F463359

General Info

Members Datasets Scaffolds Average Seq Length
557 281 1114 171

Family's Representative Sequence

Representative Sequence 3300049569|Ga0501032_0796536|Ga0501032_0796536_38_556
Length 156
Sequence MMNGMKIVLVVAVGENGIIGRGGQLPWHLRSDLQHFKRLTLGKPVIMGRKTYESIGKPLPQRTNIVVTRDAGFSAPGVLFASDLPAAFAMARADADKRGVDEIMVIGGSDVHASPAGDVSFPPIDRNLWREVAREHHMRGPQDDCDFTTLTYTRAR

Samples

Sample ID Description Type Environment
1 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
2 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
7 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
8 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
9 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
10 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
11 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
12 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
13 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
14 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
15 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
16 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
17 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
18 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
19 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
20 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
21 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
22 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
23 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
24 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
25 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
26 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
27 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
28 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
29 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
30 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
31 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
32 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
33 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
34 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
35 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
36 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
37 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
38 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
39 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
40 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
41 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
42 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
43 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
44 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
45 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
46 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
47 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
48 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
49 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
50 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
51 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
52 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
53 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
54 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
55 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
56 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
57 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
58 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
59 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
60 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
61 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
62 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
63 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
64 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
65 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
66 3300012481 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.1.yng.040610 Metagenome Rhizosphere
67 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
68 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
69 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
70 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
71 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
72 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
73 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
74 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
75 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
76 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
77 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
78 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
79 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
80 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
81 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
82 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
114 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
115 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
116 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
117 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
118 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
119 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
120 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
121 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
122 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
123 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
124 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
125 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
126 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
127 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
128 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
129 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
130 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
131 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
132 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
133 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
134 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
135 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
136 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
137 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
138 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
139 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
140 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
141 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
142 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
143 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
144 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
145 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
146 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
147 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
148 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
149 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
150 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
151 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
152 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
153 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
154 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
155 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
156 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
157 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
158 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
159 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
160 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
161 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
162 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
163 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
164 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
165 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
166 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
167 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
168 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
169 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
170 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
171 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
172 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
173 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
174 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
175 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
176 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
177 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
178 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
179 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
180 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
181 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
182 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
183 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
184 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
185 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
186 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
187 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
188 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
189 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
190 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
191 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
192 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
193 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
194 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
195 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
196 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
197 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
198 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
199 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
200 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
201 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
202 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
203 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
204 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
205 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
206 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
207 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
208 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
209 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
210 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
211 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
212 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
213 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
214 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
215 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
216 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
217 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
218 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
219 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
220 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
221 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
222 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
223 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
224 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
225 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
226 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
227 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
228 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
229 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
230 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
231 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
232 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
233 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
234 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
235 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
236 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
237 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
238 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
239 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
240 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
241 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
242 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
243 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
244 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
245 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
246 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
247 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
248 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
249 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
250 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
251 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
252 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
253 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
254 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
255 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
256 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
257 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
258 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
259 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
260 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
261 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
262 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
263 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
264 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
265 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
266 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
267 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
268 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
269 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
270 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
271 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
272 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
273 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
274 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
275 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
276 3300053728 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 endosphere Metagenome Endosphere
277 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
278 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
279 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
280 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
281 2643221547 Pseudolabrys sp. Root1462 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.64
Metatranscriptomes 0.18
Isolates 0.18

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.41
Nodule 0
Rhizoplane 5.57
Rhizosphere 90.31
Stem 0
Stem Tuber 0
Unclassified 6.1

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501032_0796536 3300049569 Bacteria 597
2 JGI25165J46597_1027022 3300003214 Bacteria 743
3 Ga0070658_10744498 3300005327 Bacteria 851
4 Ga0070666_10389827 3300005335 Unclassified 1001
5 Ga0070680_100080171 3300005336 Bacteria 2692
6 Ga0070680_100273597 3300005336 Bacteria 1430
7 Ga0070661_100025924 3300005344 Bacteria 4213
8 Ga0070675_100490587 3300005354 Unclassified 1106
9 Ga0070671_100093988 3300005355 Bacteria 2513
10 Ga0070674_100023567 3300005356 Bacteria 3985
11 Ga0070673_100055154 3300005364 Bacteria 3130
12 Ga0070659_100149379 3300005366 Bacteria 1905
13 Ga0070667_100056374 3300005367 Bacteria 3319
14 Ga0070709_10186142 3300005434 Bacteria 1461
15 Ga0070714_100018468 3300005435 Bacteria 5664
16 Ga0070713_100359474 3300005436 Bacteria 1352
17 Ga0070710_10053105 3300005437 Bacteria 2282
18 Ga0070711_100006095 3300005439 Bacteria 7247
19 Ga0070711_100056739 3300005439 Bacteria 2710
20 Ga0070711_100115912 3300005439 Bacteria 1973
21 Ga0070711_100143246 3300005439 Bacteria 1794
22 Ga0070705_100083905 3300005440 Bacteria 1964
23 Ga0070694_100313833 3300005444 Bacteria 1205
24 Ga0070663_100060818 3300005455 Bacteria 2718
25 Ga0070663_100769096 3300005455 Unclassified 824
26 Ga0070678_100020530 3300005456 Bacteria 4336
27 Ga0070678_100065070 3300005456 Bacteria 2705
28 Ga0070681_10072090 3300005458 Bacteria 3417
29 Ga0070681_10746707 3300005458 Unclassified 895
30 Ga0070681_10750695 3300005458 Bacteria 892
31 Ga0070685_10359643 3300005466 Bacteria 997
32 Ga0070679_100028116 3300005530 Bacteria 5541
33 Ga0070679_100095983 3300005530 Bacteria 2952
34 Ga0070684_100775423 3300005535 Bacteria 896
35 Ga0068853_100580542 3300005539 Bacteria 1064
36 Ga0070695_100222047 3300005545 Bacteria 1362
37 Ga0070696_100135573 3300005546 Bacteria 1795
38 Ga0070693_100143658 3300005547 Bacteria 1505
39 Ga0070665_100807073 3300005548 Bacteria 951
40 Ga0070704_100580587 3300005549 Unclassified 983
41 Ga0068855_100284816 3300005563 Bacteria 1834
42 Ga0068856_100244772 3300005614 Bacteria 1808
43 Ga0068856_101449378 3300005614 Unclassified 701
44 Ga0068864_100205596 3300005618 Bacteria 1811
45 Ga0068866_10808707 3300005718 Unclassified 652
46 Ga0081455_10011386 3300005937 Bacteria 8941
47 Ga0081455_10379928 3300005937 Archaea 987
48 Ga0070717_10855056 3300006028 Unclassified 828
49 Ga0075364_10243097 3300006051 Bacteria 1223
50 Ga0075432_10027682 3300006058 Bacteria 1952
51 Ga0070712_101002826 3300006175 Unclassified 723
52 Ga0075367_10629146 3300006178 Bacteria 682
53 Ga0075427_10002688 3300006194 Bacteria 2409
54 Ga0097621_100033091 3300006237 Bacteria 4114
55 Ga0075370_10150693 3300006353 Bacteria 1363
56 Ga0068871_100163007 3300006358 Bacteria 1907
57 Ga0075428_100387900 3300006844 Bacteria 1497
58 Ga0075430_100205099 3300006846 Bacteria 1636
59 Ga0075433_10024260 3300006852 Bacteria 5116
60 Ga0075433_10305073 3300006852 Unclassified 1410
61 Ga0075434_100117871 3300006871 Bacteria 2668
62 Ga0075434_100264412 3300006871 Bacteria 1739
63 Ga0075434_100494638 3300006871 Bacteria 1244
64 Ga0075429_100268413 3300006880 Bacteria 1494
65 Ga0075435_100287796 3300007076 Bacteria 1403
66 Ga0075435_100399027 3300007076 Bacteria 1183
67 Ga0105250_10070270 3300009092 Bacteria 1414
68 Ga0105240_10398598 3300009093 Bacteria 1550
69 Ga0105240_10501462 3300009093 Unclassified 1349
70 Ga0105240_11220412 3300009093 Bacteria 796
71 Ga0111539_10445139 3300009094 Bacteria 1508
72 Ga0105245_10094403 3300009098 Bacteria 2757
73 Ga0105245_10216433 3300009098 Bacteria 1846
74 Ga0105247_10239316 3300009101 Unclassified 1236
75 Ga0105247_10303420 3300009101 Bacteria 1109
76 Ga0114129_10550688 3300009147 Bacteria 1500
77 Ga0114129_11129938 3300009147 Bacteria 979
78 Ga0105241_10389840 3300009174 Bacteria 1219
79 Ga0105241_10582389 3300009174 Bacteria 1009
80 Ga0105242_10138984 3300009176 Bacteria 2105
81 Ga0105248_10020734 3300009177 Bacteria 7281
82 Ga0105237_10344850 3300009545 Bacteria 1494
83 Ga0105237_10357353 3300009545 Bacteria 1465
84 Ga0105238_10275243 3300009551 Bacteria 1664
85 Ga0105249_10137200 3300009553 Bacteria 2342
86 Ga0105249_10977786 3300009553 Unclassified 915
87 Ga0105239_10075495 3300010375 Bacteria 3706
88 Ga0105239_12306382 3300010375 Bacteria 626
89 Ga0105246_10029143 3300011119 Bacteria 3632
90 Ga0105246_10054987 3300011119 Bacteria 2745
91 Ga0157320_1001827 3300012481 Bacteria 1131
92 Ga0157370_10157941 3300013104 Bacteria 2110
93 Ga0157369_10230640 3300013105 Bacteria 1936
94 Ga0157374_10197690 3300013296 Bacteria 1968
95 Ga0157374_10453939 3300013296 Bacteria 1283
96 Ga0157378_10062983 3300013297 Bacteria 3313
97 Ga0157378_10200944 3300013297 Bacteria 1885
98 Ga0163162_10197819 3300013306 Bacteria 2139
99 Ga0163162_10250363 3300013306 Bacteria 1904
100 Ga0157372_10276386 3300013307 Bacteria 1952
101 Ga0157372_11558496 3300013307 Unclassified 761
102 Ga0157375_10096786 3300013308 Bacteria 3025
103 Ga0157375_10434160 3300013308 Bacteria 1479
104 Ga0157375_11843294 3300013308 Unclassified 717
105 Ga0163163_10212474 3300014325 Bacteria 1984
106 Ga0157379_10060733 3300014968 Bacteria 3380
107 Ga0157379_10274728 3300014968 Bacteria 1533
108 Ga0157376_10051396 3300014969 Bacteria 3423
109 Ga0157376_10316154 3300014969 Bacteria 1483
110 Ga0163161_10517249 3300017792 Unclassified 974
111 Ga0206356_11792220 3300020070 Unclassified 625
112 Ga0213873_10123836 3300021358 Bacteria 761
113 Ga0213876_10089048 3300021384 Bacteria 1635
114 Ga0209233_1006346 3300025261 Bacteria 3819
115 Ga0207692_10235457 3300025898 Unclassified 1091
116 Ga0207710_10168418 3300025900 Bacteria 1070
117 Ga0207685_10029768 3300025905 Bacteria 1937
118 Ga0207707_10215606 3300025912 Bacteria 1671
119 Ga0207707_10766812 3300025912 Bacteria 806
120 Ga0207695_10351540 3300025913 Bacteria 1361
121 Ga0207671_10113007 3300025914 Bacteria 2068
122 Ga0207693_10008546 3300025915 Bacteria 8380
123 Ga0207693_10302440 3300025915 Bacteria 1253
124 Ga0207663_10053001 3300025916 Bacteria 2532
125 Ga0207663_10161182 3300025916 Bacteria 1583
126 Ga0207663_10170232 3300025916 Bacteria 1546
127 Ga0207660_10205885 3300025917 Bacteria 1538
128 Ga0207657_10035581 3300025919 Bacteria 4464
129 Ga0207652_10018220 3300025921 Bacteria 5757
130 Ga0207694_10155401 3300025924 Bacteria 1845
131 Ga0207694_10184587 3300025924 Bacteria 1692
132 Ga0207659_10175202 3300025926 Bacteria 1695
133 Ga0207659_10643771 3300025926 Bacteria 906
134 Ga0207687_10060600 3300025927 Bacteria 2670
135 Ga0207664_10025181 3300025929 Bacteria 4478
136 Ga0207664_10039614 3300025929 Bacteria 3659
137 Ga0207644_10007589 3300025931 Bacteria 7073
138 Ga0207706_10009732 3300025933 Bacteria 8821
139 Ga0207686_10102853 3300025934 Bacteria 1910
140 Ga0207669_10084551 3300025937 Bacteria 2045
141 Ga0207711_10214164 3300025941 Bacteria 1760
142 Ga0207689_10721643 3300025942 Unclassified 841
143 Ga0207667_10149652 3300025949 Bacteria 2403
144 Ga0207667_10602655 3300025949 Bacteria 1107
145 Ga0207651_10067000 3300025960 Bacteria 2525
146 Ga0207712_10031556 3300025961 Bacteria 3570
147 Ga0207640_10133241 3300025981 Bacteria 1799
148 Ga0207658_10160460 3300025986 Bacteria 1842
149 Ga0207678_10021192 3300026067 Bacteria 5697
150 Ga0207678_10021441 3300026067 Bacteria 5664
151 Ga0207678_10262635 3300026067 Bacteria 1480
152 Ga0207676_10126913 3300026095 Bacteria 2162
153 Ga0207674_10279119 3300026116 Bacteria 1619
154 Ga0207683_10050440 3300026121 Bacteria 3645
155 Ga0207683_10338002 3300026121 Bacteria 1381
156 Ga0268266_10478079 3300028379 Bacteria 1187
157 Ga0268266_10869257 3300028379 Bacteria 872
158 Ga0265337_1001493 3300028556 Bacteria 11469
159 Ga0265338_10017281 3300028800 Bacteria 7785
160 Ga0265330_10069879 3300031235 Bacteria 1520
161 Ga0265325_10022838 3300031241 Bacteria 3422
162 Ga0265325_10043030 3300031241 Bacteria 2358
163 Ga0265340_10020486 3300031247 Bacteria 3398
164 Ga0265331_10174776 3300031250 Bacteria 971
165 Ga0265316_10078554 3300031344 Bacteria 2533
166 Ga0265316_10181305 3300031344 Bacteria 1568
167 Ga0265316_10627074 3300031344 Unclassified 761
168 Ga0265313_10000513 3300031595 Bacteria 40580
169 Ga0265313_10001570 3300031595 Bacteria 21191
170 Ga0265313_10008665 3300031595 Bacteria 6726
171 Ga0265313_10012327 3300031595 Bacteria 5229
172 Ga0316579_10022141 3300031691 Bacteria 2839
173 Ga0265314_10000771 3300031711 Bacteria 38181
174 Ga0265314_10007590 3300031711 Bacteria 9389
175 Ga0307405_10987218 3300031731 Bacteria 718
176 Ga0307413_10126431 3300031824 Bacteria 1742
177 Ga0307413_10200169 3300031824 Bacteria 1442
178 Ga0307407_10245837 3300031903 Bacteria 1223
179 Ga0307407_10514003 3300031903 Bacteria 880
180 Ga0307409_100068917 3300031995 Bacteria 2800
181 Ga0373930_0011268 3300034816 Bacteria 1612
182 Ga0373950_0008438 3300034818 Bacteria 1622
183 Ga0373958_0002453 3300034819 Bacteria 2601
184 Ga0373938_0000453 3300034957 Bacteria 6689
185 Ga0373926_0013097 3300035083 Bacteria 2809
186 Ga0373934_0033608 3300035086 Bacteria 2013
187 Ga0373944_0032533 3300035089 Bacteria 1576
188 Ga0373951_0015860 3300035091 Bacteria 1699
189 Ga0373952_0138559 3300035092 Unclassified 674
190 Ga0373923_0000792 3300035111 Bacteria 8234
191 Ga0373936_0001246 3300035113 Bacteria 9176
192 Ga0373936_0125776 3300035113 Bacteria 1099
193 Ga0373945_0020052 3300035116 Bacteria 2285
194 Ga0373953_0017642 3300035117 Bacteria 2628
195 Ga0373954_0009128 3300035118 Bacteria 4363
196 Ga0373954_0016323 3300035118 Bacteria 3322
197 Ga0373954_0025519 3300035118 Bacteria 2702
198 Ga0373956_0009309 3300035119 Bacteria 3993
199 Ga0373956_0075068 3300035119 Bacteria 1546
200 Ga0373957_0164136 3300035120 Bacteria 916
201 Ga0373960_0012957 3300035121 Bacteria 2082
202 Ga0373943_0007158 3300035170 Bacteria 5005
203 Ga0373946_0001845 3300035171 Bacteria 7409
204 Ga0373955_0008402 3300035172 Bacteria 4795
205 Ga0373955_0016631 3300035172 Bacteria 3624
206 Ga0373942_0048570 3300035207 Bacteria 1183
207 Ga0373962_0002352 3300035242 Bacteria 4513
208 Ga0373924_0004724 3300035410 Bacteria 4780
209 Ga0373924_0023311 3300035410 Bacteria 2426
210 Ga0373924_0123129 3300035410 Bacteria 1126
211 Ga0373924_0156503 3300035410 Bacteria 998
212 Ga0373931_0010698 3300035691 Bacteria 4415
213 Ga0373931_0321215 3300035691 Bacteria 961
214 Ga0373935_0003876 3300035692 Bacteria 8728
215 Ga0373935_0005968 3300035692 Bacteria 7226
216 Ga0373935_0181526 3300035692 Bacteria 1445
217 Ga0373935_0271627 3300035692 Unclassified 1191
218 Ga0373927_0004839 3300035695 Bacteria 9361
219 Ga0373933_0004411 3300035724 Bacteria 7729
220 Ga0373947_0126534 3300035725 Bacteria 1627
221 Ga0373947_0188464 3300035725 Bacteria 1345
222 Ga0373937_0002145 3300036401 Bacteria 16512
223 Ga0373937_0006979 3300036401 Bacteria 9748
224 Ga0373937_0030415 3300036401 Bacteria 4891
225 Ga0373937_0080020 3300036401 Bacteria 3021
226 Ga0373937_0144865 3300036401 Bacteria 2223
227 Ga0316582_0117604 3300036647 Bacteria 1776
228 Ga0373925_0008524 3300037068 Bacteria 7471
229 Ga0373925_0023646 3300037068 Bacteria 4483
230 Ga0436365_1873778 3300039437 Bacteria 12049
231 Ga0436365_1904201 3300039437 Bacteria 1475
232 Ga0436362_0723276 3300039453 Bacteria 1820
233 Ga0495592_0006856 3300046454 Bacteria 8504
234 Ga0495592_0041995 3300046454 Bacteria 3425
235 Ga0495603_0062839 3300046455 Bacteria 2191
236 Ga0495629_0001240 3300046459 Bacteria 20042
237 Ga0495629_0075992 3300046459 Bacteria 2345
238 Ga0495629_0738330 3300046459 Unclassified 652
239 Ga0495641_0021394 3300046461 Bacteria 3255
240 Ga0495641_0212811 3300046461 Unclassified 867
241 Ga0495651_0006317 3300046462 Bacteria 9063
242 Ga0495651_0029605 3300046462 Bacteria 4270
243 Ga0495651_0287778 3300046462 Bacteria 1107
244 Ga0495653_0010825 3300046463 Bacteria 7465
245 Ga0495580_0015940 3300046472 Bacteria 5655
246 Ga0495580_0367938 3300046472 Bacteria 972
247 Ga0495580_0519527 3300046472 Unclassified 793
248 Ga0495582_0003108 3300046473 Bacteria 9307
249 Ga0495582_0324694 3300046473 Bacteria 885
250 Ga0495639_0004976 3300046475 Bacteria 5700
251 Ga0495662_0019363 3300046476 Bacteria 3291
252 Ga0495662_0223913 3300046476 Unclassified 927
253 Ga0495664_0028098 3300046477 Bacteria 3283
254 Ga0495594_0010943 3300046499 Bacteria 4707
255 Ga0495594_0144572 3300046499 Bacteria 1349
256 Ga0495608_0001415 3300046511 Bacteria 17058
257 Ga0495608_0176849 3300046511 Bacteria 1351
258 Ga0495618_0017306 3300046514 Bacteria 4417
259 Ga0495618_0038370 3300046514 Bacteria 3010
260 Ga0495618_0306343 3300046514 Bacteria 986
261 Ga0495628_0023939 3300046516 Bacteria 5005
262 Ga0495630_0007589 3300046517 Bacteria 7754
263 Ga0495630_0119338 3300046517 Bacteria 2000
264 Ga0495630_0395837 3300046517 Bacteria 1058
265 Ga0495644_0034753 3300046523 Bacteria 1903
266 Ga0495666_0001193 3300046526 Bacteria 12527
267 Ga0495652_0042527 3300046529 Bacteria 3917
268 Ga0495665_0009870 3300046531 Bacteria 5168
269 Ga0495665_0064381 3300046531 Bacteria 1935
270 Ga0495665_0408723 3300046531 Bacteria 688
271 Ga0495640_0034312 3300046533 Bacteria 3599
272 Ga0495640_0077035 3300046533 Bacteria 2223
273 Ga0495640_0291231 3300046533 Unclassified 1015
274 Ga0495586_0035461 3300046535 Bacteria 2680
275 Ga0495587_0004603 3300046536 Bacteria 9067
276 Ga0495645_0052308 3300046543 Bacteria 2971
277 Ga0495645_0060598 3300046543 Bacteria 2743
278 Ga0495622_0004018 3300046557 Bacteria 6866
279 Ga0495667_0001645 3300046559 Bacteria 14801
280 Ga0495667_0020703 3300046559 Bacteria 4439
281 Ga0495667_0037944 3300046559 Bacteria 3209
282 Ga0495634_0097536 3300046642 Bacteria 1902
283 Ga0495634_0104450 3300046642 Bacteria 1827
284 Ga0495635_0022810 3300046663 Bacteria 4363
285 Ga0495635_0024338 3300046663 Bacteria 4220
286 Ga0495635_0032827 3300046663 Bacteria 3601
287 Ga0495635_0072161 3300046663 Bacteria 2366
288 Ga0495635_0191074 3300046663 Bacteria 1390
289 Ga0495588_0024562 3300046674 Bacteria 2995
290 Ga0495588_0512354 3300046674 Unclassified 629
291 Ga0495657_0142120 3300046675 Bacteria 1495
292 Ga0495599_0013019 3300046678 Bacteria 5133
293 Ga0495623_0000629 3300046679 Bacteria 23493
294 Ga0495646_0004584 3300046680 Bacteria 8710
295 Ga0495646_0012772 3300046680 Bacteria 5338
296 Ga0495647_0000801 3300046681 Bacteria 9394
297 Ga0495647_0005629 3300046681 Bacteria 4116
298 Ga0495658_0000745 3300046683 Bacteria 17569
299 Ga0495658_0002290 3300046683 Bacteria 9656
300 Ga0495658_0215811 3300046683 Bacteria 1200
301 Ga0495613_0042153 3300046689 Bacteria 3378
302 Ga0495613_0152323 3300046689 Bacteria 1648
303 Ga0495624_0038700 3300046690 Bacteria 3062
304 Ga0495600_0004235 3300046809 Bacteria 8567
305 Ga0495600_0067886 3300046809 Bacteria 2330
306 Ga0495600_0082507 3300046809 Bacteria 2098
307 Ga0495581_0050728 3300047315 Bacteria 2396
308 Ga0495581_0153046 3300047315 Bacteria 1347
309 Ga0495581_0206366 3300047315 Bacteria 1149
310 Ga0495604_0008684 3300047317 Bacteria 8030
311 Ga0495604_0026165 3300047317 Bacteria 4645
312 Ga0495636_0605883 3300047318 Bacteria 536
313 Ga0495674_0019562 3300047319 Bacteria 6282
314 Ga0495674_0020681 3300047319 Bacteria 6094
315 Ga0495674_0074689 3300047319 Bacteria 2918
316 Ga0495674_0495180 3300047319 Bacteria 978
317 Ga0495676_0068957 3300047321 Bacteria 2730
318 Ga0495680_0005762 3300047322 Bacteria 11598
319 Ga0495680_0010131 3300047322 Bacteria 8423
320 Ga0495680_0020742 3300047322 Bacteria 5518
321 Ga0495680_0041210 3300047322 Bacteria 3673
322 Ga0495680_0179768 3300047322 Bacteria 1528
323 Ga0495675_0002358 3300047444 Bacteria 11271
324 Ga0495684_0070444 3300047471 Bacteria 2658
325 Ga0495684_0552712 3300047471 Bacteria 784
326 Ga0495593_0005464 3300047673 Bacteria 7504
327 Ga0495593_0055496 3300047673 Bacteria 2085
328 Ga0495593_0163950 3300047673 Bacteria 1121
329 Ga0495602_0028395 3300048088 Bacteria 5354
330 Ga0495614_0018217 3300048089 Bacteria 3042
331 Ga0496100_0057851 3300048903 Bacteria 2541
332 Ga0496101_0066666 3300048904 Bacteria 2626
333 Ga0496101_0201599 3300048904 Bacteria 1538
334 Ga0496102_0058075 3300048905 Bacteria 3534
335 Ga0496102_0069032 3300048905 Bacteria 3244
336 Ga0496102_0129217 3300048905 Bacteria 2363
337 Ga0496102_0195065 3300048905 Bacteria 1908
338 Ga0496103_0039901 3300048906 Bacteria 2885
339 Ga0496103_0054128 3300048906 Bacteria 2487
340 Ga0496104_0011174 3300048907 Bacteria 8035
341 Ga0496104_0083240 3300048907 Bacteria 3051
342 Ga0496105_0013053 3300048908 Bacteria 6584
343 Ga0496105_0072838 3300048908 Bacteria 2838
344 Ga0496106_0059439 3300048909 Bacteria 2896
345 Ga0496106_0138323 3300048909 Bacteria 1914
346 Ga0496107_0005300 3300048910 Bacteria 8812
347 Ga0496107_0109787 3300048910 Bacteria 2026
348 Ga0496107_0183595 3300048910 Bacteria 1553
349 Ga0496108_0087953 3300048911 Bacteria 2639
350 Ga0496109_0051612 3300048912 Bacteria 3746
351 Ga0496109_0105642 3300048912 Bacteria 2615
352 Ga0496110_0268213 3300048913 Bacteria 1554
353 Ga0496111_0029169 3300048914 Bacteria 3917
354 Ga0496111_0384198 3300048914 Bacteria 1038
355 Ga0496112_0102788 3300048915 Bacteria 2827
356 Ga0496112_0422927 3300048915 Bacteria 1271
357 Ga0496113_0064033 3300048916 Bacteria 2779
358 Ga0496114_0029554 3300048917 Bacteria 4506
359 Ga0496115_0062175 3300048918 Bacteria 3012
360 Ga0496115_0170415 3300048918 Bacteria 1800
361 Ga0496115_0408254 3300048918 Bacteria 1101
362 Ga0501031_0005435 3300049568 Bacteria 8294
363 Ga0501031_0052292 3300049568 Bacteria 2661
364 Ga0501031_0094304 3300049568 Bacteria 1953
365 Ga0501031_0101815 3300049568 Bacteria 1874
366 Ga0501031_0217338 3300049568 Bacteria 1245
367 Ga0501032_0017735 3300049569 Bacteria 4997
368 Ga0501032_0031486 3300049569 Bacteria 3636
369 Ga0501032_0049318 3300049569 Bacteria 2840
370 Ga0501032_0175839 3300049569 Bacteria 1402
371 Ga0501033_0028789 3300049570 Bacteria 4174
372 Ga0501033_0040575 3300049570 Bacteria 3474
373 Ga0501033_0052369 3300049570 Bacteria 3025
374 Ga0501033_0193383 3300049570 Bacteria 1455
375 Ga0501034_0000197 3300049571 Bacteria 114088
376 Ga0501034_0001247 3300049571 Bacteria 34598
377 Ga0501034_0019479 3300049571 Bacteria 6940
378 Ga0501034_0025868 3300049571 Bacteria 5977
379 Ga0501034_0030864 3300049571 Bacteria 5446
380 Ga0501034_0078135 3300049571 Bacteria 3314
381 Ga0501034_0167764 3300049571 Bacteria 2163
382 Ga0501034_0223572 3300049571 Bacteria 1834
383 Ga0501034_0252054 3300049571 Bacteria 1709
384 Ga0501036_0017189 3300049572 Bacteria 6046
385 Ga0501036_0037657 3300049572 Bacteria 4091
386 Ga0501036_0039959 3300049572 Bacteria 3968
387 Ga0501036_0078588 3300049572 Bacteria 2790
388 Ga0501036_0103529 3300049572 Bacteria 2407
389 Ga0501036_0547638 3300049572 Unclassified 961
390 Ga0501037_0006086 3300049573 Bacteria 8818
391 Ga0501037_0017837 3300049573 Bacteria 5225
392 Ga0501037_0018838 3300049573 Bacteria 5086
393 Ga0501037_0032508 3300049573 Bacteria 3852
394 Ga0501037_0053118 3300049573 Bacteria 2963
395 Ga0501037_0246408 3300049573 Bacteria 1251
396 Ga0501037_0250078 3300049573 Bacteria 1241
397 Ga0501038_0007936 3300049574 Bacteria 9780
398 Ga0501038_0037665 3300049574 Bacteria 4239
399 Ga0501038_0309106 3300049574 Bacteria 1239
400 Ga0501038_0556636 3300049574 Bacteria 871
401 Ga0501038_0802126 3300049574 Bacteria 699
402 Ga0501039_0034420 3300049575 Bacteria 3909
403 Ga0501039_0074878 3300049575 Bacteria 2631
404 Ga0501039_0182216 3300049575 Bacteria 1651
405 Ga0501040_0028195 3300049576 Bacteria 3784
406 Ga0501042_0397030 3300049578 Bacteria 999
407 Ga0501043_0006548 3300049579 Bacteria 9342
408 Ga0501043_0006622 3300049579 Bacteria 9268
409 Ga0501043_0022318 3300049579 Bacteria 4966
410 Ga0501043_0169887 3300049579 Bacteria 1701
411 Ga0501043_0179812 3300049579 Bacteria 1648
412 Ga0501043_0254304 3300049579 Bacteria 1352
413 Ga0501043_0583779 3300049579 Bacteria 827
414 Ga0501046_0009112 3300049580 Bacteria 8596
415 Ga0501046_0074207 3300049580 Bacteria 2639
416 Ga0501046_0430040 3300049580 Bacteria 951
417 Ga0501047_0000186 3300049581 Bacteria 75102
418 Ga0501047_0011383 3300049581 Bacteria 8419
419 Ga0501047_0014304 3300049581 Bacteria 7547
420 Ga0501047_0016856 3300049581 Bacteria 6982
421 Ga0501047_0055362 3300049581 Bacteria 3836
422 Ga0501047_0155664 3300049581 Bacteria 2159
423 Ga0501047_1104725 3300049581 Unclassified 606
424 Ga0501048_0000856 3300049582 Bacteria 22438
425 Ga0501048_0102084 3300049582 Bacteria 2023
426 Ga0501048_0292425 3300049582 Bacteria 1159
427 Ga0501067_0009025 3300049583 Bacteria 5524
428 Ga0501068_0020312 3300049584 Bacteria 3867
429 Ga0501068_0118586 3300049584 Bacteria 1649
430 Ga0501068_0151686 3300049584 Bacteria 1457
431 Ga0501068_0162116 3300049584 Bacteria 1409
432 Ga0501069_0054962 3300049585 Bacteria 2217
433 Ga0501069_0086970 3300049585 Bacteria 1765
434 Ga0501069_0126380 3300049585 Bacteria 1462
435 Ga0501069_0140073 3300049585 Bacteria 1387
436 Ga0501069_0203186 3300049585 Bacteria 1149
437 Ga0501069_0334289 3300049585 Bacteria 891
438 Ga0501070_0002665 3300049586 Bacteria 15579
439 Ga0501070_0008996 3300049586 Bacteria 8449
440 Ga0501070_0009868 3300049586 Bacteria 8073
441 Ga0501070_0021109 3300049586 Bacteria 5464
442 Ga0501070_0039121 3300049586 Bacteria 3956
443 Ga0501070_0051850 3300049586 Bacteria 3404
444 Ga0501070_0060750 3300049586 Bacteria 3132
445 Ga0501070_0081757 3300049586 Bacteria 2673
446 Ga0501070_0087649 3300049586 Bacteria 2576
447 Ga0501070_0124067 3300049586 Bacteria 2134
448 Ga0501070_0130161 3300049586 Bacteria 2079
449 Ga0501070_0330657 3300049586 Bacteria 1238
450 Ga0501071_0053722 3300049587 Bacteria 2906
451 Ga0501071_0084183 3300049587 Bacteria 2330
452 Ga0501072_0018872 3300049588 Bacteria 5320
453 Ga0501072_0053379 3300049588 Bacteria 3183
454 Ga0501072_0408430 3300049588 Bacteria 1077
455 Ga0501073_0010210 3300049589 Bacteria 6897
456 Ga0501073_0018856 3300049589 Bacteria 4986
457 Ga0501073_0023953 3300049589 Bacteria 4383
458 Ga0501073_0059716 3300049589 Bacteria 2662
459 Ga0501073_0275365 3300049589 Bacteria 1161
460 Ga0501074_0013074 3300049590 Bacteria 6034
461 Ga0501074_0016442 3300049590 Bacteria 5372
462 Ga0501074_0369504 3300049590 Bacteria 1017
463 Ga0501074_0657173 3300049590 Bacteria 740
464 Ga0501076_0094064 3300049592 Bacteria 2413
465 Ga0501077_0034959 3300049593 Bacteria 3199
466 Ga0501079_0003839 3300049741 Bacteria 11093
467 Ga0501079_0046620 3300049741 Bacteria 3344
468 Ga0501079_0114331 3300049741 Bacteria 2098
469 Ga0501079_0135781 3300049741 Bacteria 1915
470 Ga0501080_0000299 3300049742 Bacteria 37707
471 Ga0501080_0005257 3300049742 Bacteria 11531
472 Ga0501080_0215515 3300049742 Bacteria 1758
473 Ga0501080_0463802 3300049742 Bacteria 1135
474 Ga0501080_0994922 3300049742 Bacteria 727
475 Ga0501081_0676359 3300049743 Bacteria 774
476 Ga0501083_0000302 3300049744 Bacteria 31114
477 Ga0501083_0035371 3300049744 Bacteria 3412
478 Ga0501083_0076374 3300049744 Bacteria 2223
479 Ga0501083_0114001 3300049744 Bacteria 1775
480 Ga0501083_0135852 3300049744 Bacteria 1611
481 Ga0501083_0158502 3300049744 Bacteria 1481
482 Ga0501083_0189665 3300049744 Bacteria 1342
483 Ga0501083_0251567 3300049744 Bacteria 1150
484 Ga0501083_0298049 3300049744 Bacteria 1048
485 Ga0501035_0004131 3300049822 Bacteria 13799
486 Ga0501035_0021633 3300049822 Bacteria 5914
487 Ga0501035_0272475 3300049822 Bacteria 1432
488 Ga0501035_0517569 3300049822 Bacteria 980
489 Ga0501044_0061489 3300049823 Bacteria 3842
490 Ga0501044_0098202 3300049823 Bacteria 2948
491 Ga0501044_0113041 3300049823 Bacteria 2722
492 Ga0501044_0118843 3300049823 Bacteria 2645
493 Ga0501044_0154510 3300049823 Bacteria 2275
494 Ga0501044_0204011 3300049823 Bacteria 1934
495 Ga0501044_0206202 3300049823 Bacteria 1922
496 Ga0501044_0403304 3300049823 Bacteria 1279
497 Ga0501044_0635793 3300049823 Bacteria 957
498 nmdc:mga07m45_168883_c1 3300050496 Bacteria 1271
499 nmdc:mga05p37_56283_c1 3300050507 Bacteria 4842
500 nmdc:mga06r32_58819_c1 3300050510 Bacteria 3695
501 nmdc:mga08y16_540223_c1 3300050511 Bacteria 1181
502 nmdc:mga08y16_68893_c1 3300050511 Bacteria 3689
503 nmdc:mga0n895_253279_c1 3300050512 Bacteria 1787
504 nmdc:mga0n895_351949_c1 3300050512 Bacteria 1492
505 nmdc:mga0n895_357234_c1 3300050512 Bacteria 1480
506 nmdc:mga0n895_530184_c1 3300050512 Bacteria 1185
507 nmdc:mga0rr50_265676_c1 3300050513 Bacteria 1429
508 nmdc:mga0rr50_30813_c1 3300050513 Bacteria 3803
509 nmdc:mga0rr50_51956_c1 3300050513 Bacteria 3043
510 nmdc:mga08x19_237006_c1 3300050514 Bacteria 1257
511 nmdc:mga08x19_331995_c1 3300050514 Bacteria 1059
512 nmdc:mga08x19_62852_c1 3300050514 Bacteria 2408
513 nmdc:mga0a205_1362560_c1 3300050515 Unclassified 557
514 nmdc:mga0a205_422148_c1 3300050515 Bacteria 1195
515 nmdc:mga0a205_52693_c1 3300050515 Bacteria 3927
516 Ga0495601_0000352 3300053077 Bacteria 24145
517 Ga0495601_0008676 3300053077 Bacteria 5997
518 Ga0495601_0010571 3300053077 Bacteria 5496
519 Ga0495601_0049828 3300053077 Bacteria 2641
520 Ga0495601_0335629 3300053077 Bacteria 984
521 Ga0495601_0754276 3300053077 Unclassified 619
522 Ga0495612_0003841 3300053078 Bacteria 6236
523 Ga0495612_0004226 3300053078 Bacteria 5958
524 Ga0495612_0013588 3300053078 Bacteria 3279
525 Ga0495612_0026130 3300053078 Bacteria 2347
526 Ga0495612_0053461 3300053078 Bacteria 1663
527 Ga0495595_0000405 3300053084 Bacteria 16418
528 Ga0495595_0001531 3300053084 Bacteria 9014
529 Ga0495595_0010289 3300053084 Bacteria 3885
530 Ga0495619_0000085 3300053085 Bacteria 70073
531 Ga0495619_0000536 3300053085 Bacteria 25079
532 Ga0495619_0008387 3300053085 Bacteria 6533
533 Ga0495619_0011351 3300053085 Bacteria 5609
534 Ga0495619_0023812 3300053085 Bacteria 3924
535 Ga0500643_012236 3300053087 Bacteria 3081
536 Ga0500644_0000795 3300053088 Bacteria 10744
537 Ga0500651_0017592 3300053093 Bacteria 4413
538 Ga0500651_0158036 3300053093 Bacteria 1357
539 Ga0500566_0189429 3300053094 Bacteria 1048
540 Ga0500572_225925 3300053111 Unclassified 612
541 Ga0500595_000024 3300053119 Bacteria 144160
542 Ga0500618_087126 3300053125 Unclassified 701
543 Ga0500652_005339 3300053131 Bacteria 4039
544 Ga0500568_0181928 3300053139 Bacteria 772
545 Ga0500616_0000458 3300053153 Bacteria 53402
546 Ga0500657_115272 3300053728 Bacteria 1077
547 Ga0500645_000102 3300053730 Bacteria 67660
548 Ga0501084_0103814 3300054114 Bacteria 2387
549 Ga0501084_0450776 3300054114 Bacteria 1088
550 Ga0501084_0651934 3300054114 Bacteria 889
551 Ga0501082_0035245 3300060353 Bacteria 4313
552 Ga0501082_0134633 3300060353 Bacteria 2144
553 Ga0501082_0281198 3300060353 Bacteria 1448
554 Ga0501082_0337391 3300060353 Bacteria 1313
555 Ga0501082_0792317 3300060353 Bacteria 829
556 Ga0530510_0693696 3300061734 Bacteria 776
557 2643755224 2643221547 Bacteria 4740017
558 Ga0501032_0796536
559 JGI25165J46597_1027022
560 Ga0070658_10744498
561 Ga0070666_10389827
562 Ga0070680_100080171
563 Ga0070680_100273597
564 Ga0070661_100025924
565 Ga0070675_100490587
566 Ga0070671_100093988
567 Ga0070674_100023567
568 Ga0070673_100055154
569 Ga0070659_100149379
570 Ga0070667_100056374
571 Ga0070709_10186142
572 Ga0070714_100018468
573 Ga0070713_100359474
574 Ga0070710_10053105
575 Ga0070711_100006095
576 Ga0070711_100056739
577 Ga0070711_100115912
578 Ga0070711_100143246
579 Ga0070705_100083905
580 Ga0070694_100313833
581 Ga0070663_100060818
582 Ga0070663_100769096
583 Ga0070678_100020530
584 Ga0070678_100065070
585 Ga0070681_10072090
586 Ga0070681_10746707
587 Ga0070681_10750695
588 Ga0070685_10359643
589 Ga0070679_100028116
590 Ga0070679_100095983
591 Ga0070684_100775423
592 Ga0068853_100580542
593 Ga0070695_100222047
594 Ga0070696_100135573
595 Ga0070693_100143658
596 Ga0070665_100807073
597 Ga0070704_100580587
598 Ga0068855_100284816
599 Ga0068856_100244772
600 Ga0068856_101449378
601 Ga0068864_100205596
602 Ga0068866_10808707
603 Ga0081455_10011386
604 Ga0081455_10379928
605 Ga0070717_10855056
606 Ga0075364_10243097
607 Ga0075432_10027682
608 Ga0070712_101002826
609 Ga0075367_10629146
610 Ga0075427_10002688
611 Ga0097621_100033091
612 Ga0075370_10150693
613 Ga0068871_100163007
614 Ga0075428_100387900
615 Ga0075430_100205099
616 Ga0075433_10024260
617 Ga0075433_10305073
618 Ga0075434_100117871
619 Ga0075434_100264412
620 Ga0075434_100494638
621 Ga0075429_100268413
622 Ga0075435_100287796
623 Ga0075435_100399027
624 Ga0105250_10070270
625 Ga0105240_10398598
626 Ga0105240_10501462
627 Ga0105240_11220412
628 Ga0111539_10445139
629 Ga0105245_10094403
630 Ga0105245_10216433
631 Ga0105247_10239316
632 Ga0105247_10303420
633 Ga0114129_10550688
634 Ga0114129_11129938
635 Ga0105241_10389840
636 Ga0105241_10582389
637 Ga0105242_10138984
638 Ga0105248_10020734
639 Ga0105237_10344850
640 Ga0105237_10357353
641 Ga0105238_10275243
642 Ga0105249_10137200
643 Ga0105249_10977786
644 Ga0105239_10075495
645 Ga0105239_12306382
646 Ga0105246_10029143
647 Ga0105246_10054987
648 Ga0157320_1001827
649 Ga0157370_10157941
650 Ga0157369_10230640
651 Ga0157374_10197690
652 Ga0157374_10453939
653 Ga0157378_10062983
654 Ga0157378_10200944
655 Ga0163162_10197819
656 Ga0163162_10250363
657 Ga0157372_10276386
658 Ga0157372_11558496
659 Ga0157375_10096786
660 Ga0157375_10434160
661 Ga0157375_11843294
662 Ga0163163_10212474
663 Ga0157379_10060733
664 Ga0157379_10274728
665 Ga0157376_10051396
666 Ga0157376_10316154
667 Ga0163161_10517249
668 Ga0206356_11792220
669 Ga0213873_10123836
670 Ga0213876_10089048
671 Ga0209233_1006346
672 Ga0207692_10235457
673 Ga0207710_10168418
674 Ga0207685_10029768
675 Ga0207707_10215606
676 Ga0207707_10766812
677 Ga0207695_10351540
678 Ga0207671_10113007
679 Ga0207693_10008546
680 Ga0207693_10302440
681 Ga0207663_10053001
682 Ga0207663_10161182
683 Ga0207663_10170232
684 Ga0207660_10205885
685 Ga0207657_10035581
686 Ga0207652_10018220
687 Ga0207694_10155401
688 Ga0207694_10184587
689 Ga0207659_10175202
690 Ga0207659_10643771
691 Ga0207687_10060600
692 Ga0207664_10025181
693 Ga0207664_10039614
694 Ga0207644_10007589
695 Ga0207706_10009732
696 Ga0207686_10102853
697 Ga0207669_10084551
698 Ga0207711_10214164
699 Ga0207689_10721643
700 Ga0207667_10149652
701 Ga0207667_10602655
702 Ga0207651_10067000
703 Ga0207712_10031556
704 Ga0207640_10133241
705 Ga0207658_10160460
706 Ga0207678_10021192
707 Ga0207678_10021441
708 Ga0207678_10262635
709 Ga0207676_10126913
710 Ga0207674_10279119
711 Ga0207683_10050440
712 Ga0207683_10338002
713 Ga0268266_10478079
714 Ga0268266_10869257
715 Ga0265337_1001493
716 Ga0265338_10017281
717 Ga0265330_10069879
718 Ga0265325_10022838
719 Ga0265325_10043030
720 Ga0265340_10020486
721 Ga0265331_10174776
722 Ga0265316_10078554
723 Ga0265316_10181305
724 Ga0265316_10627074
725 Ga0265313_10000513
726 Ga0265313_10001570
727 Ga0265313_10008665
728 Ga0265313_10012327
729 Ga0316579_10022141
730 Ga0265314_10000771
731 Ga0265314_10007590
732 Ga0307405_10987218
733 Ga0307413_10126431
734 Ga0307413_10200169
735 Ga0307407_10245837
736 Ga0307407_10514003
737 Ga0307409_100068917
738 Ga0373930_0011268
739 Ga0373950_0008438
740 Ga0373958_0002453
741 Ga0373938_0000453
742 Ga0373926_0013097
743 Ga0373934_0033608
744 Ga0373944_0032533
745 Ga0373951_0015860
746 Ga0373952_0138559
747 Ga0373923_0000792
748 Ga0373936_0001246
749 Ga0373936_0125776
750 Ga0373945_0020052
751 Ga0373953_0017642
752 Ga0373954_0009128
753 Ga0373954_0016323
754 Ga0373954_0025519
755 Ga0373956_0009309
756 Ga0373956_0075068
757 Ga0373957_0164136
758 Ga0373960_0012957
759 Ga0373943_0007158
760 Ga0373946_0001845
761 Ga0373955_0008402
762 Ga0373955_0016631
763 Ga0373942_0048570
764 Ga0373962_0002352
765 Ga0373924_0004724
766 Ga0373924_0023311
767 Ga0373924_0123129
768 Ga0373924_0156503
769 Ga0373931_0010698
770 Ga0373931_0321215
771 Ga0373935_0003876
772 Ga0373935_0005968
773 Ga0373935_0181526
774 Ga0373935_0271627
775 Ga0373927_0004839
776 Ga0373933_0004411
777 Ga0373947_0126534
778 Ga0373947_0188464
779 Ga0373937_0002145
780 Ga0373937_0006979
781 Ga0373937_0030415
782 Ga0373937_0080020
783 Ga0373937_0144865
784 Ga0316582_0117604
785 Ga0373925_0008524
786 Ga0373925_0023646
787 Ga0436365_1873778
788 Ga0436365_1904201
789 Ga0436362_0723276
790 Ga0495592_0006856
791 Ga0495592_0041995
792 Ga0495603_0062839
793 Ga0495629_0001240
794 Ga0495629_0075992
795 Ga0495629_0738330
796 Ga0495641_0021394
797 Ga0495641_0212811
798 Ga0495651_0006317
799 Ga0495651_0029605
800 Ga0495651_0287778
801 Ga0495653_0010825
802 Ga0495580_0015940
803 Ga0495580_0367938
804 Ga0495580_0519527
805 Ga0495582_0003108
806 Ga0495582_0324694
807 Ga0495639_0004976
808 Ga0495662_0019363
809 Ga0495662_0223913
810 Ga0495664_0028098
811 Ga0495594_0010943
812 Ga0495594_0144572
813 Ga0495608_0001415
814 Ga0495608_0176849
815 Ga0495618_0017306
816 Ga0495618_0038370
817 Ga0495618_0306343
818 Ga0495628_0023939
819 Ga0495630_0007589
820 Ga0495630_0119338
821 Ga0495630_0395837
822 Ga0495644_0034753
823 Ga0495666_0001193
824 Ga0495652_0042527
825 Ga0495665_0009870
826 Ga0495665_0064381
827 Ga0495665_0408723
828 Ga0495640_0034312
829 Ga0495640_0077035
830 Ga0495640_0291231
831 Ga0495586_0035461
832 Ga0495587_0004603
833 Ga0495645_0052308
834 Ga0495645_0060598
835 Ga0495622_0004018
836 Ga0495667_0001645
837 Ga0495667_0020703
838 Ga0495667_0037944
839 Ga0495634_0097536
840 Ga0495634_0104450
841 Ga0495635_0022810
842 Ga0495635_0024338
843 Ga0495635_0032827
844 Ga0495635_0072161
845 Ga0495635_0191074
846 Ga0495588_0024562
847 Ga0495588_0512354
848 Ga0495657_0142120
849 Ga0495599_0013019
850 Ga0495623_0000629
851 Ga0495646_0004584
852 Ga0495646_0012772
853 Ga0495647_0000801
854 Ga0495647_0005629
855 Ga0495658_0000745
856 Ga0495658_0002290
857 Ga0495658_0215811
858 Ga0495613_0042153
859 Ga0495613_0152323
860 Ga0495624_0038700
861 Ga0495600_0004235
862 Ga0495600_0067886
863 Ga0495600_0082507
864 Ga0495581_0050728
865 Ga0495581_0153046
866 Ga0495581_0206366
867 Ga0495604_0008684
868 Ga0495604_0026165
869 Ga0495636_0605883
870 Ga0495674_0019562
871 Ga0495674_0020681
872 Ga0495674_0074689
873 Ga0495674_0495180
874 Ga0495676_0068957
875 Ga0495680_0005762
876 Ga0495680_0010131
877 Ga0495680_0020742
878 Ga0495680_0041210
879 Ga0495680_0179768
880 Ga0495675_0002358
881 Ga0495684_0070444
882 Ga0495684_0552712
883 Ga0495593_0005464
884 Ga0495593_0055496
885 Ga0495593_0163950
886 Ga0495602_0028395
887 Ga0495614_0018217
888 Ga0496100_0057851
889 Ga0496101_0066666
890 Ga0496101_0201599
891 Ga0496102_0058075
892 Ga0496102_0069032
893 Ga0496102_0129217
894 Ga0496102_0195065
895 Ga0496103_0039901
896 Ga0496103_0054128
897 Ga0496104_0011174
898 Ga0496104_0083240
899 Ga0496105_0013053
900 Ga0496105_0072838
901 Ga0496106_0059439
902 Ga0496106_0138323
903 Ga0496107_0005300
904 Ga0496107_0109787
905 Ga0496107_0183595
906 Ga0496108_0087953
907 Ga0496109_0051612
908 Ga0496109_0105642
909 Ga0496110_0268213
910 Ga0496111_0029169
911 Ga0496111_0384198
912 Ga0496112_0102788
913 Ga0496112_0422927
914 Ga0496113_0064033
915 Ga0496114_0029554
916 Ga0496115_0062175
917 Ga0496115_0170415
918 Ga0496115_0408254
919 Ga0501031_0005435
920 Ga0501031_0052292
921 Ga0501031_0094304
922 Ga0501031_0101815
923 Ga0501031_0217338
924 Ga0501032_0017735
925 Ga0501032_0031486
926 Ga0501032_0049318
927 Ga0501032_0175839
928 Ga0501033_0028789
929 Ga0501033_0040575
930 Ga0501033_0052369
931 Ga0501033_0193383
932 Ga0501034_0000197
933 Ga0501034_0001247
934 Ga0501034_0019479
935 Ga0501034_0025868
936 Ga0501034_0030864
937 Ga0501034_0078135
938 Ga0501034_0167764
939 Ga0501034_0223572
940 Ga0501034_0252054
941 Ga0501036_0017189
942 Ga0501036_0037657
943 Ga0501036_0039959
944 Ga0501036_0078588
945 Ga0501036_0103529
946 Ga0501036_0547638
947 Ga0501037_0006086
948 Ga0501037_0017837
949 Ga0501037_0018838
950 Ga0501037_0032508
951 Ga0501037_0053118
952 Ga0501037_0246408
953 Ga0501037_0250078
954 Ga0501038_0007936
955 Ga0501038_0037665
956 Ga0501038_0309106
957 Ga0501038_0556636
958 Ga0501038_0802126
959 Ga0501039_0034420
960 Ga0501039_0074878
961 Ga0501039_0182216
962 Ga0501040_0028195
963 Ga0501042_0397030
964 Ga0501043_0006548
965 Ga0501043_0006622
966 Ga0501043_0022318
967 Ga0501043_0169887
968 Ga0501043_0179812
969 Ga0501043_0254304
970 Ga0501043_0583779
971 Ga0501046_0009112
972 Ga0501046_0074207
973 Ga0501046_0430040
974 Ga0501047_0000186
975 Ga0501047_0011383
976 Ga0501047_0014304
977 Ga0501047_0016856
978 Ga0501047_0055362
979 Ga0501047_0155664
980 Ga0501047_1104725
981 Ga0501048_0000856
982 Ga0501048_0102084
983 Ga0501048_0292425
984 Ga0501067_0009025
985 Ga0501068_0020312
986 Ga0501068_0118586
987 Ga0501068_0151686
988 Ga0501068_0162116
989 Ga0501069_0054962
990 Ga0501069_0086970
991 Ga0501069_0126380
992 Ga0501069_0140073
993 Ga0501069_0203186
994 Ga0501069_0334289
995 Ga0501070_0002665
996 Ga0501070_0008996
997 Ga0501070_0009868
998 Ga0501070_0021109
999 Ga0501070_0039121
1000 Ga0501070_0051850
1001 Ga0501070_0060750
1002 Ga0501070_0081757
1003 Ga0501070_0087649
1004 Ga0501070_0124067
1005 Ga0501070_0130161
1006 Ga0501070_0330657
1007 Ga0501071_0053722
1008 Ga0501071_0084183
1009 Ga0501072_0018872
1010 Ga0501072_0053379
1011 Ga0501072_0408430
1012 Ga0501073_0010210
1013 Ga0501073_0018856
1014 Ga0501073_0023953
1015 Ga0501073_0059716
1016 Ga0501073_0275365
1017 Ga0501074_0013074
1018 Ga0501074_0016442
1019 Ga0501074_0369504
1020 Ga0501074_0657173
1021 Ga0501076_0094064
1022 Ga0501077_0034959
1023 Ga0501079_0003839
1024 Ga0501079_0046620
1025 Ga0501079_0114331
1026 Ga0501079_0135781
1027 Ga0501080_0000299
1028 Ga0501080_0005257
1029 Ga0501080_0215515
1030 Ga0501080_0463802
1031 Ga0501080_0994922
1032 Ga0501081_0676359
1033 Ga0501083_0000302
1034 Ga0501083_0035371
1035 Ga0501083_0076374
1036 Ga0501083_0114001
1037 Ga0501083_0135852
1038 Ga0501083_0158502
1039 Ga0501083_0189665
1040 Ga0501083_0251567
1041 Ga0501083_0298049
1042 Ga0501035_0004131
1043 Ga0501035_0021633
1044 Ga0501035_0272475
1045 Ga0501035_0517569
1046 Ga0501044_0061489
1047 Ga0501044_0098202
1048 Ga0501044_0113041
1049 Ga0501044_0118843
1050 Ga0501044_0154510
1051 Ga0501044_0204011
1052 Ga0501044_0206202
1053 Ga0501044_0403304
1054 Ga0501044_0635793
1055 nmdc:mga07m45_168883_c1
1056 nmdc:mga05p37_56283_c1
1057 nmdc:mga06r32_58819_c1
1058 nmdc:mga08y16_540223_c1
1059 nmdc:mga08y16_68893_c1
1060 nmdc:mga0n895_253279_c1
1061 nmdc:mga0n895_351949_c1
1062 nmdc:mga0n895_357234_c1
1063 nmdc:mga0n895_530184_c1
1064 nmdc:mga0rr50_265676_c1
1065 nmdc:mga0rr50_30813_c1
1066 nmdc:mga0rr50_51956_c1
1067 nmdc:mga08x19_237006_c1
1068 nmdc:mga08x19_331995_c1
1069 nmdc:mga08x19_62852_c1
1070 nmdc:mga0a205_1362560_c1
1071 nmdc:mga0a205_422148_c1
1072 nmdc:mga0a205_52693_c1
1073 Ga0495601_0000352
1074 Ga0495601_0008676
1075 Ga0495601_0010571
1076 Ga0495601_0049828
1077 Ga0495601_0335629
1078 Ga0495601_0754276
1079 Ga0495612_0003841
1080 Ga0495612_0004226
1081 Ga0495612_0013588
1082 Ga0495612_0026130
1083 Ga0495612_0053461
1084 Ga0495595_0000405
1085 Ga0495595_0001531
1086 Ga0495595_0010289
1087 Ga0495619_0000085
1088 Ga0495619_0000536
1089 Ga0495619_0008387
1090 Ga0495619_0011351
1091 Ga0495619_0023812
1092 Ga0500643_012236
1093 Ga0500644_0000795
1094 Ga0500651_0017592
1095 Ga0500651_0158036
1096 Ga0500566_0189429
1097 Ga0500572_225925
1098 Ga0500595_000024
1099 Ga0500618_087126
1100 Ga0500652_005339
1101 Ga0500568_0181928
1102 Ga0500616_0000458
1103 Ga0500657_115272
1104 Ga0500645_000102
1105 Ga0501084_0103814
1106 Ga0501084_0450776
1107 Ga0501084_0651934
1108 Ga0501082_0035245
1109 Ga0501082_0134633
1110 Ga0501082_0281198
1111 Ga0501082_0337391
1112 Ga0501082_0792317
1113 Ga0530510_0693696
1114 2643755224

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00186

DHFR_1

Dihydrofolate reductase

6

115

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
6xg4-assembly1.cif.gz_A x-ray structure of escherichia coli dihydrofolate reductase l28r mutant in complex with trimethoprim 0.9759 8 172
7mym-assembly1.cif.gz_A crystal structure of escherichia coli dihydrofolate reductase in complex with trimethoprim and nadph 0.9698 8 171
3ql0-assembly1.cif.gz_A crystal structure of n23pp/s148a mutant of e. coli dihydrofolate reductase 0.9656 8 172
4qi9-assembly2.cif.gz_B crystal structure of dihydrofolate reductase from yersinia pestis complexed with methotrexate 0.9656 6 172
3ia4-assembly3.cif.gz_C moritella profunda dihydrofolate reductase (dhfr) in complex with nadph and methotrexate (mtx) 0.9647 6 172
ID Description Score Start End Superfamily
4or7A00 Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A 0.973 8 172 3.40.430.10
3fl9F00 Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A 0.9492 6 172 3.40.430.10
3tqaA00 Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A 0.9433 6 171 3.40.430.10
3tqaA00 Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A 0.9375 6 171 3.40.430.10
4fghA00 Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A 0.9345 6 172 3.40.430.10
ID Description Score Start End GO Terms
AF-A0A7S8C7J3-F1-model_v4 Dihydrofolate reductase (EC 1.5.1.3) 0.9908 6 172 GO:0004146
GO:0005829
GO:0006730
GO:0046452
GO:0046654
GO:0046655
GO:0050661
AF-A0A2P7BHF9-F1-model_v4 Dihydrofolate reductase (EC 1.5.1.3) 0.9886 8 172 GO:0004146
GO:0005829
GO:0006730
GO:0016301
GO:0046452
GO:0046654
GO:0046655
GO:0050661
AF-A0A537VHJ7-F1-model_v4 Dihydrofolate reductase (EC 1.5.1.3) 0.9864 6 172 GO:0004146
GO:0005829
GO:0006730
GO:0046452
GO:0046654
GO:0046655
GO:0050661
AF-A0A839AFR1-F1-model_v4 dihydrofolate reductase (EC 1.5.1.3) 0.9829 2 172 GO:0004146
GO:0005829
GO:0046452
GO:0046654
GO:0046655
GO:0050661
AF-A0A1E3W4D6-F1-model_v4 Dihydrofolate reductase (EC 1.5.1.3) 0.9812 14 172 GO:0004146
GO:0005829
GO:0006730
GO:0046452
GO:0046654
GO:0046655
GO:0050661

Map