300049568 | Bacteria | 2661 |
| 364 | Ga0501031_0094304 | 3300049568 | Bacteria | 1953 |
| 365 | Ga0501031_0101815 | 3300049568 | Bacteria | 1874 |
| 366 | Ga0501031_0217338 | 3300049568 | Bacteria | 1245 |
| 367 | Ga0501032_0017735 | 3300049569 | Bacteria | 4997 |
| 368 | Ga0501032_0031486 | 3300049569 | Bacteria | 3636 |
| 369 | Ga0501032_0049318 | 3300049569 | Bacteria | 2840 |
| 370 | Ga0501032_0175839 | 3300049569 | Bacteria | 1402 |
| 371 | Ga0501033_0028789 | 3300049570 | Bacteria | 4174 |
| 372 | Ga0501033_0040575 | 3300049570 | Bacteria | 3474 |
| 373 | Ga0501033_0052369 | 3300049570 | Bacteria | 3025 |
| 374 | Ga0501033_0193383 | 3300049570 | Bacteria | 1455 |
| 375 | Ga0501034_0000197 | 3300049571 | Bacteria | 114088 |
| 376 | Ga0501034_0001247 | 3300049571 | Bacteria | 34598 |
| 377 | Ga0501034_0019479 | 3300049571 | Bacteria | 6940 |
| 378 | Ga0501034_0025868 | 3300049571 | Bacteria | 5977 |
| 379 | Ga0501034_0030864 | 3300049571 | Bacteria | 5446 |
| 380 | Ga0501034_0078135 | 3300049571 | Bacteria | 3314 |
| 381 | Ga0501034_0167764 | 3300049571 | Bacteria | 2163 |
| 382 | Ga0501034_0223572 | 3300049571 | Bacteria | 1834 |
| 383 | Ga0501034_0252054 | 3300049571 | Bacteria | 1709 |
| 384 | Ga0501036_0017189 | 3300049572 | Bacteria | 6046 |
| 385 | Ga0501036_0037657 | 3300049572 | Bacteria | 4091 |
| 386 | Ga0501036_0039959 | 3300049572 | Bacteria | 3968 |
| 387 | Ga0501036_0078588 | 3300049572 | Bacteria | 2790 |
| 388 | Ga0501036_0103529 | 3300049572 | Bacteria | 2407 |
| 389 | Ga0501036_0547638 | 3300049572 | Unclassified | 961 |
| 390 | Ga0501037_0006086 | 3300049573 | Bacteria | 8818 |
| 391 | Ga0501037_0017837 | 3300049573 | Bacteria | 5225 |
| 392 | Ga0501037_0018838 | 3300049573 | Bacteria | 5086 |
| 393 | Ga0501037_0032508 | 3300049573 | Bacteria | 3852 |
| 394 | Ga0501037_0053118 | 3300049573 | Bacteria | 2963 |
| 395 | Ga0501037_0246408 | 3300049573 | Bacteria | 1251 |
| 396 | Ga0501037_0250078 | 3300049573 | Bacteria | 1241 |
| 397 | Ga0501038_0007936 | 3300049574 | Bacteria | 9780 |
| 398 | Ga0501038_0037665 | 3300049574 | Bacteria | 4239 |
| 399 | Ga0501038_0309106 | 3300049574 | Bacteria | 1239 |
| 400 | Ga0501038_0556636 | 3300049574 | Bacteria | 871 |
| 401 | Ga0501038_0802126 | 3300049574 | Bacteria | 699 |
| 402 | Ga0501039_0034420 | 3300049575 | Bacteria | 3909 |
| 403 | Ga0501039_0074878 | 3300049575 | Bacteria | 2631 |
| 404 | Ga0501039_0182216 | 3300049575 | Bacteria | 1651 |
| 405 | Ga0501040_0028195 | 3300049576 | Bacteria | 3784 |
| 406 | Ga0501042_0397030 | 3300049578 | Bacteria | 999 |
| 407 | Ga0501043_0006548 | 3300049579 | Bacteria | 9342 |
| 408 | Ga0501043_0006622 | 3300049579 | Bacteria | 9268 |
| 409 | Ga0501043_0022318 | 3300049579 | Bacteria | 4966 |
| 410 | Ga0501043_0169887 | 3300049579 | Bacteria | 1701 |
| 411 | Ga0501043_0179812 | 3300049579 | Bacteria | 1648 |
| 412 | Ga0501043_0254304 | 3300049579 | Bacteria | 1352 |
| 413 | Ga0501043_0583779 | 3300049579 | Bacteria | 827 |
| 414 | Ga0501046_0009112 | 3300049580 | Bacteria | 8596 |
| 415 | Ga0501046_0074207 | 3300049580 | Bacteria | 2639 |
| 416 | Ga0501046_0430040 | 3300049580 | Bacteria | 951 |
| 417 | Ga0501047_0000186 | 3300049581 | Bacteria | 75102 |
| 418 | Ga0501047_0011383 | 3300049581 | Bacteria | 8419 |
| 419 | Ga0501047_0014304 | 3300049581 | Bacteria | 7547 |
| 420 | Ga0501047_0016856 | 3300049581 | Bacteria | 6982 |
| 421 | Ga0501047_0055362 | 3300049581 | Bacteria | 3836 |
| 422 | Ga0501047_0155664 | 3300049581 | Bacteria | 2159 |
| 423 | Ga0501047_1104725 | 3300049581 | Unclassified | 606 |
| 424 | Ga0501048_0000856 | 3300049582 | Bacteria | 22438 |
| 425 | Ga0501048_0102084 | 3300049582 | Bacteria | 2023 |
| 426 | Ga0501048_0292425 | 3300049582 | Bacteria | 1159 |
| 427 | Ga0501067_0009025 | 3300049583 | Bacteria | 5524 |
| 428 | Ga0501068_0020312 | 3300049584 | Bacteria | 3867 |
| 429 | Ga0501068_0118586 | 3300049584 | Bacteria | 1649 |
| 430 | Ga0501068_0151686 | 3300049584 | Bacteria | 1457 |
| 431 | Ga0501068_0162116 | 3300049584 | Bacteria | 1409 |
| 432 | Ga0501069_0054962 | 3300049585 | Bacteria | 2217 |
| 433 | Ga0501069_0086970 | 3300049585 | Bacteria | 1765 |
| 434 | Ga0501069_0126380 | 3300049585 | Bacteria | 1462 |
| 435 | Ga0501069_0140073 | 3300049585 | Bacteria | 1387 |
| 436 | Ga0501069_0203186 | 3300049585 | Bacteria | 1149 |
| 437 | Ga0501069_0334289 | 3300049585 | Bacteria | 891 |
| 438 | Ga0501070_0002665 | 3300049586 | Bacteria | 15579 |
| 439 | Ga0501070_0008996 | 3300049586 | Bacteria | 8449 |
| 440 | Ga0501070_0009868 | 3300049586 | Bacteria | 8073 |
| 441 | Ga0501070_0021109 | 3300049586 | Bacteria | 5464 |
| 442 | Ga0501070_0039121 | 3300049586 | Bacteria | 3956 |
| 443 | Ga0501070_0051850 | 3300049586 | Bacteria | 3404 |
| 444 | Ga0501070_0060750 | 3300049586 | Bacteria | 3132 |
| 445 | Ga0501070_0081757 | 3300049586 | Bacteria | 2673 |
| 446 | Ga0501070_0087649 | 3300049586 | Bacteria | 2576 |
| 447 | Ga0501070_0124067 | 3300049586 | Bacteria | 2134 |
| 448 | Ga0501070_0130161 | 3300049586 | Bacteria | 2079 |
| 449 | Ga0501070_0330657 | 3300049586 | Bacteria | 1238 |
| 450 | Ga0501071_0053722 | 3300049587 | Bacteria | 2906 |
| 451 | Ga0501071_0084183 | 3300049587 | Bacteria | 2330 |
| 452 | Ga0501072_0018872 | 3300049588 | Bacteria | 5320 |
| 453 | Ga0501072_0053379 | 3300049588 | Bacteria | 3183 |
| 454 | Ga0501072_0408430 | 3300049588 | Bacteria | 1077 |
| 455 | Ga0501073_0010210 | 3300049589 | Bacteria | 6897 |
| 456 | Ga0501073_0018856 | 3300049589 | Bacteria | 4986 |
| 457 | Ga0501073_0023953 | 3300049589 | Bacteria | 4383 |
| 458 | Ga0501073_0059716 | 3300049589 | Bacteria | 2662 |
| 459 | Ga0501073_0275365 | 3300049589 | Bacteria | 1161 |
| 460 | Ga0501074_0013074 | 3300049590 | Bacteria | 6034 |
| 461 | Ga0501074_0016442 | 3300049590 | Bacteria | 5372 |
| 462 | Ga0501074_0369504 | 3300049590 | Bacteria | 1017 |
| 463 | Ga0501074_0657173 | 3300049590 | Bacteria | 740 |
| 464 | Ga0501076_0094064 | 3300049592 | Bacteria | 2413 |
| 465 | Ga0501077_0034959 | 3300049593 | Bacteria | 3199 |
| 466 | Ga0501079_0003839 | 3300049741 | Bacteria | 11093 |
| 467 | Ga0501079_0046620 | 3300049741 | Bacteria | 3344 |
| 468 | Ga0501079_0114331 | 3300049741 | Bacteria | 2098 |
| 469 | Ga0501079_0135781 | 3300049741 | Bacteria | 1915 |
| 470 | Ga0501080_0000299 | 3300049742 | Bacteria | 37707 |
| 471 | Ga0501080_0005257 | 3300049742 | Bacteria | 11531 |
| 472 | Ga0501080_0215515 | 3300049742 | Bacteria | 1758 |
| 473 | Ga0501080_0463802 | 3300049742 | Bacteria | 1135 |
| 474 | Ga0501080_0994922 | 3300049742 | Bacteria | 727 |
| 475 | Ga0501081_0676359 | 3300049743 | Bacteria | 774 |
| 476 | Ga0501083_0000302 | 3300049744 | Bacteria | 31114 |
| 477 | Ga0501083_0035371 | 3300049744 | Bacteria | 3412 |
| 478 | Ga0501083_0076374 | 3300049744 | Bacteria | 2223 |
| 479 | Ga0501083_0114001 | 3300049744 | Bacteria | 1775 |
| 480 | Ga0501083_0135852 | 3300049744 | Bacteria | 1611 |
| 481 | Ga0501083_0158502 | 3300049744 | Bacteria | 1481 |
| 482 | Ga0501083_0189665 | 3300049744 | Bacteria | 1342 |
| 483 | Ga0501083_0251567 | 3300049744 | Bacteria | 1150 |
| 484 | Ga0501083_0298049 | 3300049744 | Bacteria | 1048 |
| 485 | Ga0501035_0004131 | 3300049822 | Bacteria | 13799 |
| 486 | Ga0501035_0021633 | 3300049822 | Bacteria | 5914 |
| 487 | Ga0501035_0272475 | 3300049822 | Bacteria | 1432 |
| 488 | Ga0501035_0517569 | 3300049822 | Bacteria | 980 |
| 489 | Ga0501044_0061489 | 3300049823 | Bacteria | 3842 |
| 490 | Ga0501044_0098202 | 3300049823 | Bacteria | 2948 |
| 491 | Ga0501044_0113041 | 3300049823 | Bacteria | 2722 |
| 492 | Ga0501044_0118843 | 3300049823 | Bacteria | 2645 |
| 493 | Ga0501044_0154510 | 3300049823 | Bacteria | 2275 |
| 494 | Ga0501044_0204011 | 3300049823 | Bacteria | 1934 |
| 495 | Ga0501044_0206202 | 3300049823 | Bacteria | 1922 |
| 496 | Ga0501044_0403304 | 3300049823 | Bacteria | 1279 |
| 497 | Ga0501044_0635793 | 3300049823 | Bacteria | 957 |
| 498 | nmdc:mga07m45_168883_c1 | 3300050496 | Bacteria | 1271 |
| 499 | nmdc:mga05p37_56283_c1 | 3300050507 | Bacteria | 4842 |
| 500 | nmdc:mga06r32_58819_c1 | 3300050510 | Bacteria | 3695 |
| 501 | nmdc:mga08y16_540223_c1 | 3300050511 | Bacteria | 1181 |
| 502 | nmdc:mga08y16_68893_c1 | 3300050511 | Bacteria | 3689 |
| 503 | nmdc:mga0n895_253279_c1 | 3300050512 | Bacteria | 1787 |
| 504 | nmdc:mga0n895_351949_c1 | 3300050512 | Bacteria | 1492 |
| 505 | nmdc:mga0n895_357234_c1 | 3300050512 | Bacteria | 1480 |
| 506 | nmdc:mga0n895_530184_c1 | 3300050512 | Bacteria | 1185 |
| 507 | nmdc:mga0rr50_265676_c1 | 3300050513 | Bacteria | 1429 |
| 508 | nmdc:mga0rr50_30813_c1 | 3300050513 | Bacteria | 3803 |
| 509 | nmdc:mga0rr50_51956_c1 | 3300050513 | Bacteria | 3043 |
| 510 | nmdc:mga08x19_237006_c1 | 3300050514 | Bacteria | 1257 |
| 511 | nmdc:mga08x19_331995_c1 | 3300050514 | Bacteria | 1059 |
| 512 | nmdc:mga08x19_62852_c1 | 3300050514 | Bacteria | 2408 |
| 513 | nmdc:mga0a205_1362560_c1 | 3300050515 | Unclassified | 557 |
| 514 | nmdc:mga0a205_422148_c1 | 3300050515 | Bacteria | 1195 |
| 515 | nmdc:mga0a205_52693_c1 | 3300050515 | Bacteria | 3927 |
| 516 | Ga0495601_0000352 | 3300053077 | Bacteria | 24145 |
| 517 | Ga0495601_0008676 | 3300053077 | Bacteria | 5997 |
| 518 | Ga0495601_0010571 | 3300053077 | Bacteria | 5496 |
| 519 | Ga0495601_0049828 | 3300053077 | Bacteria | 2641 |
| 520 | Ga0495601_0335629 | 3300053077 | Bacteria | 984 |
| 521 | Ga0495601_0754276 | 3300053077 | Unclassified | 619 |
| 522 | Ga0495612_0003841 | 3300053078 | Bacteria | 6236 |
| 523 | Ga0495612_0004226 | 3300053078 | Bacteria | 5958 |
| 524 | Ga0495612_0013588 | 3300053078 | Bacteria | 3279 |
| 525 | Ga0495612_0026130 | 3300053078 | Bacteria | 2347 |
| 526 | Ga0495612_0053461 | 3300053078 | Bacteria | 1663 |
| 527 | Ga0495595_0000405 | 3300053084 | Bacteria | 16418 |
| 528 | Ga0495595_0001531 | 3300053084 | Bacteria | 9014 |
| 529 | Ga0495595_0010289 | 3300053084 | Bacteria | 3885 |
| 530 | Ga0495619_0000085 | 3300053085 | Bacteria | 70073 |
| 531 | Ga0495619_0000536 | 3300053085 | Bacteria | 25079 |
| 532 | Ga0495619_0008387 | 3300053085 | Bacteria | 6533 |
| 533 | Ga0495619_0011351 | 3300053085 | Bacteria | 5609 |
| 534 | Ga0495619_0023812 | 3300053085 | Bacteria | 3924 |
| 535 | Ga0500643_012236 | 3300053087 | Bacteria | 3081 |
| 536 | Ga0500644_0000795 | 3300053088 | Bacteria | 10744 |
| 537 | Ga0500651_0017592 | 3300053093 | Bacteria | 4413 |
| 538 | Ga0500651_0158036 | 3300053093 | Bacteria | 1357 |
| 539 | Ga0500566_0189429 | 3300053094 | Bacteria | 1048 |
| 540 | Ga0500572_225925 | 3300053111 | Unclassified | 612 |
| 541 | Ga0500595_000024 | 3300053119 | Bacteria | 144160 |
| 542 | Ga0500618_087126 | 3300053125 | Unclassified | 701 |
| 543 | Ga0500652_005339 | 3300053131 | Bacteria | 4039 |
| 544 | Ga0500568_0181928 | 3300053139 | Bacteria | 772 |
| 545 | Ga0500616_0000458 | 3300053153 | Bacteria | 53402 |
| 546 | Ga0500657_115272 | 3300053728 | Bacteria | 1077 |
| 547 | Ga0500645_000102 | 3300053730 | Bacteria | 67660 |
| 548 | Ga0501084_0103814 | 3300054114 | Bacteria | 2387 |
| 549 | Ga0501084_0450776 | 3300054114 | Bacteria | 1088 |
| 550 | Ga0501084_0651934 | 3300054114 | Bacteria | 889 |
| 551 | Ga0501082_0035245 | 3300060353 | Bacteria | 4313 |
| 552 | Ga0501082_0134633 | 3300060353 | Bacteria | 2144 |
| 553 | Ga0501082_0281198 | 3300060353 | Bacteria | 1448 |
| 554 | Ga0501082_0337391 | 3300060353 | Bacteria | 1313 |
| 555 | Ga0501082_0792317 | 3300060353 | Bacteria | 829 |
| 556 | Ga0530510_0693696 | 3300061734 | Bacteria | 776 |
| 557 | 2643755224 | 2643221547 | Bacteria | 4740017 |
| 558 | Ga0501032_0796536 | |||
| 559 | JGI25165J46597_1027022 | |||
| 560 | Ga0070658_10744498 | |||
| 561 | Ga0070666_10389827 | |||
| 562 | Ga0070680_100080171 | |||
| 563 | Ga0070680_100273597 | |||
| 564 | Ga0070661_100025924 | |||
| 565 | Ga0070675_100490587 | |||
| 566 | Ga0070671_100093988 | |||
| 567 | Ga0070674_100023567 | |||
| 568 | Ga0070673_100055154 | |||
| 569 | Ga0070659_100149379 | |||
| 570 | Ga0070667_100056374 | |||
| 571 | Ga0070709_10186142 | |||
| 572 | Ga0070714_100018468 | |||
| 573 | Ga0070713_100359474 | |||
| 574 | Ga0070710_10053105 | |||
| 575 | Ga0070711_100006095 | |||
| 576 | Ga0070711_100056739 | |||
| 577 | Ga0070711_100115912 | |||
| 578 | Ga0070711_100143246 | |||
| 579 | Ga0070705_100083905 | |||
| 580 | Ga0070694_100313833 | |||
| 581 | Ga0070663_100060818 | |||
| 582 | Ga0070663_100769096 | |||
| 583 | Ga0070678_100020530 | |||
| 584 | Ga0070678_100065070 | |||
| 585 | Ga0070681_10072090 | |||
| 586 | Ga0070681_10746707 | |||
| 587 | Ga0070681_10750695 | |||
| 588 | Ga0070685_10359643 | |||
| 589 | Ga0070679_100028116 | |||
| 590 | Ga0070679_100095983 | |||
| 591 | Ga0070684_100775423 | |||
| 592 | Ga0068853_100580542 | |||
| 593 | Ga0070695_100222047 | |||
| 594 | Ga0070696_100135573 | |||
| 595 | Ga0070693_100143658 | |||
| 596 | Ga0070665_100807073 | |||
| 597 | Ga0070704_100580587 | |||
| 598 | Ga0068855_100284816 | |||
| 599 | Ga0068856_100244772 | |||
| 600 | Ga0068856_101449378 | |||
| 601 | Ga0068864_100205596 | |||
| 602 | Ga0068866_10808707 | |||
| 603 | Ga0081455_10011386 | |||
| 604 | Ga0081455_10379928 | |||
| 605 | Ga0070717_10855056 | |||
| 606 | Ga0075364_10243097 | |||
| 607 | Ga0075432_10027682 | |||
| 608 | Ga0070712_101002826 | |||
| 609 | Ga0075367_10629146 | |||
| 610 | Ga0075427_10002688 | |||
| 611 | Ga0097621_100033091 | |||
| 612 | Ga0075370_10150693 | |||
| 613 | Ga0068871_100163007 | |||
| 614 | Ga0075428_100387900 | |||
| 615 | Ga0075430_100205099 | |||
| 616 | Ga0075433_10024260 | |||
| 617 | Ga0075433_10305073 | |||
| 618 | Ga0075434_100117871 | |||
| 619 | Ga0075434_100264412 | |||
| 620 | Ga0075434_100494638 | |||
| 621 | Ga0075429_100268413 | |||
| 622 | Ga0075435_100287796 | |||
| 623 | Ga0075435_100399027 | |||
| 624 | Ga0105250_10070270 | |||
| 625 | Ga0105240_10398598 | |||
| 626 | Ga0105240_10501462 | |||
| 627 | Ga0105240_11220412 | |||
| 628 | Ga0111539_10445139 | |||
| 629 | Ga0105245_10094403 | |||
| 630 | Ga0105245_10216433 | |||
| 631 | Ga0105247_10239316 | |||
| 632 | Ga0105247_10303420 | |||
| 633 | Ga0114129_10550688 | |||
| 634 | Ga0114129_11129938 | |||
| 635 | Ga0105241_10389840 | |||
| 636 | Ga0105241_10582389 | |||
| 637 | Ga0105242_10138984 | |||
| 638 | Ga0105248_10020734 | |||
| 639 | Ga0105237_10344850 | |||
| 640 | Ga0105237_10357353 | |||
| 641 | Ga0105238_10275243 | |||
| 642 | Ga0105249_10137200 | |||
| 643 | Ga0105249_10977786 | |||
| 644 | Ga0105239_10075495 | |||
| 645 | Ga0105239_12306382 | |||
| 646 | Ga0105246_10029143 | |||
| 647 | Ga0105246_10054987 | |||
| 648 | Ga0157320_1001827 | |||
| 649 | Ga0157370_10157941 | |||
| 650 | Ga0157369_10230640 | |||
| 651 | Ga0157374_10197690 | |||
| 652 | Ga0157374_10453939 | |||
| 653 | Ga0157378_10062983 | |||
| 654 | Ga0157378_10200944 | |||
| 655 | Ga0163162_10197819 | |||
| 656 | Ga0163162_10250363 | |||
| 657 | Ga0157372_10276386 | |||
| 658 | Ga0157372_11558496 | |||
| 659 | Ga0157375_10096786 | |||
| 660 | Ga0157375_10434160 | |||
| 661 | Ga0157375_11843294 | |||
| 662 | Ga0163163_10212474 | |||
| 663 | Ga0157379_10060733 | |||
| 664 | Ga0157379_10274728 | |||
| 665 | Ga0157376_10051396 | |||
| 666 | Ga0157376_10316154 | |||
| 667 | Ga0163161_10517249 | |||
| 668 | Ga0206356_11792220 | |||
| 669 | Ga0213873_10123836 | |||
| 670 | Ga0213876_10089048 | |||
| 671 | Ga0209233_1006346 | |||
| 672 | Ga0207692_10235457 | |||
| 673 | Ga0207710_10168418 | |||
| 674 | Ga0207685_10029768 | |||
| 675 | Ga0207707_10215606 | |||
| 676 | Ga0207707_10766812 | |||
| 677 | Ga0207695_10351540 | |||
| 678 | Ga0207671_10113007 | |||
| 679 | Ga0207693_10008546 | |||
| 680 | Ga0207693_10302440 | |||
| 681 | Ga0207663_10053001 | |||
| 682 | Ga0207663_10161182 | |||
| 683 | Ga0207663_10170232 | |||
| 684 | Ga0207660_10205885 | |||
| 685 | Ga0207657_10035581 | |||
| 686 | Ga0207652_10018220 | |||
| 687 | Ga0207694_10155401 | |||
| 688 | Ga0207694_10184587 | |||
| 689 | Ga0207659_10175202 | |||
| 690 | Ga0207659_10643771 | |||
| 691 | Ga0207687_10060600 | |||
| 692 | Ga0207664_10025181 | |||
| 693 | Ga0207664_10039614 | |||
| 694 | Ga0207644_10007589 | |||
| 695 | Ga0207706_10009732 | |||
| 696 | Ga0207686_10102853 | |||
| 697 | Ga0207669_10084551 | |||
| 698 | Ga0207711_10214164 | |||
| 699 | Ga0207689_10721643 | |||
| 700 | Ga0207667_10149652 | |||
| 701 | Ga0207667_10602655 | |||
| 702 | Ga0207651_10067000 | |||
| 703 | Ga0207712_10031556 | |||
| 704 | Ga0207640_10133241 | |||
| 705 | Ga0207658_10160460 | |||
| 706 | Ga0207678_10021192 | |||
| 707 | Ga0207678_10021441 | |||
| 708 | Ga0207678_10262635 | |||
| 709 | Ga0207676_10126913 | |||
| 710 | Ga0207674_10279119 | |||
| 711 | Ga0207683_10050440 | |||
| 712 | Ga0207683_10338002 | |||
| 713 | Ga0268266_10478079 | |||
| 714 | Ga0268266_10869257 | |||
| 715 | Ga0265337_1001493 | |||
| 716 | Ga0265338_10017281 | |||
| 717 | Ga0265330_10069879 | |||
| 718 | Ga0265325_10022838 | |||
| 719 | Ga0265325_10043030 | |||
| 720 | Ga0265340_10020486 | |||
| 721 | Ga0265331_10174776 | |||
| 722 | Ga0265316_10078554 | |||
| 723 | Ga0265316_10181305 | |||
| 724 | Ga0265316_10627074 | |||
| 725 | Ga0265313_10000513 | |||
| 726 | Ga0265313_10001570 | |||
| 727 | Ga0265313_10008665 | |||
| 728 | Ga0265313_10012327 | |||
| 729 | Ga0316579_10022141 | |||
| 730 | Ga0265314_10000771 | |||
| 731 | Ga0265314_10007590 | |||
| 732 | Ga0307405_10987218 | |||
| 733 | Ga0307413_10126431 | |||
| 734 | Ga0307413_10200169 | |||
| 735 | Ga0307407_10245837 | |||
| 736 | Ga0307407_10514003 | |||
| 737 | Ga0307409_100068917 | |||
| 738 | Ga0373930_0011268 | |||
| 739 | Ga0373950_0008438 | |||
| 740 | Ga0373958_0002453 | |||
| 741 | Ga0373938_0000453 | |||
| 742 | Ga0373926_0013097 | |||
| 743 | Ga0373934_0033608 | |||
| 744 | Ga0373944_0032533 | |||
| 745 | Ga0373951_0015860 | |||
| 746 | Ga0373952_0138559 | |||
| 747 | Ga0373923_0000792 | |||
| 748 | Ga0373936_0001246 | |||
| 749 | Ga0373936_0125776 | |||
| 750 | Ga0373945_0020052 | |||
| 751 | Ga0373953_0017642 | |||
| 752 | Ga0373954_0009128 | |||
| 753 | Ga0373954_0016323 | |||
| 754 | Ga0373954_0025519 | |||
| 755 | Ga0373956_0009309 | |||
| 756 | Ga0373956_0075068 | |||
| 757 | Ga0373957_0164136 | |||
| 758 | Ga0373960_0012957 | |||
| 759 | Ga0373943_0007158 | |||
| 760 | Ga0373946_0001845 | |||
| 761 | Ga0373955_0008402 | |||
| 762 | Ga0373955_0016631 | |||
| 763 | Ga0373942_0048570 | |||
| 764 | Ga0373962_0002352 | |||
| 765 | Ga0373924_0004724 | |||
| 766 | Ga0373924_0023311 | |||
| 767 | Ga0373924_0123129 | |||
| 768 | Ga0373924_0156503 | |||
| 769 | Ga0373931_0010698 | |||
| 770 | Ga0373931_0321215 | |||
| 771 | Ga0373935_0003876 | |||
| 772 | Ga0373935_0005968 | |||
| 773 | Ga0373935_0181526 | |||
| 774 | Ga0373935_0271627 | |||
| 775 | Ga0373927_0004839 | |||
| 776 | Ga0373933_0004411 | |||
| 777 | Ga0373947_0126534 | |||
| 778 | Ga0373947_0188464 | |||
| 779 | Ga0373937_0002145 | |||
| 780 | Ga0373937_0006979 | |||
| 781 | Ga0373937_0030415 | |||
| 782 | Ga0373937_0080020 | |||
| 783 | Ga0373937_0144865 | |||
| 784 | Ga0316582_0117604 | |||
| 785 | Ga0373925_0008524 | |||
| 786 | Ga0373925_0023646 | |||
| 787 | Ga0436365_1873778 | |||
| 788 | Ga0436365_1904201 | |||
| 789 | Ga0436362_0723276 | |||
| 790 | Ga0495592_0006856 | |||
| 791 | Ga0495592_0041995 | |||
| 792 | Ga0495603_0062839 | |||
| 793 | Ga0495629_0001240 | |||
| 794 | Ga0495629_0075992 | |||
| 795 | Ga0495629_0738330 | |||
| 796 | Ga0495641_0021394 | |||
| 797 | Ga0495641_0212811 | |||
| 798 | Ga0495651_0006317 | |||
| 799 | Ga0495651_0029605 | |||
| 800 | Ga0495651_0287778 | |||
| 801 | Ga0495653_0010825 | |||
| 802 | Ga0495580_0015940 | |||
| 803 | Ga0495580_0367938 | |||
| 804 | Ga0495580_0519527 | |||
| 805 | Ga0495582_0003108 | |||
| 806 | Ga0495582_0324694 | |||
| 807 | Ga0495639_0004976 | |||
| 808 | Ga0495662_0019363 | |||
| 809 | Ga0495662_0223913 | |||
| 810 | Ga0495664_0028098 | |||
| 811 | Ga0495594_0010943 | |||
| 812 | Ga0495594_0144572 | |||
| 813 | Ga0495608_0001415 | |||
| 814 | Ga0495608_0176849 | |||
| 815 | Ga0495618_0017306 | |||
| 816 | Ga0495618_0038370 | |||
| 817 | Ga0495618_0306343 | |||
| 818 | Ga0495628_0023939 | |||
| 819 | Ga0495630_0007589 | |||
| 820 | Ga0495630_0119338 | |||
| 821 | Ga0495630_0395837 | |||
| 822 | Ga0495644_0034753 | |||
| 823 | Ga0495666_0001193 | |||
| 824 | Ga0495652_0042527 | |||
| 825 | Ga0495665_0009870 | |||
| 826 | Ga0495665_0064381 | |||
| 827 | Ga0495665_0408723 | |||
| 828 | Ga0495640_0034312 | |||
| 829 | Ga0495640_0077035 | |||
| 830 | Ga0495640_0291231 | |||
| 831 | Ga0495586_0035461 | |||
| 832 | Ga0495587_0004603 | |||
| 833 | Ga0495645_0052308 | |||
| 834 | Ga0495645_0060598 | |||
| 835 | Ga0495622_0004018 | |||
| 836 | Ga0495667_0001645 | |||
| 837 | Ga0495667_0020703 | |||
| 838 | Ga0495667_0037944 | |||
| 839 | Ga0495634_0097536 | |||
| 840 | Ga0495634_0104450 | |||
| 841 | Ga0495635_0022810 | |||
| 842 | Ga0495635_0024338 | |||
| 843 | Ga0495635_0032827 | |||
| 844 | Ga0495635_0072161 | |||
| 845 | Ga0495635_0191074 | |||
| 846 | Ga0495588_0024562 | |||
| 847 | Ga0495588_0512354 | |||
| 848 | Ga0495657_0142120 | |||
| 849 | Ga0495599_0013019 | |||
| 850 | Ga0495623_0000629 | |||
| 851 | Ga0495646_0004584 | |||
| 852 | Ga0495646_0012772 | |||
| 853 | Ga0495647_0000801 | |||
| 854 | Ga0495647_0005629 | |||
| 855 | Ga0495658_0000745 | |||
| 856 | Ga0495658_0002290 | |||
| 857 | Ga0495658_0215811 | |||
| 858 | Ga0495613_0042153 | |||
| 859 | Ga0495613_0152323 | |||
| 860 | Ga0495624_0038700 | |||
| 861 | Ga0495600_0004235 | |||
| 862 | Ga0495600_0067886 | |||
| 863 | Ga0495600_0082507 | |||
| 864 | Ga0495581_0050728 | |||
| 865 | Ga0495581_0153046 | |||
| 866 | Ga0495581_0206366 | |||
| 867 | Ga0495604_0008684 | |||
| 868 | Ga0495604_0026165 | |||
| 869 | Ga0495636_0605883 | |||
| 870 | Ga0495674_0019562 | |||
| 871 | Ga0495674_0020681 | |||
| 872 | Ga0495674_0074689 | |||
| 873 | Ga0495674_0495180 | |||
| 874 | Ga0495676_0068957 | |||
| 875 | Ga0495680_0005762 | |||
| 876 | Ga0495680_0010131 | |||
| 877 | Ga0495680_0020742 | |||
| 878 | Ga0495680_0041210 | |||
| 879 | Ga0495680_0179768 | |||
| 880 | Ga0495675_0002358 | |||
| 881 | Ga0495684_0070444 | |||
| 882 | Ga0495684_0552712 | |||
| 883 | Ga0495593_0005464 | |||
| 884 | Ga0495593_0055496 | |||
| 885 | Ga0495593_0163950 | |||
| 886 | Ga0495602_0028395 | |||
| 887 | Ga0495614_0018217 | |||
| 888 | Ga0496100_0057851 | |||
| 889 | Ga0496101_0066666 | |||
| 890 | Ga0496101_0201599 | |||
| 891 | Ga0496102_0058075 | |||
| 892 | Ga0496102_0069032 | |||
| 893 | Ga0496102_0129217 | |||
| 894 | Ga0496102_0195065 | |||
| 895 | Ga0496103_0039901 | |||
| 896 | Ga0496103_0054128 | |||
| 897 | Ga0496104_0011174 | |||
| 898 | Ga0496104_0083240 | |||
| 899 | Ga0496105_0013053 | |||
| 900 | Ga0496105_0072838 | |||
| 901 | Ga0496106_0059439 | |||
| 902 | Ga0496106_0138323 | |||
| 903 | Ga0496107_0005300 | |||
| 904 | Ga0496107_0109787 | |||
| 905 | Ga0496107_0183595 | |||
| 906 | Ga0496108_0087953 | |||
| 907 | Ga0496109_0051612 | |||
| 908 | Ga0496109_0105642 | |||
| 909 | Ga0496110_0268213 | |||
| 910 | Ga0496111_0029169 | |||
| 911 | Ga0496111_0384198 | |||
| 912 | Ga0496112_0102788 | |||
| 913 | Ga0496112_0422927 | |||
| 914 | Ga0496113_0064033 | |||
| 915 | Ga0496114_0029554 | |||
| 916 | Ga0496115_0062175 | |||
| 917 | Ga0496115_0170415 | |||
| 918 | Ga0496115_0408254 | |||
| 919 | Ga0501031_0005435 | |||
| 920 | Ga0501031_0052292 | |||
| 921 | Ga0501031_0094304 | |||
| 922 | Ga0501031_0101815 | |||
| 923 | Ga0501031_0217338 | |||
| 924 | Ga0501032_0017735 | |||
| 925 | Ga0501032_0031486 | |||
| 926 | Ga0501032_0049318 | |||
| 927 | Ga0501032_0175839 | |||
| 928 | Ga0501033_0028789 | |||
| 929 | Ga0501033_0040575 | |||
| 930 | Ga0501033_0052369 | |||
| 931 | Ga0501033_0193383 | |||
| 932 | Ga0501034_0000197 | |||
| 933 | Ga0501034_0001247 | |||
| 934 | Ga0501034_0019479 | |||
| 935 | Ga0501034_0025868 | |||
| 936 | Ga0501034_0030864 | |||
| 937 | Ga0501034_0078135 | |||
| 938 | Ga0501034_0167764 | |||
| 939 | Ga0501034_0223572 | |||
| 940 | Ga0501034_0252054 | |||
| 941 | Ga0501036_0017189 | |||
| 942 | Ga0501036_0037657 | |||
| 943 | Ga0501036_0039959 | |||
| 944 | Ga0501036_0078588 | |||
| 945 | Ga0501036_0103529 | |||
| 946 | Ga0501036_0547638 | |||
| 947 | Ga0501037_0006086 | |||
| 948 | Ga0501037_0017837 | |||
| 949 | Ga0501037_0018838 | |||
| 950 | Ga0501037_0032508 | |||
| 951 | Ga0501037_0053118 | |||
| 952 | Ga0501037_0246408 | |||
| 953 | Ga0501037_0250078 | |||
| 954 | Ga0501038_0007936 | |||
| 955 | Ga0501038_0037665 | |||
| 956 | Ga0501038_0309106 | |||
| 957 | Ga0501038_0556636 | |||
| 958 | Ga0501038_0802126 | |||
| 959 | Ga0501039_0034420 | |||
| 960 | Ga0501039_0074878 | |||
| 961 | Ga0501039_0182216 | |||
| 962 | Ga0501040_0028195 | |||
| 963 | Ga0501042_0397030 | |||
| 964 | Ga0501043_0006548 | |||
| 965 | Ga0501043_0006622 | |||
| 966 | Ga0501043_0022318 | |||
| 967 | Ga0501043_0169887 | |||
| 968 | Ga0501043_0179812 | |||
| 969 | Ga0501043_0254304 | |||
| 970 | Ga0501043_0583779 | |||
| 971 | Ga0501046_0009112 | |||
| 972 | Ga0501046_0074207 | |||
| 973 | Ga0501046_0430040 | |||
| 974 | Ga0501047_0000186 | |||
| 975 | Ga0501047_0011383 | |||
| 976 | Ga0501047_0014304 | |||
| 977 | Ga0501047_0016856 | |||
| 978 | Ga0501047_0055362 | |||
| 979 | Ga0501047_0155664 | |||
| 980 | Ga0501047_1104725 | |||
| 981 | Ga0501048_0000856 | |||
| 982 | Ga0501048_0102084 | |||
| 983 | Ga0501048_0292425 | |||
| 984 | Ga0501067_0009025 | |||
| 985 | Ga0501068_0020312 | |||
| 986 | Ga0501068_0118586 | |||
| 987 | Ga0501068_0151686 | |||
| 988 | Ga0501068_0162116 | |||
| 989 | Ga0501069_0054962 | |||
| 990 | Ga0501069_0086970 | |||
| 991 | Ga0501069_0126380 | |||
| 992 | Ga0501069_0140073 | |||
| 993 | Ga0501069_0203186 | |||
| 994 | Ga0501069_0334289 | |||
| 995 | Ga0501070_0002665 | |||
| 996 | Ga0501070_0008996 | |||
| 997 | Ga0501070_0009868 | |||
| 998 | Ga0501070_0021109 | |||
| 999 | Ga0501070_0039121 | |||
| 1000 | Ga0501070_0051850 | |||
| 1001 | Ga0501070_0060750 | |||
| 1002 | Ga0501070_0081757 | |||
| 1003 | Ga0501070_0087649 | |||
| 1004 | Ga0501070_0124067 | |||
| 1005 | Ga0501070_0130161 | |||
| 1006 | Ga0501070_0330657 | |||
| 1007 | Ga0501071_0053722 | |||
| 1008 | Ga0501071_0084183 | |||
| 1009 | Ga0501072_0018872 | |||
| 1010 | Ga0501072_0053379 | |||
| 1011 | Ga0501072_0408430 | |||
| 1012 | Ga0501073_0010210 | |||
| 1013 | Ga0501073_0018856 | |||
| 1014 | Ga0501073_0023953 | |||
| 1015 | Ga0501073_0059716 | |||
| 1016 | Ga0501073_0275365 | |||
| 1017 | Ga0501074_0013074 | |||
| 1018 | Ga0501074_0016442 | |||
| 1019 | Ga0501074_0369504 | |||
| 1020 | Ga0501074_0657173 | |||
| 1021 | Ga0501076_0094064 | |||
| 1022 | Ga0501077_0034959 | |||
| 1023 | Ga0501079_0003839 | |||
| 1024 | Ga0501079_0046620 | |||
| 1025 | Ga0501079_0114331 | |||
| 1026 | Ga0501079_0135781 | |||
| 1027 | Ga0501080_0000299 | |||
| 1028 | Ga0501080_0005257 | |||
| 1029 | Ga0501080_0215515 | |||
| 1030 | Ga0501080_0463802 | |||
| 1031 | Ga0501080_0994922 | |||
| 1032 | Ga0501081_0676359 | |||
| 1033 | Ga0501083_0000302 | |||
| 1034 | Ga0501083_0035371 | |||
| 1035 | Ga0501083_0076374 | |||
| 1036 | Ga0501083_0114001 | |||
| 1037 | Ga0501083_0135852 | |||
| 1038 | Ga0501083_0158502 | |||
| 1039 | Ga0501083_0189665 | |||
| 1040 | Ga0501083_0251567 | |||
| 1041 | Ga0501083_0298049 | |||
| 1042 | Ga0501035_0004131 | |||
| 1043 | Ga0501035_0021633 | |||
| 1044 | Ga0501035_0272475 | |||
| 1045 | Ga0501035_0517569 | |||
| 1046 | Ga0501044_0061489 | |||
| 1047 | Ga0501044_0098202 | |||
| 1048 | Ga0501044_0113041 | |||
| 1049 | Ga0501044_0118843 | |||
| 1050 | Ga0501044_0154510 | |||
| 1051 | Ga0501044_0204011 | |||
| 1052 | Ga0501044_0206202 | |||
| 1053 | Ga0501044_0403304 | |||
| 1054 | Ga0501044_0635793 | |||
| 1055 | nmdc:mga07m45_168883_c1 | |||
| 1056 | nmdc:mga05p37_56283_c1 | |||
| 1057 | nmdc:mga06r32_58819_c1 | |||
| 1058 | nmdc:mga08y16_540223_c1 | |||
| 1059 | nmdc:mga08y16_68893_c1 | |||
| 1060 | nmdc:mga0n895_253279_c1 | |||
| 1061 | nmdc:mga0n895_351949_c1 | |||
| 1062 | nmdc:mga0n895_357234_c1 | |||
| 1063 | nmdc:mga0n895_530184_c1 | |||
| 1064 | nmdc:mga0rr50_265676_c1 | |||
| 1065 | nmdc:mga0rr50_30813_c1 | |||
| 1066 | nmdc:mga0rr50_51956_c1 | |||
| 1067 | nmdc:mga08x19_237006_c1 | |||
| 1068 | nmdc:mga08x19_331995_c1 | |||
| 1069 | nmdc:mga08x19_62852_c1 | |||
| 1070 | nmdc:mga0a205_1362560_c1 | |||
| 1071 | nmdc:mga0a205_422148_c1 | |||
| 1072 | nmdc:mga0a205_52693_c1 | |||
| 1073 | Ga0495601_0000352 | |||
| 1074 | Ga0495601_0008676 | |||
| 1075 | Ga0495601_0010571 | |||
| 1076 | Ga0495601_0049828 | |||
| 1077 | Ga0495601_0335629 | |||
| 1078 | Ga0495601_0754276 | |||
| 1079 | Ga0495612_0003841 | |||
| 1080 | Ga0495612_0004226 | |||
| 1081 | Ga0495612_0013588 | |||
| 1082 | Ga0495612_0026130 | |||
| 1083 | Ga0495612_0053461 | |||
| 1084 | Ga0495595_0000405 | |||
| 1085 | Ga0495595_0001531 | |||
| 1086 | Ga0495595_0010289 | |||
| 1087 | Ga0495619_0000085 | |||
| 1088 | Ga0495619_0000536 | |||
| 1089 | Ga0495619_0008387 | |||
| 1090 | Ga0495619_0011351 | |||
| 1091 | Ga0495619_0023812 | |||
| 1092 | Ga0500643_012236 | |||
| 1093 | Ga0500644_0000795 | |||
| 1094 | Ga0500651_0017592 | |||
| 1095 | Ga0500651_0158036 | |||
| 1096 | Ga0500566_0189429 | |||
| 1097 | Ga0500572_225925 | |||
| 1098 | Ga0500595_000024 | |||
| 1099 | Ga0500618_087126 | |||
| 1100 | Ga0500652_005339 | |||
| 1101 | Ga0500568_0181928 | |||
| 1102 | Ga0500616_0000458 | |||
| 1103 | Ga0500657_115272 | |||
| 1104 | Ga0500645_000102 | |||
| 1105 | Ga0501084_0103814 | |||
| 1106 | Ga0501084_0450776 | |||
| 1107 | Ga0501084_0651934 | |||
| 1108 | Ga0501082_0035245 | |||
| 1109 | Ga0501082_0134633 | |||
| 1110 | Ga0501082_0281198 | |||
| 1111 | Ga0501082_0337391 | |||
| 1112 | Ga0501082_0792317 | |||
| 1113 | Ga0530510_0693696 | |||
| 1114 | 2643755224 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6xg4-assembly1.cif.gz_A | x-ray structure of escherichia coli dihydrofolate reductase l28r mutant in complex with trimethoprim | 0.9759 | 8 | 172 |
| 7mym-assembly1.cif.gz_A | crystal structure of escherichia coli dihydrofolate reductase in complex with trimethoprim and nadph | 0.9698 | 8 | 171 |
| 3ql0-assembly1.cif.gz_A | crystal structure of n23pp/s148a mutant of e. coli dihydrofolate reductase | 0.9656 | 8 | 172 |
| 4qi9-assembly2.cif.gz_B | crystal structure of dihydrofolate reductase from yersinia pestis complexed with methotrexate | 0.9656 | 6 | 172 |
| 3ia4-assembly3.cif.gz_C | moritella profunda dihydrofolate reductase (dhfr) in complex with nadph and methotrexate (mtx) | 0.9647 | 6 | 172 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 4or7A00 | Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A | 0.973 | 8 | 172 | 3.40.430.10 |
| 3fl9F00 | Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A | 0.9492 | 6 | 172 | 3.40.430.10 |
| 3tqaA00 | Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A | 0.9433 | 6 | 171 | 3.40.430.10 |
| 3tqaA00 | Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A | 0.9375 | 6 | 171 | 3.40.430.10 |
| 4fghA00 | Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A | 0.9345 | 6 | 172 | 3.40.430.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7S8C7J3-F1-model_v4 | Dihydrofolate reductase (EC 1.5.1.3) | 0.9908 | 6 | 172 |
GO:0004146
GO:0005829 GO:0006730 GO:0046452 GO:0046654 GO:0046655 GO:0050661 |
| AF-A0A2P7BHF9-F1-model_v4 | Dihydrofolate reductase (EC 1.5.1.3) | 0.9886 | 8 | 172 |
GO:0004146
GO:0005829 GO:0006730 GO:0016301 GO:0046452 GO:0046654 GO:0046655 GO:0050661 |
| AF-A0A537VHJ7-F1-model_v4 | Dihydrofolate reductase (EC 1.5.1.3) | 0.9864 | 6 | 172 |
GO:0004146
GO:0005829 GO:0006730 GO:0046452 GO:0046654 GO:0046655 GO:0050661 |
| AF-A0A839AFR1-F1-model_v4 | dihydrofolate reductase (EC 1.5.1.3) | 0.9829 | 2 | 172 |
GO:0004146
GO:0005829 GO:0046452 GO:0046654 GO:0046655 GO:0050661 |
| AF-A0A1E3W4D6-F1-model_v4 | Dihydrofolate reductase (EC 1.5.1.3) | 0.9812 | 14 | 172 |
GO:0004146
GO:0005829 GO:0006730 GO:0046452 GO:0046654 GO:0046655 GO:0050661 |