F463318

General Info

Members Datasets Scaffolds Average Seq Length
557 334 1114 224

Family's Representative Sequence

Representative Sequence 3300021377|Ga0213874_10061507|Ga0213874_100615072
Length 233
Sequence MSRPADVWAVVPVKETEGAKQRLAPVLSAPLRQRLALAMLEDVLEAIAGVAGLGGILLVTIDSSAIALARRYGAVTLAEGARDGHTGAVNAGARHLIEQDRRTMLTLPGDLPLADTGEIERLIAAHGIAPAFTIAPAHDDLGSNAIVMSPPLAVPLRFGDDSFFPHLAGSRAAGIEPCVVRLPGLAFDIDNPQDLEHFLRLETATCAGRLIREYADEISKMAARSSGRGEEVG

Samples

Sample ID Description Type Environment
1 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
2 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
3 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
4 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
5 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
14 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
15 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
16 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
17 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
18 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
19 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
20 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
21 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
22 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
23 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
24 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
25 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
26 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
27 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
28 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
29 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
30 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
31 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
32 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
33 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
34 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
35 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
36 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
37 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
38 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
39 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
40 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
41 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
42 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
43 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
44 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
45 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
46 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
47 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
48 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
49 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
50 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
51 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
52 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
53 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
54 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
55 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
56 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
57 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
58 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
59 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
60 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
61 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
62 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
63 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
64 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
65 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
66 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
67 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
68 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
69 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
70 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
71 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
72 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
73 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
74 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
75 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
76 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
77 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
78 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
79 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
80 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
81 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
82 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
83 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
84 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
85 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
86 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
87 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
88 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
89 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
90 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
91 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
92 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
93 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
94 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
95 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
96 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
97 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
98 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
99 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
150 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
154 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
155 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
156 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
157 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
158 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
159 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
160 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
161 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
162 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
163 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
164 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
165 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
166 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
167 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
168 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
169 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
170 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
171 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
172 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
173 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
174 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
175 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
176 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
177 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
178 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
179 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
180 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
181 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
182 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
183 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
184 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
185 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
186 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
187 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
188 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
189 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
190 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
191 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
192 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
193 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
194 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
195 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
196 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
197 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
198 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
199 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
200 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
201 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
202 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
203 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
204 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
205 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
206 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
207 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
208 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
209 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
210 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
211 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
212 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
213 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
214 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
215 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
216 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
217 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
218 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
219 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
220 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
221 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
222 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
223 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
224 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
225 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
226 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
227 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
228 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
229 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
230 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
231 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
232 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
233 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
234 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
235 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
236 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
237 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
238 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
239 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
240 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
241 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
242 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
243 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
244 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
245 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
246 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
247 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
248 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
249 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
250 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
251 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
252 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
253 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
254 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
255 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
256 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
257 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
258 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
259 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
260 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
261 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
262 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
263 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
264 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
265 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
266 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
267 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
268 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
269 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
270 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
271 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
272 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
273 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
274 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
275 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
276 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
277 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
278 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
279 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
280 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
281 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
282 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
283 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
284 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
285 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
286 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
287 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
288 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
289 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
290 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
291 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
292 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
293 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
294 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
295 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
296 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
297 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
298 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
299 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
300 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
301 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
302 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
303 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
304 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
305 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
306 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
307 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
308 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
309 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
310 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
311 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
312 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
313 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
314 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
315 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
316 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
317 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
318 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
319 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
320 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
321 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
322 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
323 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
324 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
325 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
326 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
327 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
328 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
329 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
330 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
331 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
332 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
333 3300053733 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere Metagenome Endosphere
334 2513237141 Bradyrhizobium sp. TV2a.2 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 99.82
Metatranscriptomes 0
Isolates 0.18

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.8
Nodule 0.18
Rhizoplane 8.8
Rhizosphere 77.38
Stem 0
Stem Tuber 0
Unclassified 6.82

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0213874_10061507 3300021377 Unclassified 1177
2 rootH2_10209492 3300003320 Bacteria 1111
3 rootH1_10221694 3300003323 Bacteria 1170
4 JGI25404J52841_10000129 3300003659 Bacteria 7895
5 JGI25404J52841_10003116 3300003659 Bacteria 3239
6 JGI25404J52841_10033569 3300003659 Unclassified 1094
7 JGI25405J52794_10015896 3300003911 Bacteria 1482
8 Ga0070676_10156810 3300005328 Bacteria 1462
9 Ga0070683_100039594 3300005329 Bacteria 4328
10 Ga0070683_100144460 3300005329 Bacteria 2254
11 Ga0070690_100177814 3300005330 Bacteria 1469
12 Ga0068869_100118212 3300005334 Bacteria 2024
13 Ga0070680_100169178 3300005336 Bacteria 1838
14 Ga0070682_100320389 3300005337 Bacteria 1145
15 Ga0070682_100327011 3300005337 Bacteria 1135
16 Ga0068868_100043811 3300005338 Bacteria 3496
17 Ga0070661_100223585 3300005344 Bacteria 1445
18 Ga0070692_10371359 3300005345 Bacteria 895
19 Ga0070668_100034293 3300005347 Bacteria 3867
20 Ga0070668_100064751 3300005347 Bacteria 2834
21 Ga0070668_100084932 3300005347 Bacteria 2487
22 Ga0070668_100096091 3300005347 Bacteria 2341
23 Ga0070668_100462481 3300005347 Bacteria 1093
24 Ga0070675_100100592 3300005354 Bacteria 2434
25 Ga0070674_100001074 3300005356 Bacteria 14307
26 Ga0070674_100423663 3300005356 Unclassified 1093
27 Ga0070673_100097160 3300005364 Bacteria 2419
28 Ga0070688_100075031 3300005365 Bacteria 2173
29 Ga0070659_100092443 3300005366 Bacteria 2426
30 Ga0070667_100446451 3300005367 Bacteria 1181
31 Ga0070709_10012473 3300005434 Bacteria 4757
32 Ga0070709_10242179 3300005434 Bacteria 1295
33 Ga0070709_10247116 3300005434 Bacteria 1284
34 Ga0070714_100074099 3300005435 Unclassified 2951
35 Ga0070713_100317270 3300005436 Bacteria 1438
36 Ga0070713_100822533 3300005436 Unclassified 891
37 Ga0070710_10082783 3300005437 Bacteria 1877
38 Ga0070711_100162687 3300005439 Bacteria 1693
39 Ga0070711_100165910 3300005439 Bacteria 1679
40 Ga0070711_100343366 3300005439 Bacteria 1198
41 Ga0070700_100172673 3300005441 Bacteria 1498
42 Ga0070663_100334539 3300005455 Bacteria 1221
43 Ga0070678_100023040 3300005456 Bacteria 4141
44 Ga0070678_100132324 3300005456 Bacteria 1984
45 Ga0070678_100247816 3300005456 Bacteria 1492
46 Ga0070662_100088509 3300005457 Bacteria 2321
47 Ga0070681_10149771 3300005458 Bacteria 2260
48 Ga0070681_10303286 3300005458 Bacteria 1506
49 Ga0068867_100120302 3300005459 Bacteria 2029
50 Ga0070698_100007463 3300005471 Bacteria 11829
51 Ga0070698_100113312 3300005471 Bacteria 2677
52 Ga0070679_100051285 3300005530 Bacteria 4109
53 Ga0070679_100072374 3300005530 Bacteria 3439
54 Ga0070679_100114051 3300005530 Bacteria 2688
55 Ga0070679_100342186 3300005530 Bacteria 1444
56 Ga0070684_100000839 3300005535 Bacteria 21616
57 Ga0070684_100023583 3300005535 Bacteria 5150
58 Ga0070684_100449760 3300005535 Bacteria 1191
59 Ga0068853_100050168 3300005539 Bacteria 3589
60 Ga0068853_100447468 3300005539 Bacteria 1215
61 Ga0068853_100967880 3300005539 Bacteria 819
62 Ga0070686_100395200 3300005544 Bacteria 1050
63 Ga0070696_100202789 3300005546 Bacteria 1481
64 Ga0070693_100061464 3300005547 Bacteria 2184
65 Ga0070665_100047542 3300005548 Bacteria 4306
66 Ga0070665_100278810 3300005548 Bacteria 1673
67 Ga0070665_100405988 3300005548 Bacteria 1370
68 Ga0070704_100091219 3300005549 Bacteria 2271
69 Ga0070704_100816395 3300005549 Unclassified 834
70 Ga0068855_100127027 3300005563 Bacteria 2915
71 Ga0068855_100347720 3300005563 Bacteria 1634
72 Ga0070664_100506015 3300005564 Unclassified 1114
73 Ga0068857_100530859 3300005577 Bacteria 1107
74 Ga0068854_100155142 3300005578 Bacteria 1769
75 Ga0068856_100268496 3300005614 Bacteria 1722
76 Ga0068856_100932219 3300005614 Unclassified 887
77 Ga0070702_100205262 3300005615 Bacteria 1307
78 Ga0068852_100137965 3300005616 Bacteria 2253
79 Ga0068852_100429934 3300005616 Bacteria 1304
80 Ga0068852_100691111 3300005616 Unclassified 1030
81 Ga0068866_10023360 3300005718 Bacteria 2875
82 Ga0068866_10174154 3300005718 Bacteria 1266
83 Ga0068861_100061301 3300005719 Bacteria 2886
84 Ga0068861_100356025 3300005719 Bacteria 1286
85 Ga0068870_10332884 3300005840 Bacteria 969
86 Ga0068863_100130151 3300005841 Bacteria 2402
87 Ga0068858_100038408 3300005842 Bacteria 4440
88 Ga0068860_100083856 3300005843 Bacteria 3032
89 Ga0068860_100160916 3300005843 Bacteria 2164
90 Ga0068862_100027819 3300005844 Bacteria 4762
91 Ga0068862_100067529 3300005844 Bacteria 3082
92 Ga0068862_100280653 3300005844 Unclassified 1526
93 Ga0081455_10000911 3300005937 Bacteria 37905
94 Ga0081455_10002979 3300005937 Bacteria 19784
95 Ga0081455_10082882 3300005937 Bacteria 2622
96 Ga0081538_10115434 3300005981 Bacteria 1305
97 Ga0081540_1000370 3300005983 Bacteria 45002
98 Ga0081540_1009351 3300005983 Bacteria 6760
99 Ga0081540_1010161 3300005983 Bacteria 6402
100 Ga0081540_1011750 3300005983 Bacteria 5825
101 Ga0081540_1012027 3300005983 Bacteria 5731
102 Ga0081540_1012598 3300005983 Bacteria 5552
103 Ga0081539_10002318 3300005985 Bacteria 27421
104 Ga0081539_10007392 3300005985 Bacteria 10042
105 Ga0070717_10011063 3300006028 Bacteria 6836
106 Ga0075365_10094624 3300006038 Bacteria 2039
107 Ga0075365_10125519 3300006038 Bacteria 1773
108 Ga0075365_10212810 3300006038 Bacteria 1355
109 Ga0075368_10121308 3300006042 Bacteria 1083
110 Ga0070715_10166905 3300006163 Bacteria 1093
111 Ga0070712_100067138 3300006175 Bacteria 2551
112 Ga0070712_100069514 3300006175 Bacteria 2512
113 Ga0070712_100391927 3300006175 Bacteria 1145
114 Ga0075362_10021534 3300006177 Bacteria 2706
115 Ga0075362_10035762 3300006177 Bacteria 2170
116 Ga0075367_10002181 3300006178 Bacteria 8816
117 Ga0075367_10032062 3300006178 Bacteria 3020
118 Ga0075367_10107203 3300006178 Bacteria 1712
119 Ga0075367_10186256 3300006178 Bacteria 1295
120 Ga0075367_10446443 3300006178 Bacteria 819
121 Ga0075369_10001265 3300006186 Bacteria 8610
122 Ga0075369_10187182 3300006186 Unclassified 953
123 Ga0075369_10202253 3300006186 Bacteria 917
124 Ga0097621_100451860 3300006237 Bacteria 1158
125 Ga0075434_100687755 3300006871 Bacteria 1041
126 Ga0068865_100598394 3300006881 Bacteria 932
127 Ga0099794_10183673 3300007265 Bacteria 1068
128 Ga0105251_10227435 3300009011 Bacteria 840
129 Ga0105240_10362234 3300009093 Unclassified 1642
130 Ga0105245_10032716 3300009098 Bacteria 4604
131 Ga0105245_10270199 3300009098 Bacteria 1658
132 Ga0105247_10319069 3300009101 Unclassified 1083
133 Ga0114129_10895513 3300009147 Bacteria 1125
134 Ga0105243_10074552 3300009148 Bacteria 2752
135 Ga0105243_10667459 3300009148 Bacteria 1009
136 Ga0105241_10151336 3300009174 Bacteria 1898
137 Ga0105241_10613545 3300009174 Bacteria 984
138 Ga0105241_10979834 3300009174 Bacteria 790
139 Ga0105242_10161972 3300009176 Bacteria 1959
140 Ga0105242_10364592 3300009176 Bacteria 1338
141 Ga0105242_10397475 3300009176 Bacteria 1285
142 Ga0105248_10075320 3300009177 Bacteria 3793
143 Ga0105237_10109884 3300009545 Bacteria 2749
144 Ga0105237_10659219 3300009545 Archaea 1053
145 Ga0105238_10473070 3300009551 Bacteria 1252
146 Ga0105238_10520590 3300009551 Bacteria 1192
147 Ga0105249_10061669 3300009553 Bacteria 3442
148 Ga0099796_10001277 3300010159 Bacteria 4960
149 Ga0099796_10079495 3300010159 Bacteria 1199
150 Ga0105239_10043872 3300010375 Bacteria 4903
151 Ga0105239_10065802 3300010375 Bacteria 3982
152 Ga0105239_10209909 3300010375 Bacteria 2183
153 Ga0105239_10409657 3300010375 Bacteria 1535
154 Ga0105246_10144503 3300011119 Bacteria 1793
155 Ga0105246_10319070 3300011119 Bacteria 1262
156 Ga0157369_10010262 3300013105 Bacteria 10687
157 Ga0157374_10065328 3300013296 Bacteria 3417
158 Ga0157374_11020073 3300013296 Unclassified 847
159 Ga0157378_10298464 3300013297 Unclassified 1558
160 Ga0163162_10131244 3300013306 Bacteria 2614
161 Ga0163162_10175080 3300013306 Bacteria 2271
162 Ga0163162_10318066 3300013306 Bacteria 1689
163 Ga0157375_10295831 3300013308 Bacteria 1782
164 Ga0157375_10544893 3300013308 Bacteria 1322
165 Ga0157375_10880202 3300013308 Bacteria 1041
166 Ga0163163_10113634 3300014325 Bacteria 2738
167 Ga0163163_10197863 3300014325 Bacteria 2058
168 Ga0163163_10352373 3300014325 Bacteria 1528
169 Ga0157377_10568758 3300014745 Bacteria 803
170 Ga0157377_10627811 3300014745 Bacteria 770
171 Ga0157379_10549068 3300014968 Bacteria 1075
172 Ga0157379_10565722 3300014968 Bacteria 1059
173 Ga0157376_10321605 3300014969 Bacteria 1471
174 Ga0157376_10395491 3300014969 Bacteria 1335
175 Ga0157376_10405073 3300014969 Bacteria 1320
176 Ga0157376_10726633 3300014969 Unclassified 1000
177 Ga0163161_10152082 3300017792 Bacteria 1759
178 Ga0213874_10021575 3300021377 Bacteria 1778
179 Ga0213876_10004287 3300021384 Bacteria 7996
180 Ga0213875_10059396 3300021388 Bacteria 1790
181 Ga0207682_10041068 3300025893 Bacteria 1887
182 Ga0207642_10079243 3300025899 Bacteria 1590
183 Ga0207642_10149799 3300025899 Bacteria 1240
184 Ga0207688_10015017 3300025901 Bacteria 4202
185 Ga0207680_10112823 3300025903 Bacteria 1766
186 Ga0207685_10123189 3300025905 Bacteria 1141
187 Ga0207699_10006278 3300025906 Bacteria 5742
188 Ga0207699_10351440 3300025906 Unclassified 1041
189 Ga0207645_10043937 3300025907 Bacteria 2860
190 Ga0207654_10038280 3300025911 Bacteria 2690
191 Ga0207707_10028717 3300025912 Bacteria 4860
192 Ga0207707_10050108 3300025912 Bacteria 3638
193 Ga0207671_10116230 3300025914 Bacteria 2040
194 Ga0207671_10257427 3300025914 Bacteria 1373
195 Ga0207671_10343309 3300025914 Unclassified 1183
196 Ga0207693_10128745 3300025915 Bacteria 1990
197 Ga0207663_10059242 3300025916 Bacteria 2421
198 Ga0207663_10160433 3300025916 Unclassified 1587
199 Ga0207660_10107741 3300025917 Bacteria 2091
200 Ga0207662_10020281 3300025918 Bacteria 3791
201 Ga0207649_10148513 3300025920 Bacteria 1612
202 Ga0207652_10020947 3300025921 Bacteria 5391
203 Ga0207652_10087306 3300025921 Bacteria 2735
204 Ga0207652_10087462 3300025921 Bacteria 2733
205 Ga0207652_10437033 3300025921 Bacteria 1180
206 Ga0207646_10228287 3300025922 Bacteria 1682
207 Ga0207694_10214291 3300025924 Unclassified 1569
208 Ga0207694_10287060 3300025924 Bacteria 1353
209 Ga0207694_10335457 3300025924 Bacteria 1250
210 Ga0207650_10399923 3300025925 Bacteria 1137
211 Ga0207659_10608170 3300025926 Bacteria 932
212 Ga0207700_10088720 3300025928 Bacteria 2435
213 Ga0207700_10698122 3300025928 Unclassified 906
214 Ga0207664_10015531 3300025929 Bacteria 5530
215 Ga0207664_10643740 3300025929 Unclassified 953
216 Ga0207706_10084472 3300025933 Bacteria 2791
217 Ga0207706_10122179 3300025933 Bacteria 2290
218 Ga0207706_10430518 3300025933 Bacteria 1143
219 Ga0207686_10139033 3300025934 Bacteria 1676
220 Ga0207686_10586673 3300025934 Unclassified 875
221 Ga0207709_10053135 3300025935 Bacteria 2492
222 Ga0207669_10003139 3300025937 Bacteria 7124
223 Ga0207665_10090911 3300025939 Bacteria 2116
224 Ga0207665_10334453 3300025939 Bacteria 1140
225 Ga0207665_10369632 3300025939 Bacteria 1086
226 Ga0207691_10162164 3300025940 Bacteria 1961
227 Ga0207711_10162377 3300025941 Bacteria 2023
228 Ga0207689_10240735 3300025942 Bacteria 1496
229 Ga0207661_10005104 3300025944 Bacteria 9216
230 Ga0207661_10086284 3300025944 Bacteria 2604
231 Ga0207679_10208329 3300025945 Bacteria 1638
232 Ga0207667_10297202 3300025949 Bacteria 1650
233 Ga0207667_10478586 3300025949 Bacteria 1264
234 Ga0207651_10483021 3300025960 Bacteria 1068
235 Ga0207712_10074010 3300025961 Bacteria 2459
236 Ga0207668_10015172 3300025972 Bacteria 4782
237 Ga0207668_10202383 3300025972 Bacteria 1582
238 Ga0207668_10249586 3300025972 Bacteria 1440
239 Ga0207668_10253466 3300025972 Bacteria 1430
240 Ga0207658_10054043 3300025986 Bacteria 2970
241 Ga0207677_10036971 3300026023 Bacteria 3187
242 Ga0207703_10092970 3300026035 Bacteria 2540
243 Ga0207639_10448573 3300026041 Bacteria 1171
244 Ga0207639_10498610 3300026041 Bacteria 1112
245 Ga0207678_10420812 3300026067 Bacteria 1158
246 Ga0207702_10455827 3300026078 Bacteria 1241
247 Ga0207641_10100760 3300026088 Bacteria 2544
248 Ga0207648_10038765 3300026089 Bacteria 4192
249 Ga0207676_10500181 3300026095 Bacteria 1154
250 Ga0207674_10163206 3300026116 Bacteria 2182
251 Ga0207675_100037354 3300026118 Bacteria 4530
252 Ga0207675_100105068 3300026118 Bacteria 2661
253 Ga0207675_100475223 3300026118 Bacteria 1241
254 Ga0207683_10073441 3300026121 Bacteria 3026
255 Ga0207683_10117991 3300026121 Bacteria 2380
256 Ga0207683_10590797 3300026121 Bacteria 1027
257 Ga0207698_10188642 3300026142 Bacteria 1834
258 Ga0207698_10306193 3300026142 Bacteria 1481
259 Ga0207698_10850637 3300026142 Bacteria 917
260 Ga0209179_1004425 3300027512 Bacteria 2119
261 Ga0209813_10045722 3300027866 Unclassified 1349
262 Ga0209813_10134862 3300027866 Bacteria 871
263 Ga0268266_10237852 3300028379 Bacteria 1679
264 Ga0268266_10246177 3300028379 Bacteria 1652
265 Ga0268265_10038088 3300028380 Bacteria 3534
266 Ga0268265_10135546 3300028380 Bacteria 2053
267 Ga0268264_10013299 3300028381 Bacteria 6777
268 Ga0268264_10091165 3300028381 Bacteria 2629
269 Ga0268264_10291064 3300028381 Bacteria 1534
270 Ga0265325_10095584 3300031241 Bacteria 1460
271 Ga0307513_10044623 3300031456 Bacteria 4854
272 Ga0307509_10049341 3300031507 Bacteria 4513
273 Ga0307508_10000235 3300031616 Bacteria 67350
274 Ga0307516_10096708 3300031730 Bacteria 2773
275 Ga0307405_10111851 3300031731 Bacteria 1852
276 Ga0307405_10410004 3300031731 Bacteria 1063
277 Ga0307413_10284123 3300031824 Bacteria 1246
278 Ga0307413_10496860 3300031824 Bacteria 979
279 Ga0307412_10545511 3300031911 Bacteria 973
280 Ga0307416_100208377 3300032002 Bacteria 1862
281 Ga0307415_100021681 3300032126 Bacteria 3954
282 Ga0307415_100090057 3300032126 Bacteria 2218
283 Ga0307510_10002894 3300033180 Bacteria 19752
284 Ga0373926_0057759 3300035083 Bacteria 1410
285 Ga0373928_0012018 3300035084 Bacteria 1722
286 Ga0373940_0029611 3300035088 Bacteria 1451
287 Ga0373944_0033745 3300035089 Bacteria 1552
288 Ga0373936_0073942 3300035113 Unclassified 1409
289 Ga0373936_0173529 3300035113 Bacteria 943
290 Ga0373945_0032145 3300035116 Bacteria 1858
291 Ga0373954_0013447 3300035118 Bacteria 3647
292 Ga0373943_0004903 3300035170 Bacteria 6045
293 Ga0373946_0136758 3300035171 Bacteria 1132
294 Ga0373946_0154367 3300035171 Unclassified 1073
295 Ga0373955_0051431 3300035172 Bacteria 2244
296 Ga0373924_0125255 3300035410 Bacteria 1116
297 Ga0373931_0000538 3300035691 Bacteria 15536
298 Ga0373931_0142942 3300035691 Bacteria 1388
299 Ga0373931_0183782 3300035691 Bacteria 1240
300 Ga0373931_0527167 3300035691 Bacteria 765
301 Ga0373935_0222611 3300035692 Bacteria 1311
302 Ga0373935_0255891 3300035692 Bacteria 1226
303 Ga0373927_0194664 3300035695 Bacteria 1330
304 Ga0373927_0199527 3300035695 Unclassified 1313
305 Ga0373933_0166003 3300035724 Bacteria 1403
306 Ga0373947_0019606 3300035725 Bacteria 3900
307 Ga0373947_0408854 3300035725 Bacteria 916
308 Ga0373937_0225676 3300036401 Bacteria 1763
309 Ga0373925_0046357 3300037068 Bacteria 3232
310 Ga0373925_0137059 3300037068 Bacteria 1913
311 Ga0373925_0168738 3300037068 Bacteria 1727
312 Ga0373925_0385181 3300037068 Bacteria 1142
313 Ga0395899_0216127 3300037312 Bacteria 1330
314 Ga0395900_0004655 3300037418 Bacteria 14474
315 Ga0395898_0030064 3300037466 Bacteria 5439
316 Ga0395898_0166091 3300037466 Bacteria 2111
317 Ga0436364_0587562 3300037853 Bacteria 3912
318 Ga0436364_1006126 3300037853 Bacteria 602
319 Ga0436365_1076238 3300039437 Bacteria 2385
320 Ga0436365_1868988 3300039437 Bacteria 11565
321 Ga0436360_0140826 3300039438 Bacteria 5906
322 Ga0436360_0242937 3300039438 Bacteria 2197
323 Ga0436360_1015519 3300039438 Bacteria 2176
324 Ga0436363_0080798 3300039450 Bacteria 11740
325 Ga0436363_0546119 3300039450 Bacteria 2114
326 Ga0439461_0066414 3300041410 Bacteria 828
327 Ga0439465_0007853 3300041413 Bacteria 3381
328 Ga0439465_0066357 3300041413 Bacteria 1203
329 Ga0451787_789332 3300041441 Bacteria 810
330 Ga0451793_1642900 3300041452 Unclassified 1238
331 Ga0451851_0910711 3300041507 Bacteria 778
332 Ga0466968_0117997 3300044735 Bacteria 1199
333 Ga0466970_0402496 3300044765 Bacteria 781
334 Ga0466958_0387749 3300045836 Bacteria 901
335 Ga0466967_0219368 3300045976 Bacteria 1806
336 Ga0466967_0257885 3300045976 Bacteria 1667
337 Ga0466967_1380276 3300045976 Bacteria 702
338 Ga0495617_026755 3300046452 Bacteria 1942
339 Ga0495592_0085496 3300046454 Bacteria 2274
340 Ga0495603_0010292 3300046455 Bacteria 5661
341 Ga0495603_0083438 3300046455 Bacteria 1871
342 Ga0495590_0252514 3300046457 Bacteria 656
343 Ga0495629_0000708 3300046459 Bacteria 27003
344 Ga0495629_0026876 3300046459 Bacteria 4087
345 Ga0495629_0207416 3300046459 Bacteria 1354
346 Ga0495629_0573206 3300046459 Bacteria 756
347 Ga0495641_0025898 3300046461 Bacteria 2872
348 Ga0495651_0434359 3300046462 Bacteria 851
349 Ga0495653_0137498 3300046463 Bacteria 1722
350 Ga0495650_0048970 3300046471 Bacteria 1757
351 Ga0495580_0067615 3300046472 Bacteria 2499
352 Ga0495582_0003136 3300046473 Bacteria 9274
353 Ga0495582_0128641 3300046473 Bacteria 1430
354 Ga0495605_0011490 3300046474 Bacteria 4931
355 Ga0495639_0002986 3300046475 Bacteria 7366
356 Ga0495639_0024043 3300046475 Bacteria 2679
357 Ga0495639_0043669 3300046475 Bacteria 2025
358 Ga0495639_0213271 3300046475 Bacteria 948
359 Ga0495662_0037222 3300046476 Bacteria 2349
360 Ga0495664_0028921 3300046477 Bacteria 3238
361 Ga0495664_0148556 3300046477 Bacteria 1421
362 Ga0495585_0063826 3300046492 Bacteria 2020
363 Ga0495594_0004174 3300046499 Bacteria 7418
364 Ga0495594_0011820 3300046499 Bacteria 4540
365 Ga0495594_0289039 3300046499 Bacteria 934
366 Ga0495596_0186587 3300046500 Unclassified 806
367 Ga0495607_0100476 3300046501 Bacteria 1550
368 Ga0495583_0126408 3300046506 Bacteria 1072
369 Ga0495606_0003152 3300046507 Bacteria 17859
370 Ga0495606_0135377 3300046507 Bacteria 1460
371 Ga0495616_0052521 3300046513 Bacteria 2029
372 Ga0495618_0033151 3300046514 Bacteria 3238
373 Ga0495620_0072571 3300046515 Bacteria 1405
374 Ga0495628_0031053 3300046516 Bacteria 4321
375 Ga0495631_0022343 3300046518 Bacteria 2941
376 Ga0495632_0031079 3300046519 Bacteria 2765
377 Ga0495637_0044589 3300046520 Bacteria 1887
378 Ga0495644_0012121 3300046523 Bacteria 3314
379 Ga0495663_0007602 3300046525 Bacteria 2999
380 Ga0495666_0024841 3300046526 Bacteria 2960
381 Ga0495642_0041365 3300046528 Bacteria 1874
382 Ga0495652_0268604 3300046529 Bacteria 1255
383 Ga0495654_0117328 3300046530 Bacteria 1208
384 Ga0495665_0002120 3300046531 Bacteria 10739
385 Ga0495665_0063963 3300046531 Bacteria 1942
386 Ga0495640_0018279 3300046533 Bacteria 5204
387 Ga0495586_0308518 3300046535 Bacteria 907
388 Ga0495587_0055673 3300046536 Bacteria 2329
389 Ga0495598_0001255 3300046537 Bacteria 4942
390 Ga0495609_0025153 3300046538 Bacteria 2730
391 Ga0495621_0003514 3300046539 Bacteria 4325
392 Ga0495597_0072370 3300046542 Bacteria 1483
393 Ga0495645_0090866 3300046543 Bacteria 2181
394 Ga0495645_0186485 3300046543 Bacteria 1417
395 Ga0495622_0023544 3300046557 Bacteria 2872
396 Ga0495633_0010280 3300046558 Bacteria 5116
397 Ga0495633_0268635 3300046558 Bacteria 777
398 Ga0495667_0469328 3300046559 Unclassified 790
399 Ga0495668_0356840 3300046616 Bacteria 802
400 Ga0495634_0006007 3300046642 Bacteria 9266
401 Ga0495634_0136470 3300046642 Bacteria 1560
402 Ga0495625_0113789 3300046660 Bacteria 1847
403 Ga0495625_0287935 3300046660 Bacteria 1055
404 Ga0495635_0004326 3300046663 Bacteria 9836
405 Ga0495635_0042637 3300046663 Bacteria 3133
406 Ga0495635_0100399 3300046663 Bacteria 1978
407 Ga0495659_0001567 3300046664 Bacteria 7690
408 Ga0495661_0054038 3300046665 Bacteria 2413
409 Ga0495588_0001004 3300046674 Bacteria 12297
410 Ga0495588_0031891 3300046674 Bacteria 2654
411 Ga0495646_0022490 3300046680 Bacteria 3977
412 Ga0495646_0187383 3300046680 Bacteria 1132
413 Ga0495647_0007563 3300046681 Bacteria 3646
414 Ga0495658_0001960 3300046683 Bacteria 10528
415 Ga0495669_0009434 3300046684 Bacteria 4114
416 Ga0495613_0022995 3300046689 Bacteria 4645
417 Ga0495624_0003274 3300046690 Bacteria 12069
418 Ga0495670_0061469 3300046691 Bacteria 1888
419 Ga0495671_0015183 3300046692 Bacteria 4134
420 Ga0495671_0123405 3300046692 Bacteria 1263
421 Ga0495649_0107378 3300046694 Bacteria 1481
422 Ga0495589_0027139 3300046794 Bacteria 2896
423 Ga0495589_0243235 3300046794 Bacteria 842
424 Ga0495581_0001031 3300047315 Bacteria 15076
425 Ga0495581_0075944 3300047315 Bacteria 1944
426 Ga0495581_0172201 3300047315 Bacteria 1266
427 Ga0495604_0261809 3300047317 Bacteria 1175
428 Ga0495636_0013525 3300047318 Bacteria 3239
429 Ga0495674_0105770 3300047319 Bacteria 2390
430 Ga0495672_0133060 3300047320 Bacteria 1306
431 Ga0495676_0012956 3300047321 Bacteria 7502
432 Ga0495676_0175627 3300047321 Bacteria 1504
433 Ga0495683_0019905 3300047323 Bacteria 3462
434 Ga0495675_0209702 3300047444 Bacteria 1183
435 Ga0495677_0005216 3300047445 Bacteria 4942
436 Ga0495679_014512 3300047446 Bacteria 2916
437 Ga0495685_008090 3300047447 Bacteria 3483
438 Ga0495681_0034369 3300047470 Bacteria 2527
439 Ga0495684_0086112 3300047471 Bacteria 2382
440 Ga0495684_0218317 3300047471 Bacteria 1399
441 Ga0495686_0147866 3300047472 Bacteria 1381
442 Ga0495593_0001063 3300047673 Bacteria 16031
443 Ga0495593_0070946 3300047673 Bacteria 1809
444 Ga0495593_0239411 3300047673 Bacteria 909
445 Ga0495602_0487235 3300048088 Bacteria 864
446 Ga0495614_0045333 3300048089 Bacteria 1886
447 Ga0495615_0014879 3300048090 Bacteria 1652
448 Ga0496100_0049950 3300048903 Bacteria 2707
449 Ga0496101_0037676 3300048904 Bacteria 3431
450 Ga0496101_0205181 3300048904 Unclassified 1525
451 Ga0496101_0331792 3300048904 Bacteria 1194
452 Ga0496102_0021159 3300048905 Bacteria 5751
453 Ga0496102_0413339 3300048905 Bacteria 1267
454 Ga0496102_0933816 3300048905 Bacteria 789
455 Ga0496104_0026760 3300048907 Bacteria 5330
456 Ga0496104_0071171 3300048907 Bacteria 3306
457 Ga0496104_0121861 3300048907 Bacteria 2504
458 Ga0496104_0347723 3300048907 Bacteria 1395
459 Ga0496105_0121020 3300048908 Bacteria 2158
460 Ga0496105_0124501 3300048908 Bacteria 2125
461 Ga0496105_0255828 3300048908 Bacteria 1418
462 Ga0496106_0020066 3300048909 Bacteria 4957
463 Ga0496106_0042726 3300048909 Bacteria 3399
464 Ga0496106_0230023 3300048909 Unclassified 1480
465 Ga0496107_0006787 3300048910 Bacteria 7882
466 Ga0496107_0098499 3300048910 Bacteria 2141
467 Ga0496107_0156040 3300048910 Bacteria 1690
468 Ga0496107_0326244 3300048910 Bacteria 1142
469 Ga0496107_0611998 3300048910 Bacteria 805
470 Ga0496108_0017896 3300048911 Bacteria 5797
471 Ga0496108_0098322 3300048911 Bacteria 2494
472 Ga0496109_0032243 3300048912 Bacteria 4709
473 Ga0496109_0049027 3300048912 Bacteria 3843
474 Ga0496109_0338479 3300048912 Bacteria 1421
475 Ga0496109_0730075 3300048912 Bacteria 928
476 Ga0496110_0296711 3300048913 Bacteria 1472
477 Ga0496110_0321092 3300048913 Unclassified 1410
478 Ga0496111_0023195 3300048914 Bacteria 4355
479 Ga0496111_0167303 3300048914 Bacteria 1633
480 Ga0496111_0338204 3300048914 Bacteria 1114
481 Ga0496112_0001395 3300048915 Bacteria 18455
482 Ga0496112_0004066 3300048915 Bacteria 12278
483 Ga0496112_0050453 3300048915 Bacteria 4080
484 Ga0496112_0081619 3300048915 Bacteria 3198
485 Ga0496112_0092387 3300048915 Bacteria 2996
486 Ga0496113_0007147 3300048916 Bacteria 7151
487 Ga0496113_0058394 3300048916 Bacteria 2902
488 Ga0496114_0048293 3300048917 Bacteria 3540
489 Ga0496114_0179683 3300048917 Bacteria 1847
490 Ga0496114_0422952 3300048917 Bacteria 1180
491 Ga0496115_0011324 3300048918 Bacteria 6684
492 Ga0496115_0027208 3300048918 Bacteria 4471
493 Ga0496115_0070637 3300048918 Bacteria 2831
494 Ga0496115_0135180 3300048918 Bacteria 2033
495 Ga0496117_0128001 3300048920 Bacteria 1546
496 Ga0496121_0018461 3300048924 Bacteria 7031
497 Ga0496121_0039856 3300048924 Bacteria 4131
498 Ga0496121_0136352 3300048924 Bacteria 1828
499 Ga0496124_0101565 3300048927 Bacteria 2330
500 Ga0496126_0110591 3300048929 Bacteria 2393
501 Ga0496126_0182598 3300048929 Bacteria 1781
502 Ga0496126_0281559 3300048929 Bacteria 1377
503 Ga0496126_0674801 3300048929 Bacteria 806
504 Ga0495678_040575 3300049459 Bacteria 1870
505 Ga0495682_0130351 3300049460 Bacteria 899
506 Ga0501046_0183971 3300049580 Unclassified 1561
507 Ga0501047_0031164 3300049581 Bacteria 5143
508 Ga0501073_0086527 3300049589 Bacteria 2180
509 Ga0501080_0201387 3300049742 Bacteria 1828
510 Ga0501080_0231113 3300049742 Bacteria 1690
511 Ga0501080_0670593 3300049742 Bacteria 916
512 Ga0501044_0086551 3300049823 Bacteria 3165
513 nmdc:mga03683_1158_c1 3300050489 Bacteria 7750
514 nmdc:mga03683_55334_c1 3300050489 Bacteria 1666
515 nmdc:mga00v17_684229_c1 3300050491 Unclassified 658
516 nmdc:mga0yw44_14309_c1 3300050492 Bacteria 4210
517 nmdc:mga0yw44_147016_c1 3300050492 Bacteria 1535
518 nmdc:mga0yw44_263842_c1 3300050492 Bacteria 1148
519 nmdc:mga0yw44_273288_c1 3300050492 Bacteria 1128
520 nmdc:mga0yw44_615370_c1 3300050492 Bacteria 738
521 nmdc:mga0k408_302902_c1 3300050493 Bacteria 954
522 nmdc:mga06z11_157772_c1 3300050494 Bacteria 1295
523 nmdc:mga06z11_37500_c1 3300050494 Bacteria 2401
524 nmdc:mga06z11_55589_c1 3300050494 Bacteria 2044
525 nmdc:mga06z11_56371_c1 3300050494 Bacteria 2032
526 nmdc:mga07m45_516826_c1 3300050496 Bacteria 691
527 nmdc:mga07m45_64271_c1 3300050496 Bacteria 2082
528 nmdc:mga0qj67_382007_c1 3300050509 Bacteria 1137
529 nmdc:mga08y16_888043_c1 3300050511 Bacteria 878
530 nmdc:mga0n895_439819_c1 3300050512 Bacteria 1317
531 nmdc:mga0n895_676530_c1 3300050512 Bacteria 1029
532 nmdc:mga0rr50_424952_c1 3300050513 Bacteria 1124
533 nmdc:mga0a205_739558_c1 3300050515 Bacteria 832
534 nmdc:mga0sz30_107160_c1 3300050516 Bacteria 1223
535 nmdc:mga0sz30_148182_c1 3300050516 Bacteria 1037
536 nmdc:mga0sz30_252412_c1 3300050516 Unclassified 785
537 nmdc:mga0sz30_792_c1 3300050516 Bacteria 11461
538 Ga0495601_0094163 3300053077 Bacteria 1930
539 Ga0495612_0077153 3300053078 Bacteria 1396
540 Ga0500635_0004117 3300053080 Bacteria 3725
541 Ga0495595_0186172 3300053084 Bacteria 1031
542 Ga0495619_0107901 3300053085 Bacteria 1900
543 Ga0495619_0126325 3300053085 Bacteria 1755
544 Ga0500578_0409419 3300053086 Bacteria 780
545 Ga0500646_0041741 3300053090 Bacteria 1294
546 Ga0500651_0043528 3300053093 Bacteria 2827
547 Ga0500651_0245818 3300053093 Bacteria 1042
548 Ga0500641_0008505 3300053096 Bacteria 3665
549 Ga0500595_017775 3300053119 Bacteria 2616
550 Ga0500658_0259474 3300053134 Bacteria 799
551 Ga0500568_0011142 3300053139 Bacteria 4188
552 Ga0500634_0107828 3300053161 Unclassified 1381
553 Ga0500638_241918 3300053162 Bacteria 733
554 Ga0500639_032707 3300053163 Bacteria 2749
555 Ga0500637_0346396 3300053178 Unclassified 792
556 Ga0500552_005003 3300053733 Bacteria 1424
557 2513888107 2513237141 Bacteria 8496279
558 Ga0213874_10061507
559 rootH2_10209492
560 rootH1_10221694
561 JGI25404J52841_10000129
562 JGI25404J52841_10003116
563 JGI25404J52841_10033569
564 JGI25405J52794_10015896
565 Ga0070676_10156810
566 Ga0070683_100039594
567 Ga0070683_100144460
568 Ga0070690_100177814
569 Ga0068869_100118212
570 Ga0070680_100169178
571 Ga0070682_100320389
572 Ga0070682_100327011
573 Ga0068868_100043811
574 Ga0070661_100223585
575 Ga0070692_10371359
576 Ga0070668_100034293
577 Ga0070668_100064751
578 Ga0070668_100084932
579 Ga0070668_100096091
580 Ga0070668_100462481
581 Ga0070675_100100592
582 Ga0070674_100001074
583 Ga0070674_100423663
584 Ga0070673_100097160
585 Ga0070688_100075031
586 Ga0070659_100092443
587 Ga0070667_100446451
588 Ga0070709_10012473
589 Ga0070709_10242179
590 Ga0070709_10247116
591 Ga0070714_100074099
592 Ga0070713_100317270
593 Ga0070713_100822533
594 Ga0070710_10082783
595 Ga0070711_100162687
596 Ga0070711_100165910
597 Ga0070711_100343366
598 Ga0070700_100172673
599 Ga0070663_100334539
600 Ga0070678_100023040
601 Ga0070678_100132324
602 Ga0070678_100247816
603 Ga0070662_100088509
604 Ga0070681_10149771
605 Ga0070681_10303286
606 Ga0068867_100120302
607 Ga0070698_100007463
608 Ga0070698_100113312
609 Ga0070679_100051285
610 Ga0070679_100072374
611 Ga0070679_100114051
612 Ga0070679_100342186
613 Ga0070684_100000839
614 Ga0070684_100023583
615 Ga0070684_100449760
616 Ga0068853_100050168
617 Ga0068853_100447468
618 Ga0068853_100967880
619 Ga0070686_100395200
620 Ga0070696_100202789
621 Ga0070693_100061464
622 Ga0070665_100047542
623 Ga0070665_100278810
624 Ga0070665_100405988
625 Ga0070704_100091219
626 Ga0070704_100816395
627 Ga0068855_100127027
628 Ga0068855_100347720
629 Ga0070664_100506015
630 Ga0068857_100530859
631 Ga0068854_100155142
632 Ga0068856_100268496
633 Ga0068856_100932219
634 Ga0070702_100205262
635 Ga0068852_100137965
636 Ga0068852_100429934
637 Ga0068852_100691111
638 Ga0068866_10023360
639 Ga0068866_10174154
640 Ga0068861_100061301
641 Ga0068861_100356025
642 Ga0068870_10332884
643 Ga0068863_100130151
644 Ga0068858_100038408
645 Ga0068860_100083856
646 Ga0068860_100160916
647 Ga0068862_100027819
648 Ga0068862_100067529
649 Ga0068862_100280653
650 Ga0081455_10000911
651 Ga0081455_10002979
652 Ga0081455_10082882
653 Ga0081538_10115434
654 Ga0081540_1000370
655 Ga0081540_1009351
656 Ga0081540_1010161
657 Ga0081540_1011750
658 Ga0081540_1012027
659 Ga0081540_1012598
660 Ga0081539_10002318
661 Ga0081539_10007392
662 Ga0070717_10011063
663 Ga0075365_10094624
664 Ga0075365_10125519
665 Ga0075365_10212810
666 Ga0075368_10121308
667 Ga0070715_10166905
668 Ga0070712_100067138
669 Ga0070712_100069514
670 Ga0070712_100391927
671 Ga0075362_10021534
672 Ga0075362_10035762
673 Ga0075367_10002181
674 Ga0075367_10032062
675 Ga0075367_10107203
676 Ga0075367_10186256
677 Ga0075367_10446443
678 Ga0075369_10001265
679 Ga0075369_10187182
680 Ga0075369_10202253
681 Ga0097621_100451860
682 Ga0075434_100687755
683 Ga0068865_100598394
684 Ga0099794_10183673
685 Ga0105251_10227435
686 Ga0105240_10362234
687 Ga0105245_10032716
688 Ga0105245_10270199
689 Ga0105247_10319069
690 Ga0114129_10895513
691 Ga0105243_10074552
692 Ga0105243_10667459
693 Ga0105241_10151336
694 Ga0105241_10613545
695 Ga0105241_10979834
696 Ga0105242_10161972
697 Ga0105242_10364592
698 Ga0105242_10397475
699 Ga0105248_10075320
700 Ga0105237_10109884
701 Ga0105237_10659219
702 Ga0105238_10473070
703 Ga0105238_10520590
704 Ga0105249_10061669
705 Ga0099796_10001277
706 Ga0099796_10079495
707 Ga0105239_10043872
708 Ga0105239_10065802
709 Ga0105239_10209909
710 Ga0105239_10409657
711 Ga0105246_10144503
712 Ga0105246_10319070
713 Ga0157369_10010262
714 Ga0157374_10065328
715 Ga0157374_11020073
716 Ga0157378_10298464
717 Ga0163162_10131244
718 Ga0163162_10175080
719 Ga0163162_10318066
720 Ga0157375_10295831
721 Ga0157375_10544893
722 Ga0157375_10880202
723 Ga0163163_10113634
724 Ga0163163_10197863
725 Ga0163163_10352373
726 Ga0157377_10568758
727 Ga0157377_10627811
728 Ga0157379_10549068
729 Ga0157379_10565722
730 Ga0157376_10321605
731 Ga0157376_10395491
732 Ga0157376_10405073
733 Ga0157376_10726633
734 Ga0163161_10152082
735 Ga0213874_10021575
736 Ga0213876_10004287
737 Ga0213875_10059396
738 Ga0207682_10041068
739 Ga0207642_10079243
740 Ga0207642_10149799
741 Ga0207688_10015017
742 Ga0207680_10112823
743 Ga0207685_10123189
744 Ga0207699_10006278
745 Ga0207699_10351440
746 Ga0207645_10043937
747 Ga0207654_10038280
748 Ga0207707_10028717
749 Ga0207707_10050108
750 Ga0207671_10116230
751 Ga0207671_10257427
752 Ga0207671_10343309
753 Ga0207693_10128745
754 Ga0207663_10059242
755 Ga0207663_10160433
756 Ga0207660_10107741
757 Ga0207662_10020281
758 Ga0207649_10148513
759 Ga0207652_10020947
760 Ga0207652_10087306
761 Ga0207652_10087462
762 Ga0207652_10437033
763 Ga0207646_10228287
764 Ga0207694_10214291
765 Ga0207694_10287060
766 Ga0207694_10335457
767 Ga0207650_10399923
768 Ga0207659_10608170
769 Ga0207700_10088720
770 Ga0207700_10698122
771 Ga0207664_10015531
772 Ga0207664_10643740
773 Ga0207706_10084472
774 Ga0207706_10122179
775 Ga0207706_10430518
776 Ga0207686_10139033
777 Ga0207686_10586673
778 Ga0207709_10053135
779 Ga0207669_10003139
780 Ga0207665_10090911
781 Ga0207665_10334453
782 Ga0207665_10369632
783 Ga0207691_10162164
784 Ga0207711_10162377
785 Ga0207689_10240735
786 Ga0207661_10005104
787 Ga0207661_10086284
788 Ga0207679_10208329
789 Ga0207667_10297202
790 Ga0207667_10478586
791 Ga0207651_10483021
792 Ga0207712_10074010
793 Ga0207668_10015172
794 Ga0207668_10202383
795 Ga0207668_10249586
796 Ga0207668_10253466
797 Ga0207658_10054043
798 Ga0207677_10036971
799 Ga0207703_10092970
800 Ga0207639_10448573
801 Ga0207639_10498610
802 Ga0207678_10420812
803 Ga0207702_10455827
804 Ga0207641_10100760
805 Ga0207648_10038765
806 Ga0207676_10500181
807 Ga0207674_10163206
808 Ga0207675_100037354
809 Ga0207675_100105068
810 Ga0207675_100475223
811 Ga0207683_10073441
812 Ga0207683_10117991
813 Ga0207683_10590797
814 Ga0207698_10188642
815 Ga0207698_10306193
816 Ga0207698_10850637
817 Ga0209179_1004425
818 Ga0209813_10045722
819 Ga0209813_10134862
820 Ga0268266_10237852
821 Ga0268266_10246177
822 Ga0268265_10038088
823 Ga0268265_10135546
824 Ga0268264_10013299
825 Ga0268264_10091165
826 Ga0268264_10291064
827 Ga0265325_10095584
828 Ga0307513_10044623
829 Ga0307509_10049341
830 Ga0307508_10000235
831 Ga0307516_10096708
832 Ga0307405_10111851
833 Ga0307405_10410004
834 Ga0307413_10284123
835 Ga0307413_10496860
836 Ga0307412_10545511
837 Ga0307416_100208377
838 Ga0307415_100021681
839 Ga0307415_100090057
840 Ga0307510_10002894
841 Ga0373926_0057759
842 Ga0373928_0012018
843 Ga0373940_0029611
844 Ga0373944_0033745
845 Ga0373936_0073942
846 Ga0373936_0173529
847 Ga0373945_0032145
848 Ga0373954_0013447
849 Ga0373943_0004903
850 Ga0373946_0136758
851 Ga0373946_0154367
852 Ga0373955_0051431
853 Ga0373924_0125255
854 Ga0373931_0000538
855 Ga0373931_0142942
856 Ga0373931_0183782
857 Ga0373931_0527167
858 Ga0373935_0222611
859 Ga0373935_0255891
860 Ga0373927_0194664
861 Ga0373927_0199527
862 Ga0373933_0166003
863 Ga0373947_0019606
864 Ga0373947_0408854
865 Ga0373937_0225676
866 Ga0373925_0046357
867 Ga0373925_0137059
868 Ga0373925_0168738
869 Ga0373925_0385181
870 Ga0395899_0216127
871 Ga0395900_0004655
872 Ga0395898_0030064
873 Ga0395898_0166091
874 Ga0436364_0587562
875 Ga0436364_1006126
876 Ga0436365_1076238
877 Ga0436365_1868988
878 Ga0436360_0140826
879 Ga0436360_0242937
880 Ga0436360_1015519
881 Ga0436363_0080798
882 Ga0436363_0546119
883 Ga0439461_0066414
884 Ga0439465_0007853
885 Ga0439465_0066357
886 Ga0451787_789332
887 Ga0451793_1642900
888 Ga0451851_0910711
889 Ga0466968_0117997
890 Ga0466970_0402496
891 Ga0466958_0387749
892 Ga0466967_0219368
893 Ga0466967_0257885
894 Ga0466967_1380276
895 Ga0495617_026755
896 Ga0495592_0085496
897 Ga0495603_0010292
898 Ga0495603_0083438
899 Ga0495590_0252514
900 Ga0495629_0000708
901 Ga0495629_0026876
902 Ga0495629_0207416
903 Ga0495629_0573206
904 Ga0495641_0025898
905 Ga0495651_0434359
906 Ga0495653_0137498
907 Ga0495650_0048970
908 Ga0495580_0067615
909 Ga0495582_0003136
910 Ga0495582_0128641
911 Ga0495605_0011490
912 Ga0495639_0002986
913 Ga0495639_0024043
914 Ga0495639_0043669
915 Ga0495639_0213271
916 Ga0495662_0037222
917 Ga0495664_0028921
918 Ga0495664_0148556
919 Ga0495585_0063826
920 Ga0495594_0004174
921 Ga0495594_0011820
922 Ga0495594_0289039
923 Ga0495596_0186587
924 Ga0495607_0100476
925 Ga0495583_0126408
926 Ga0495606_0003152
927 Ga0495606_0135377
928 Ga0495616_0052521
929 Ga0495618_0033151
930 Ga0495620_0072571
931 Ga0495628_0031053
932 Ga0495631_0022343
933 Ga0495632_0031079
934 Ga0495637_0044589
935 Ga0495644_0012121
936 Ga0495663_0007602
937 Ga0495666_0024841
938 Ga0495642_0041365
939 Ga0495652_0268604
940 Ga0495654_0117328
941 Ga0495665_0002120
942 Ga0495665_0063963
943 Ga0495640_0018279
944 Ga0495586_0308518
945 Ga0495587_0055673
946 Ga0495598_0001255
947 Ga0495609_0025153
948 Ga0495621_0003514
949 Ga0495597_0072370
950 Ga0495645_0090866
951 Ga0495645_0186485
952 Ga0495622_0023544
953 Ga0495633_0010280
954 Ga0495633_0268635
955 Ga0495667_0469328
956 Ga0495668_0356840
957 Ga0495634_0006007
958 Ga0495634_0136470
959 Ga0495625_0113789
960 Ga0495625_0287935
961 Ga0495635_0004326
962 Ga0495635_0042637
963 Ga0495635_0100399
964 Ga0495659_0001567
965 Ga0495661_0054038
966 Ga0495588_0001004
967 Ga0495588_0031891
968 Ga0495646_0022490
969 Ga0495646_0187383
970 Ga0495647_0007563
971 Ga0495658_0001960
972 Ga0495669_0009434
973 Ga0495613_0022995
974 Ga0495624_0003274
975 Ga0495670_0061469
976 Ga0495671_0015183
977 Ga0495671_0123405
978 Ga0495649_0107378
979 Ga0495589_0027139
980 Ga0495589_0243235
981 Ga0495581_0001031
982 Ga0495581_0075944
983 Ga0495581_0172201
984 Ga0495604_0261809
985 Ga0495636_0013525
986 Ga0495674_0105770
987 Ga0495672_0133060
988 Ga0495676_0012956
989 Ga0495676_0175627
990 Ga0495683_0019905
991 Ga0495675_0209702
992 Ga0495677_0005216
993 Ga0495679_014512
994 Ga0495685_008090
995 Ga0495681_0034369
996 Ga0495684_0086112
997 Ga0495684_0218317
998 Ga0495686_0147866
999 Ga0495593_0001063
1000 Ga0495593_0070946
1001 Ga0495593_0239411
1002 Ga0495602_0487235
1003 Ga0495614_0045333
1004 Ga0495615_0014879
1005 Ga0496100_0049950
1006 Ga0496101_0037676
1007 Ga0496101_0205181
1008 Ga0496101_0331792
1009 Ga0496102_0021159
1010 Ga0496102_0413339
1011 Ga0496102_0933816
1012 Ga0496104_0026760
1013 Ga0496104_0071171
1014 Ga0496104_0121861
1015 Ga0496104_0347723
1016 Ga0496105_0121020
1017 Ga0496105_0124501
1018 Ga0496105_0255828
1019 Ga0496106_0020066
1020 Ga0496106_0042726
1021 Ga0496106_0230023
1022 Ga0496107_0006787
1023 Ga0496107_0098499
1024 Ga0496107_0156040
1025 Ga0496107_0326244
1026 Ga0496107_0611998
1027 Ga0496108_0017896
1028 Ga0496108_0098322
1029 Ga0496109_0032243
1030 Ga0496109_0049027
1031 Ga0496109_0338479
1032 Ga0496109_0730075
1033 Ga0496110_0296711
1034 Ga0496110_0321092
1035 Ga0496111_0023195
1036 Ga0496111_0167303
1037 Ga0496111_0338204
1038 Ga0496112_0001395
1039 Ga0496112_0004066
1040 Ga0496112_0050453
1041 Ga0496112_0081619
1042 Ga0496112_0092387
1043 Ga0496113_0007147
1044 Ga0496113_0058394
1045 Ga0496114_0048293
1046 Ga0496114_0179683
1047 Ga0496114_0422952
1048 Ga0496115_0011324
1049 Ga0496115_0027208
1050 Ga0496115_0070637
1051 Ga0496115_0135180
1052 Ga0496117_0128001
1053 Ga0496121_0018461
1054 Ga0496121_0039856
1055 Ga0496121_0136352
1056 Ga0496124_0101565
1057 Ga0496126_0110591
1058 Ga0496126_0182598
1059 Ga0496126_0281559
1060 Ga0496126_0674801
1061 Ga0495678_040575
1062 Ga0495682_0130351
1063 Ga0501046_0183971
1064 Ga0501047_0031164
1065 Ga0501073_0086527
1066 Ga0501080_0201387
1067 Ga0501080_0231113
1068 Ga0501080_0670593
1069 Ga0501044_0086551
1070 nmdc:mga03683_1158_c1
1071 nmdc:mga03683_55334_c1
1072 nmdc:mga00v17_684229_c1
1073 nmdc:mga0yw44_14309_c1
1074 nmdc:mga0yw44_147016_c1
1075 nmdc:mga0yw44_263842_c1
1076 nmdc:mga0yw44_273288_c1
1077 nmdc:mga0yw44_615370_c1
1078 nmdc:mga0k408_302902_c1
1079 nmdc:mga06z11_157772_c1
1080 nmdc:mga06z11_37500_c1
1081 nmdc:mga06z11_55589_c1
1082 nmdc:mga06z11_56371_c1
1083 nmdc:mga07m45_516826_c1
1084 nmdc:mga07m45_64271_c1
1085 nmdc:mga0qj67_382007_c1
1086 nmdc:mga08y16_888043_c1
1087 nmdc:mga0n895_439819_c1
1088 nmdc:mga0n895_676530_c1
1089 nmdc:mga0rr50_424952_c1
1090 nmdc:mga0a205_739558_c1
1091 nmdc:mga0sz30_107160_c1
1092 nmdc:mga0sz30_148182_c1
1093 nmdc:mga0sz30_252412_c1
1094 nmdc:mga0sz30_792_c1
1095 Ga0495601_0094163
1096 Ga0495612_0077153
1097 Ga0500635_0004117
1098 Ga0495595_0186172
1099 Ga0495619_0107901
1100 Ga0495619_0126325
1101 Ga0500578_0409419
1102 Ga0500646_0041741
1103 Ga0500651_0043528
1104 Ga0500651_0245818
1105 Ga0500641_0008505
1106 Ga0500595_017775
1107 Ga0500658_0259474
1108 Ga0500568_0011142
1109 Ga0500634_0107828
1110 Ga0500638_241918
1111 Ga0500639_032707
1112 Ga0500637_0346396
1113 Ga0500552_005003
1114 2513888107

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01983

CofC

Guanylyl transferase CofC like

7

225

0.87

PF12804

NTP_transf_3

MobA-like NTP transferase domain

27

180

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
7p97-assembly2.cif.gz_BBB structure of 3-phospho-d-glycerate guanylyltransferase with product 3-gppg bound 0.8504 4 195
7p97-assembly2.cif.gz_BBB structure of 3-phospho-d-glycerate guanylyltransferase with product 3-gppg bound 0.8219 4 195
2i5e-assembly1.cif.gz_B crystal structure of a protein of unknown function mm2497 from methanosarcina mazei go1, probable nucleotidyltransferase 0.8068 3 212
6ifi-assembly1.cif.gz_B crystal structure of the apo form of cmp-n-acetylneuraminate synthetase from vibrio cholerae 0.7656 3 121
2i5e-assembly1.cif.gz_B crystal structure of a protein of unknown function mm2497 from methanosarcina mazei go1, probable nucleotidyltransferase 0.7456 3 212
ID Description Score Start End Superfamily
af_Q58297_5_176_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.7973 3 173 3.90.550.10
af_P9WP83_9_180_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.7809 3 173 3.90.550.10
af_P9WP83_9_180_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.7604 3 173 3.90.550.10
af_Q58297_5_176_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.7519 3 173 3.90.550.10
af_O06376_3_236_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.7335 1 122 3.90.550.10
ID Description Score Start End GO Terms
AF-A0A7V8NMZ3-F1-model_v4 NTP transferase domain-containing protein 0.9505 4 124 GO:0005525
GO:0043814
AF-A0A521RN01-F1-model_v4 2-phospho-L-lactate guanylyltransferase 0.9463 1 122 GO:0005525
GO:0043814
AF-A0A7V2LM66-F1-model_v4 2-phospho-L-lactate guanylyltransferase 0.9349 2 108 GO:0005525
GO:0043814
AF-A0A843CG73-F1-model_v4 CofC protein 0.9311 3 107 GO:0005525
GO:0043814
AF-A0A381VR16-F1-model_v4 2-phospho-L-lactate guanylyltransferase 0.9298 1 109 GO:0005525
GO:0043814

Map