F463290

General Info

Members Datasets Scaffolds Average Seq Length
557 225 1114 227

Family's Representative Sequence

Representative Sequence 3300005539|Ga0068853_100000367|Ga0068853_10000036720
Length 244
Sequence MQGFFAALRMTGFIFDAGDDMLIPSIDLMGGRIVQLVQGEKLKLAFDDFEYWIERFQKYPVVQLIDLDAAMRQGDNRALIEMFCKRLPCQVGGGLRSAADGRALLAAGAKRVIFGSSLFGAAGVNKEFAAGLKKELGEEALVFSVDTKGGKVAVKGWKDSVDLTPEEAVTWLEDYCSAFLYTHVDTEGTMSGFPMDVAAVLRSTTAKQLIVAGGIKERAEVDALDAMGVDAVAGMAVYSGAMEA

Samples

Sample ID Description Type Environment
1 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
2 3300000546 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled Metagenome Rhizosphere
3 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
4 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
13 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
14 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
15 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
16 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
17 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
18 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
19 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
20 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
21 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
22 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
23 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
24 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
25 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
26 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
27 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
28 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
29 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
30 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
31 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
32 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
33 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
34 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
35 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
36 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
37 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
38 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
39 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
40 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
41 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
42 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
43 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
44 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
45 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
46 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
47 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
48 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
49 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
50 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
51 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
52 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
53 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
54 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
55 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
56 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
57 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
58 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
59 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
60 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
61 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
62 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
63 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
64 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
65 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
66 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
67 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
68 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
108 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
109 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
110 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
111 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
112 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
113 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
114 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
115 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
116 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
117 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
118 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
119 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
120 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
121 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
122 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
123 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
124 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
125 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
126 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
127 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
128 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
129 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
130 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
131 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
132 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
133 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
134 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
135 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
136 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
137 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
138 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
139 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
140 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
141 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
142 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
143 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
144 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
145 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
146 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
147 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
148 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
149 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
150 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
151 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
152 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
153 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
154 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
155 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
156 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
157 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
158 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
159 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
160 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
161 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
162 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
163 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
164 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
165 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
166 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
167 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
168 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
169 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
170 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
171 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
172 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
173 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
174 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
175 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
176 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
177 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
178 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
179 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
180 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
181 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
182 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
183 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
184 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
185 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
186 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
187 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
188 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
189 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
190 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
191 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
192 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
193 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
194 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
195 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
196 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
197 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
198 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
199 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
200 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
201 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
202 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
203 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
204 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
205 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
206 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
207 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
208 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
209 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
210 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
211 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
212 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
213 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
214 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
215 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
216 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
217 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
218 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
219 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
220 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
221 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
222 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
223 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
224 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
225 2884215851 Edaphobacter sp. 12200R-103 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.46
Metatranscriptomes 0.36
Isolates 0.18

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.08
Nodule 0
Rhizoplane 2.69
Rhizosphere 94.25
Stem 0
Stem Tuber 0
Unclassified 8.98

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068853_100000367 3300005539 Bacteria 31060
2 LJNas_1005829 3300000546 Bacteria 1341
3 rootH2_10009426 3300003320 Bacteria 39179
4 rootH1_10212810 3300003323 Bacteria 1299
5 Ga0070658_10000121 3300005327 Bacteria 70439
6 Ga0070658_10016394 3300005327 Bacteria 5929
7 Ga0070658_10024939 3300005327 Bacteria 4795
8 Ga0070658_10079725 3300005327 Bacteria 2689
9 Ga0070658_10237104 3300005327 Unclassified 1546
10 Ga0070658_10251170 3300005327 Bacteria 1500
11 Ga0070658_10345814 3300005327 Bacteria 1272
12 Ga0070683_100002041 3300005329 Bacteria 15901
13 Ga0070683_100019183 3300005329 Bacteria 6072
14 Ga0070683_100045076 3300005329 Bacteria 4071
15 Ga0070683_100060569 3300005329 Bacteria 3518
16 Ga0070683_100397430 3300005329 Bacteria 1314
17 Ga0070670_100348337 3300005331 Unclassified 1301
18 Ga0068869_100001577 3300005334 Bacteria 13554
19 Ga0070682_100088991 3300005337 Bacteria 2016
20 Ga0068868_100000066 3300005338 Bacteria 59945
21 Ga0070660_100029979 3300005339 Bacteria 4079
22 Ga0070660_100080584 3300005339 Bacteria 2555
23 Ga0070660_100153157 3300005339 Bacteria 1854
24 Ga0070661_100026342 3300005344 Bacteria 4182
25 Ga0070661_100035316 3300005344 Unclassified 3630
26 Ga0070661_100078552 3300005344 Bacteria 2434
27 Ga0070661_100240572 3300005344 Bacteria 1394
28 Ga0070671_100007733 3300005355 Bacteria 8586
29 Ga0070671_100019026 3300005355 Bacteria 5586
30 Ga0070671_100198513 3300005355 Bacteria 1701
31 Ga0070671_100474754 3300005355 Bacteria 1074
32 Ga0070659_100039546 3300005366 Bacteria 3682
33 Ga0070659_100125529 3300005366 Bacteria 2082
34 Ga0070667_100046288 3300005367 Bacteria 3659
35 Ga0070714_100002654 3300005435 Bacteria 13178
36 Ga0070714_100243936 3300005435 Bacteria 1659
37 Ga0070713_100140660 3300005436 Bacteria 2138
38 Ga0070713_100202201 3300005436 Bacteria 1794
39 Ga0070713_100262209 3300005436 Bacteria 1579
40 Ga0070663_100088869 3300005455 Unclassified 2285
41 Ga0070681_10178163 3300005458 Bacteria 2047
42 Ga0070679_100083871 3300005530 Bacteria 3175
43 Ga0070679_100092454 3300005530 Bacteria 3012
44 Ga0070679_100106995 3300005530 Bacteria 2782
45 Ga0070679_100754701 3300005530 Bacteria 916
46 Ga0070684_100043733 3300005535 Bacteria 3870
47 Ga0070684_100117871 3300005535 Bacteria 2386
48 Ga0070684_100294775 3300005535 Bacteria 1488
49 Ga0070684_100378336 3300005535 Bacteria 1304
50 Ga0068853_100000222 3300005539 Bacteria 40206
51 Ga0068853_100067118 3300005539 Bacteria 3116
52 Ga0068853_100107800 3300005539 Bacteria 2470
53 Ga0068853_100115336 3300005539 Unclassified 2390
54 Ga0068853_100429508 3300005539 Bacteria 1240
55 Ga0068853_100449619 3300005539 Unclassified 1212
56 Ga0070665_100005637 3300005548 Bacteria 12872
57 Ga0070665_100035648 3300005548 Bacteria 5003
58 Ga0070665_100303206 3300005548 Bacteria 1600
59 Ga0068855_100000277 3300005563 Bacteria 63213
60 Ga0068855_100002688 3300005563 Bacteria 21925
61 Ga0068855_100010384 3300005563 Bacteria 11233
62 Ga0068855_100011915 3300005563 Bacteria 10511
63 Ga0068855_100035334 3300005563 Bacteria 5953
64 Ga0068855_100052910 3300005563 Bacteria 4778
65 Ga0068855_100060121 3300005563 Bacteria 4444
66 Ga0068855_100110833 3300005563 Bacteria 3150
67 Ga0068855_100127193 3300005563 Bacteria 2912
68 Ga0068855_100187371 3300005563 Bacteria 2336
69 Ga0068855_100264509 3300005563 Bacteria 1915
70 Ga0070664_100058239 3300005564 Bacteria 3286
71 Ga0068857_100003191 3300005577 Bacteria 13595
72 Ga0068857_100048791 3300005577 Bacteria 3757
73 Ga0068857_100114600 3300005577 Unclassified 2424
74 Ga0068854_100000019 3300005578 Bacteria 134145
75 Ga0068854_100130839 3300005578 Unclassified 1916
76 Ga0068854_100437872 3300005578 Bacteria 1089
77 Ga0068856_100003529 3300005614 Bacteria 15773
78 Ga0068856_100041779 3300005614 Bacteria 4508
79 Ga0068856_100062110 3300005614 Bacteria 3690
80 Ga0068856_100730844 3300005614 Bacteria 1010
81 Ga0068852_100000019 3300005616 Bacteria 129021
82 Ga0068852_100000097 3300005616 Bacteria 59430
83 Ga0068852_100032008 3300005616 Unclassified 4349
84 Ga0068852_100068135 3300005616 Bacteria 3113
85 Ga0068852_100259189 3300005616 Bacteria 1669
86 Ga0068852_100264972 3300005616 Bacteria 1651
87 Ga0068852_100286115 3300005616 Bacteria 1591
88 Ga0068864_100000625 3300005618 Bacteria 29830
89 Ga0068864_100086854 3300005618 Bacteria 2753
90 Ga0068864_100403628 3300005618 Bacteria 1299
91 Ga0068851_10085117 3300005834 Unclassified 1657
92 Ga0068863_100001753 3300005841 Bacteria 21524
93 Ga0068863_100001814 3300005841 Bacteria 21208
94 Ga0068863_100315699 3300005841 Bacteria 1517
95 Ga0068858_100014586 3300005842 Bacteria 7404
96 Ga0068860_100000689 3300005843 Bacteria 38878
97 Ga0081540_1004351 3300005983 Bacteria 10839
98 Ga0070717_10523552 3300006028 Bacteria 1073
99 Ga0070712_100658460 3300006175 Bacteria 890
100 Ga0097621_100000349 3300006237 Bacteria 31779
101 Ga0068871_100002325 3300006358 Bacteria 12946
102 Ga0075436_100009109 3300006914 Bacteria 6792
103 Ga0105240_10000372 3300009093 Bacteria 84325
104 Ga0105240_10000496 3300009093 Bacteria 72575
105 Ga0105240_10009346 3300009093 Bacteria 13895
106 Ga0105240_10010838 3300009093 Bacteria 12767
107 Ga0105240_10030875 3300009093 Bacteria 6960
108 Ga0105240_10064615 3300009093 Bacteria 4546
109 Ga0105240_10087131 3300009093 Bacteria 3824
110 Ga0105240_10132371 3300009093 Bacteria 2990
111 Ga0105240_10244112 3300009093 Bacteria 2080
112 Ga0105240_10379291 3300009093 Bacteria 1597
113 Ga0105240_10663251 3300009093 Bacteria 1142
114 Ga0105240_11152276 3300009093 Bacteria 823
115 Ga0105245_10000486 3300009098 Bacteria 36378
116 Ga0105245_10504514 3300009098 Bacteria 1226
117 Ga0105247_10002346 3300009101 Bacteria 12922
118 Ga0105243_10008481 3300009148 Bacteria 7889
119 Ga0105241_10000026 3300009174 Bacteria 132695
120 Ga0105241_10000121 3300009174 Bacteria 57041
121 Ga0105241_10002032 3300009174 Bacteria 15308
122 Ga0105241_10139161 3300009174 Bacteria 1974
123 Ga0105241_10179856 3300009174 Unclassified 1753
124 Ga0105248_10006539 3300009177 Bacteria 12780
125 Ga0105248_10007017 3300009177 Bacteria 12337
126 Ga0105248_10016372 3300009177 Bacteria 8160
127 Ga0105248_10029618 3300009177 Bacteria 6107
128 Ga0105248_10039332 3300009177 Bacteria 5296
129 Ga0105248_10108464 3300009177 Bacteria 3131
130 Ga0105248_10131792 3300009177 Bacteria 2820
131 Ga0105237_10000590 3300009545 Bacteria 50564
132 Ga0105237_10006331 3300009545 Bacteria 13155
133 Ga0105237_10055825 3300009545 Bacteria 3955
134 Ga0105237_10167008 3300009545 Bacteria 2200
135 Ga0105237_10210199 3300009545 Bacteria 1946
136 Ga0105237_10215892 3300009545 Bacteria 1918
137 Ga0105238_10000197 3300009551 Bacteria 66637
138 Ga0105238_10000509 3300009551 Bacteria 40868
139 Ga0105238_10054460 3300009551 Bacteria 4017
140 Ga0105238_10111078 3300009551 Bacteria 2721
141 Ga0105238_10207045 3300009551 Unclassified 1938
142 Ga0105238_10309477 3300009551 Bacteria 1564
143 Ga0105238_10556750 3300009551 Bacteria 1151
144 Ga0105238_10996964 3300009551 Bacteria 858
145 Ga0105238_11025474 3300009551 Bacteria 846
146 Ga0105249_10003449 3300009553 Bacteria 13698
147 Ga0105239_10001533 3300010375 Bacteria 30534
148 Ga0105239_10003046 3300010375 Bacteria 20836
149 Ga0105239_10047654 3300010375 Bacteria 4696
150 Ga0105239_10129889 3300010375 Bacteria 2801
151 Ga0105246_10001192 3300011119 Bacteria 15150
152 Ga0157373_10273517 3300013100 Unclassified 1196
153 Ga0157371_10118539 3300013102 Bacteria 1882
154 Ga0157371_10321687 3300013102 Bacteria 1123
155 Ga0157370_10013763 3300013104 Bacteria 8313
156 Ga0157370_10056931 3300013104 Bacteria 3720
157 Ga0157370_10143683 3300013104 Bacteria 2223
158 Ga0157370_10144774 3300013104 Unclassified 2213
159 Ga0157370_10150526 3300013104 Bacteria 2165
160 Ga0157370_10337514 3300013104 Bacteria 1389
161 Ga0157369_10000085 3300013105 Bacteria 129025
162 Ga0157369_10000430 3300013105 Bacteria 55736
163 Ga0157369_10002421 3300013105 Bacteria 22423
164 Ga0157369_10009218 3300013105 Bacteria 11289
165 Ga0157369_10010533 3300013105 Bacteria 10523
166 Ga0157369_10012659 3300013105 Bacteria 9566
167 Ga0157369_10069226 3300013105 Bacteria 3791
168 Ga0157369_10187110 3300013105 Bacteria 2177
169 Ga0157369_10247562 3300013105 Bacteria 1861
170 Ga0157369_10330569 3300013105 Bacteria 1584
171 Ga0157369_10373773 3300013105 Bacteria 1480
172 Ga0157369_10399786 3300013105 Bacteria 1425
173 Ga0157369_10446063 3300013105 Bacteria 1340
174 Ga0157369_10591061 3300013105 Bacteria 1146
175 Ga0157374_10023020 3300013296 Bacteria 5565
176 Ga0157374_10035016 3300013296 Bacteria 4591
177 Ga0157374_10083746 3300013296 Bacteria 3030
178 Ga0157374_10652418 3300013296 Bacteria 1064
179 Ga0157374_10652854 3300013296 Unclassified 1064
180 Ga0157378_10004251 3300013297 Bacteria 12630
181 Ga0157378_10117504 3300013297 Bacteria 2447
182 Ga0157378_10340671 3300013297 Bacteria 1462
183 Ga0163162_10043334 3300013306 Bacteria 4506
184 Ga0163162_10115403 3300013306 Unclassified 2785
185 Ga0163162_10692608 3300013306 Bacteria 1141
186 Ga0157372_10000217 3300013307 Bacteria 63667
187 Ga0157372_10020181 3300013307 Bacteria 7185
188 Ga0157372_10072143 3300013307 Bacteria 3890
189 Ga0157372_10106002 3300013307 Bacteria 3215
190 Ga0157372_10117248 3300013307 Bacteria 3054
191 Ga0157372_10226977 3300013307 Bacteria 2165
192 Ga0157372_10300417 3300013307 Unclassified 1867
193 Ga0157372_10308318 3300013307 Bacteria 1842
194 Ga0157372_10312122 3300013307 Bacteria 1830
195 Ga0157372_10320090 3300013307 Bacteria 1806
196 Ga0157372_10373289 3300013307 Bacteria 1662
197 Ga0157372_10835314 3300013307 Bacteria 1070
198 Ga0157375_10067022 3300013308 Bacteria 3586
199 Ga0157375_10157485 3300013308 Bacteria 2411
200 Ga0157375_10518255 3300013308 Bacteria 1356
201 Ga0163163_10001161 3300014325 Bacteria 22403
202 Ga0163163_10017757 3300014325 Bacteria 6641
203 Ga0163163_10020844 3300014325 Bacteria 6179
204 Ga0163163_10192750 3300014325 Bacteria 2086
205 Ga0182008_10170467 3300014497 Bacteria 1099
206 Ga0157379_10002312 3300014968 Bacteria 15882
207 Ga0157379_10157854 3300014968 Bacteria 2047
208 Ga0157379_10606583 3300014968 Unclassified 1022
209 Ga0157376_10000296 3300014969 Bacteria 33604
210 Ga0157376_10023888 3300014969 Bacteria 4793
211 Ga0157376_10032166 3300014969 Bacteria 4209
212 Ga0157376_11002475 3300014969 Bacteria 858
213 Ga0154015_1016114 3300020610 Unclassified 947
214 Ga0228598_1028824 3300024227 Bacteria 1092
215 Ga0209437_108001 3300025233 Bacteria 1699
216 Ga0209233_1001442 3300025261 Bacteria 9385
217 Ga0207656_10021009 3300025321 Unclassified 2602
218 Ga0207656_10056823 3300025321 Unclassified 1707
219 Ga0207656_10165533 3300025321 Bacteria 1054
220 Ga0207647_10014872 3300025904 Bacteria 5351
221 Ga0207705_10000021 3300025909 Bacteria 309436
222 Ga0207705_10002125 3300025909 Bacteria 15376
223 Ga0207705_10027435 3300025909 Bacteria 4060
224 Ga0207705_10032912 3300025909 Bacteria 3705
225 Ga0207705_10041847 3300025909 Bacteria 3287
226 Ga0207705_10080943 3300025909 Bacteria 2367
227 Ga0207705_10167344 3300025909 Unclassified 1654
228 Ga0207705_10205584 3300025909 Bacteria 1492
229 Ga0207654_10000054 3300025911 Bacteria 82347
230 Ga0207654_10026092 3300025911 Bacteria 3160
231 Ga0207654_10122981 3300025911 Unclassified 1632
232 Ga0207654_10156579 3300025911 Unclassified 1468
233 Ga0207707_10085789 3300025912 Bacteria 2751
234 Ga0207707_10337448 3300025912 Bacteria 1300
235 Ga0207707_10572265 3300025912 Unclassified 958
236 Ga0207695_10000080 3300025913 Bacteria 287868
237 Ga0207695_10000113 3300025913 Bacteria 247240
238 Ga0207695_10000167 3300025913 Bacteria 194371
239 Ga0207695_10000263 3300025913 Bacteria 132894
240 Ga0207695_10033351 3300025913 Bacteria 5617
241 Ga0207695_10105111 3300025913 Unclassified 2811
242 Ga0207695_10138447 3300025913 Bacteria 2386
243 Ga0207695_10188139 3300025913 Bacteria 1983
244 Ga0207695_10607515 3300025913 Bacteria 975
245 Ga0207671_10000065 3300025914 Bacteria 166743
246 Ga0207671_10000123 3300025914 Bacteria 119385
247 Ga0207671_10000139 3300025914 Bacteria 111786
248 Ga0207671_10068441 3300025914 Bacteria 2645
249 Ga0207671_10380688 3300025914 Bacteria 1121
250 Ga0207693_10540728 3300025915 Bacteria 909
251 Ga0207660_10039132 3300025917 Bacteria 3314
252 Ga0207660_10047824 3300025917 Bacteria 3026
253 Ga0207657_10020248 3300025919 Bacteria 6293
254 Ga0207657_10022299 3300025919 Bacteria 5931
255 Ga0207657_10114026 3300025919 Bacteria 2229
256 Ga0207649_10054539 3300025920 Bacteria 2488
257 Ga0207649_10171445 3300025920 Bacteria 1512
258 Ga0207652_10041920 3300025921 Bacteria 3893
259 Ga0207652_10115347 3300025921 Bacteria 2386
260 Ga0207652_10285488 3300025921 Bacteria 1489
261 Ga0207694_10000248 3300025924 Bacteria 51461
262 Ga0207694_10000711 3300025924 Bacteria 29920
263 Ga0207694_10086769 3300025924 Bacteria 2464
264 Ga0207694_10177601 3300025924 Unclassified 1725
265 Ga0207694_10245121 3300025924 Unclassified 1465
266 Ga0207694_10248546 3300025924 Bacteria 1455
267 Ga0207650_10141600 3300025925 Bacteria 1891
268 Ga0207650_10552744 3300025925 Unclassified 965
269 Ga0207687_10000978 3300025927 Bacteria 19404
270 Ga0207700_10381105 3300025928 Bacteria 1233
271 Ga0207700_10506661 3300025928 Bacteria 1068
272 Ga0207664_10017916 3300025929 Bacteria 5203
273 Ga0207664_10064130 3300025929 Bacteria 2937
274 Ga0207644_10004420 3300025931 Bacteria 9123
275 Ga0207644_10215112 3300025931 Bacteria 1521
276 Ga0207690_10084349 3300025932 Bacteria 2227
277 Ga0207709_10017040 3300025935 Bacteria 4050
278 Ga0207711_10014059 3300025941 Bacteria 6649
279 Ga0207711_10043809 3300025941 Bacteria 3819
280 Ga0207711_10058450 3300025941 Bacteria 3318
281 Ga0207711_10155934 3300025941 Bacteria 2063
282 Ga0207711_10903978 3300025941 Bacteria 821
283 Ga0207689_10000724 3300025942 Bacteria 31641
284 Ga0207661_10001283 3300025944 Bacteria 16799
285 Ga0207661_10059682 3300025944 Bacteria 3075
286 Ga0207661_10138935 3300025944 Unclassified 2089
287 Ga0207661_10314799 3300025944 Bacteria 1406
288 Ga0207661_10433514 3300025944 Unclassified 1195
289 Ga0207679_10061885 3300025945 Bacteria 2788
290 Ga0207667_10006194 3300025949 Bacteria 14522
291 Ga0207667_10007633 3300025949 Bacteria 12958
292 Ga0207667_10009516 3300025949 Bacteria 11434
293 Ga0207667_10012818 3300025949 Bacteria 9632
294 Ga0207667_10025432 3300025949 Bacteria 6479
295 Ga0207667_10026234 3300025949 Bacteria 6368
296 Ga0207667_10035816 3300025949 Bacteria 5323
297 Ga0207667_10073432 3300025949 Bacteria 3554
298 Ga0207667_10212215 3300025949 Bacteria 1984
299 Ga0207712_10030122 3300025961 Bacteria 3646
300 Ga0207640_10000028 3300025981 Bacteria 135727
301 Ga0207640_10020918 3300025981 Bacteria 3891
302 Ga0207640_10354319 3300025981 Unclassified 1180
303 Ga0207658_10003428 3300025986 Bacteria 11222
304 Ga0207677_10000143 3300026023 Bacteria 58337
305 Ga0207677_10585248 3300026023 Bacteria 977
306 Ga0207703_10004820 3300026035 Bacteria 10980
307 Ga0207639_10000088 3300026041 Bacteria 78742
308 Ga0207639_10000371 3300026041 Bacteria 31074
309 Ga0207639_10016992 3300026041 Bacteria 5155
310 Ga0207639_10102623 3300026041 Bacteria 2315
311 Ga0207639_10194100 3300026041 Bacteria 1736
312 Ga0207639_10259218 3300026041 Bacteria 1520
313 Ga0207639_10339955 3300026041 Unclassified 1338
314 Ga0207678_10003339 3300026067 Bacteria 14471
315 Ga0207678_10017744 3300026067 Bacteria 6250
316 Ga0207678_10056161 3300026067 Bacteria 3390
317 Ga0207678_10149736 3300026067 Bacteria 1992
318 Ga0207702_10001334 3300026078 Bacteria 24682
319 Ga0207702_10002672 3300026078 Bacteria 16738
320 Ga0207702_10084650 3300026078 Bacteria 2762
321 Ga0207641_10383631 3300026088 Bacteria 1346
322 Ga0207676_10002595 3300026095 Bacteria 12891
323 Ga0207676_10052862 3300026095 Bacteria 3177
324 Ga0207676_10495121 3300026095 Bacteria 1160
325 Ga0207674_10000669 3300026116 Bacteria 44573
326 Ga0207674_10005472 3300026116 Bacteria 15089
327 Ga0207674_10048839 3300026116 Bacteria 4330
328 Ga0207674_10430583 3300026116 Bacteria 1275
329 Ga0207674_10705703 3300026116 Bacteria 974
330 Ga0207698_10000003 3300026142 Bacteria 321303
331 Ga0207698_10000708 3300026142 Bacteria 19330
332 Ga0207698_10099445 3300026142 Bacteria 2406
333 Ga0207698_10105923 3300026142 Bacteria 2344
334 Ga0207698_10144796 3300026142 Unclassified 2053
335 Ga0268266_10005265 3300028379 Bacteria 12146
336 Ga0268266_10006399 3300028379 Bacteria 10792
337 Ga0268266_10008807 3300028379 Bacteria 8937
338 Ga0268264_10000598 3300028381 Bacteria 43640
339 Ga0265338_10017734 3300028800 Bacteria 7656
340 Ga0265338_10117655 3300028800 Bacteria 2126
341 Ga0265338_10225494 3300028800 Bacteria 1397
342 Ga0265324_10009104 3300029957 Bacteria 3896
343 Ga0265760_10133851 3300031090 Unclassified 803
344 Ga0265330_10000273 3300031235 Bacteria 38107
345 Ga0265330_10116345 3300031235 Bacteria 1140
346 Ga0265328_10005053 3300031239 Bacteria 5684
347 Ga0265328_10049572 3300031239 Unclassified 1542
348 Ga0265325_10000266 3300031241 Bacteria 37071
349 Ga0265325_10023750 3300031241 Bacteria 3342
350 Ga0265325_10024784 3300031241 Bacteria 3259
351 Ga0265340_10012505 3300031247 Bacteria 4481
352 Ga0265339_10000124 3300031249 Bacteria 64124
353 Ga0265339_10000194 3300031249 Bacteria 50375
354 Ga0265339_10009288 3300031249 Bacteria 6193
355 Ga0265316_10003105 3300031344 Bacteria 16919
356 Ga0265316_10006699 3300031344 Bacteria 10976
357 Ga0265316_10012685 3300031344 Bacteria 7543
358 Ga0265313_10002216 3300031595 Bacteria 17122
359 Ga0265313_10005380 3300031595 Bacteria 9445
360 Ga0265313_10021496 3300031595 Bacteria 3528
361 Ga0265313_10093326 3300031595 Bacteria 1347
362 Ga0265314_10002987 3300031711 Bacteria 16745
363 Ga0265314_10021888 3300031711 Bacteria 4904
364 Ga0265342_10000225 3300031712 Bacteria 63822
365 Ga0265342_10001536 3300031712 Bacteria 21355
366 Ga0265342_10027916 3300031712 Bacteria 3520
367 Ga0265342_10181726 3300031712 Bacteria 1151
368 Ga0307510_10071107 3300033180 Bacteria 3468
369 Ga0307510_10094785 3300033180 Bacteria 2808
370 Ga0373956_0021847 3300035119 Bacteria 2732
371 Ga0373955_0007147 3300035172 Bacteria 5117
372 Ga0373937_0019961 3300036401 Bacteria 6002
373 Ga0373937_0180871 3300036401 Unclassified 1980
374 Ga0373937_0266593 3300036401 Bacteria 1616
375 Ga0373937_0297238 3300036401 Bacteria 1526
376 Ga0373925_0401553 3300037068 Bacteria 1118
377 Ga0395900_0025848 3300037418 Bacteria 6011
378 Ga0395898_0027814 3300037466 Bacteria 5670
379 Ga0395898_0459394 3300037466 Bacteria 1212
380 Ga0439448_0015255 3300042005 Bacteria 2326
381 Ga0466969_0024581 3300044656 Bacteria 3100
382 Ga0466966_0040099 3300044684 Bacteria 3014
383 Ga0466966_0256512 3300044684 Bacteria 1053
384 Ga0466966_0382439 3300044684 Unclassified 846
385 Ga0466961_0122066 3300044693 Unclassified 1635
386 Ga0466961_0305674 3300044693 Bacteria 971
387 Ga0466963_0000494 3300044694 Bacteria 18341
388 Ga0466963_0010164 3300044694 Bacteria 5690
389 Ga0466963_0098713 3300044694 Bacteria 1997
390 Ga0466963_0215755 3300044694 Bacteria 1343
391 Ga0466958_0007910 3300045836 Bacteria 5877
392 Ga0466958_0219357 3300045836 Bacteria 1213
393 Ga0466967_0001401 3300045976 Bacteria 13938
394 Ga0466967_0001893 3300045976 Bacteria 12641
395 Ga0466967_0046813 3300045976 Bacteria 3768
396 Ga0495592_0418821 3300046454 Bacteria 845
397 Ga0495603_0009924 3300046455 Bacteria 5763
398 Ga0495629_0011020 3300046459 Bacteria 6567
399 Ga0495629_0092572 3300046459 Bacteria 2110
400 Ga0495629_0190528 3300046459 Bacteria 1419
401 Ga0495651_0290033 3300046462 Bacteria 1102
402 Ga0495650_0000038 3300046471 Bacteria 377530
403 Ga0495650_0002342 3300046471 Bacteria 15659
404 Ga0495580_0089761 3300046472 Bacteria 2140
405 Ga0495580_0103353 3300046472 Bacteria 1980
406 Ga0495580_0320237 3300046472 Unclassified 1054
407 Ga0495580_0447252 3300046472 Bacteria 867
408 Ga0495582_0001853 3300046473 Bacteria 11921
409 Ga0495582_0067225 3300046473 Bacteria 1980
410 Ga0495582_0080396 3300046473 Bacteria 1810
411 Ga0495639_0004538 3300046475 Bacteria 5952
412 Ga0495662_0006308 3300046476 Bacteria 5928
413 Ga0495664_0001348 3300046477 Bacteria 12929
414 Ga0495664_0049296 3300046477 Bacteria 2500
415 Ga0495664_0065290 3300046477 Unclassified 2169
416 Ga0495585_0025037 3300046492 Bacteria 3420
417 Ga0495594_0001190 3300046499 Bacteria 13614
418 Ga0495594_0004431 3300046499 Bacteria 7222
419 Ga0495594_0043704 3300046499 Bacteria 2456
420 Ga0495594_0056792 3300046499 Bacteria 2161
421 Ga0495596_0116450 3300046500 Bacteria 1038
422 Ga0495606_0024321 3300046507 Bacteria 4368
423 Ga0495606_0026137 3300046507 Bacteria 4164
424 Ga0495618_0037508 3300046514 Bacteria 3044
425 Ga0495628_0015738 3300046516 Bacteria 6314
426 Ga0495628_0033438 3300046516 Bacteria 4145
427 Ga0495631_0010490 3300046518 Bacteria 4581
428 Ga0495631_0038676 3300046518 Bacteria 2120
429 Ga0495644_0000048 3300046523 Bacteria 57696
430 Ga0495648_0228481 3300046524 Bacteria 913
431 Ga0495666_0024917 3300046526 Bacteria 2955
432 Ga0495652_0006640 3300046529 Bacteria 10742
433 Ga0495652_0020698 3300046529 Bacteria 5848
434 Ga0495665_0009651 3300046531 Bacteria 5228
435 Ga0495665_0194702 3300046531 Bacteria 1052
436 Ga0495640_0004801 3300046533 Bacteria 10760
437 Ga0495640_0270223 3300046533 Bacteria 1060
438 Ga0495586_0019711 3300046535 Bacteria 3591
439 Ga0495587_0007267 3300046536 Bacteria 7183
440 Ga0495609_0048103 3300046538 Bacteria 1907
441 Ga0495645_0004272 3300046543 Bacteria 9760
442 Ga0495645_0014554 3300046543 Bacteria 5584
443 Ga0495645_0039222 3300046543 Bacteria 3455
444 Ga0495645_0120435 3300046543 Bacteria 1848
445 Ga0495622_0112645 3300046557 Bacteria 1245
446 Ga0495633_0013243 3300046558 Bacteria 4354
447 Ga0495667_0015039 3300046559 Bacteria 5223
448 Ga0495667_0161695 3300046559 Bacteria 1440
449 Ga0495634_0006225 3300046642 Bacteria 9093
450 Ga0495611_0005877 3300046648 Bacteria 5236
451 Ga0495625_0000985 3300046660 Bacteria 37750
452 Ga0495625_0017473 3300046660 Bacteria 5617
453 Ga0495625_0026175 3300046660 Bacteria 4411
454 Ga0495635_0002836 3300046663 Bacteria 11904
455 Ga0495635_0197292 3300046663 Bacteria 1366
456 Ga0495635_0396171 3300046663 Unclassified 917
457 Ga0495661_0021941 3300046665 Bacteria 4156
458 Ga0495588_0068626 3300046674 Bacteria 1842
459 Ga0495599_0037006 3300046678 Bacteria 3066
460 Ga0495599_0163875 3300046678 Bacteria 1373
461 Ga0495623_0073201 3300046679 Bacteria 2130
462 Ga0495646_0013211 3300046680 Bacteria 5247
463 Ga0495646_0087913 3300046680 Bacteria 1800
464 Ga0495646_0115119 3300046680 Bacteria 1527
465 Ga0495669_0015601 3300046684 Bacteria 3254
466 Ga0495613_0003966 3300046689 Bacteria 11081
467 Ga0495613_0048075 3300046689 Bacteria 3150
468 Ga0495613_0164464 3300046689 Bacteria 1577
469 Ga0495649_0200934 3300046694 Bacteria 1035
470 Ga0495600_0012858 3300046809 Bacteria 5243
471 Ga0495600_0126930 3300046809 Bacteria 1659
472 Ga0495600_0292340 3300046809 Bacteria 1029
473 Ga0495581_0001976 3300047315 Bacteria 11495
474 Ga0495581_0044298 3300047315 Bacteria 2573
475 Ga0495604_0009666 3300047317 Bacteria 7624
476 Ga0495604_0032429 3300047317 Bacteria 4140
477 Ga0495636_0118561 3300047318 Bacteria 1169
478 Ga0495674_0011368 3300047319 Bacteria 8401
479 Ga0495674_0014334 3300047319 Bacteria 7423
480 Ga0495674_0410310 3300047319 Bacteria 1092
481 Ga0495672_0021506 3300047320 Bacteria 4206
482 Ga0495672_0051848 3300047320 Bacteria 2414
483 Ga0495676_0008961 3300047321 Bacteria 9134
484 Ga0495680_0017467 3300047322 Bacteria 6127
485 Ga0495683_0112571 3300047323 Bacteria 1298
486 Ga0495675_0079836 3300047444 Bacteria 2060
487 Ga0495685_085712 3300047447 Bacteria 1047
488 Ga0495684_0087091 3300047471 Unclassified 2367
489 Ga0495684_0114087 3300047471 Bacteria 2037
490 Ga0495686_0000178 3300047472 Bacteria 121468
491 Ga0495686_0001621 3300047472 Bacteria 23566
492 Ga0495686_0016441 3300047472 Bacteria 5016
493 Ga0495686_0022023 3300047472 Bacteria 4220
494 Ga0495686_0062732 3300047472 Bacteria 2304
495 Ga0495686_0096671 3300047472 Unclassified 1787
496 Ga0495686_0107665 3300047472 Bacteria 1675
497 Ga0495593_0061551 3300047673 Bacteria 1963
498 Ga0495602_0446209 3300048088 Unclassified 914
499 Ga0495614_0000972 3300048089 Bacteria 12208
500 Ga0495614_0009178 3300048089 Bacteria 4382
501 Ga0496100_0062884 3300048903 Bacteria 2451
502 Ga0496104_0000053 3300048907 Bacteria 135895
503 Ga0496104_0187129 3300048907 Bacteria 1981
504 Ga0496105_0063911 3300048908 Bacteria 3037
505 Ga0496106_0042478 3300048909 Bacteria 3410
506 Ga0496106_0141941 3300048909 Unclassified 1890
507 Ga0496107_0250908 3300048910 Bacteria 1317
508 Ga0496108_0226841 3300048911 Bacteria 1624
509 Ga0496112_0021005 3300048915 Bacteria 6201
510 Ga0496113_0102885 3300048916 Bacteria 2215
511 Ga0496114_0203080 3300048917 Bacteria 1736
512 Ga0496114_0410947 3300048917 Bacteria 1199
513 Ga0496114_0523799 3300048917 Bacteria 1048
514 Ga0496115_0240623 3300048918 Unclassified 1491
515 Ga0496115_0444936 3300048918 Bacteria 1047
516 Ga0496118_0174174 3300048921 Bacteria 1310
517 Ga0496126_0000014 3300048929 Bacteria 686881
518 Ga0496126_0000100 3300048929 Bacteria 203706
519 Ga0496126_0000154 3300048929 Bacteria 159983
520 Ga0496126_0018324 3300048929 Bacteria 6942
521 Ga0496126_0032919 3300048929 Bacteria 4878
522 Ga0496126_0742955 3300048929 Unclassified 758
523 Ga0495682_0028164 3300049460 Bacteria 2083
524 Ga0495682_0046605 3300049460 Bacteria 1582
525 Ga0495682_0184060 3300049460 Unclassified 742
526 Ga0501031_0152929 3300049568 Bacteria 1508
527 Ga0501032_0001912 3300049569 Bacteria 16446
528 Ga0501033_0060607 3300049570 Bacteria 2791
529 Ga0501034_0169330 3300049571 Bacteria 2152
530 Ga0501036_0081969 3300049572 Bacteria 2726
531 Ga0501036_0775796 3300049572 Bacteria 790
532 Ga0501037_0193654 3300049573 Bacteria 1439
533 Ga0501038_0005281 3300049574 Bacteria 12013
534 Ga0501043_0003983 3300049579 Bacteria 12094
535 Ga0501043_0083888 3300049579 Bacteria 2505
536 Ga0501046_0000056 3300049580 Bacteria 129342
537 Ga0501047_0008947 3300049581 Bacteria 9454
538 Ga0501047_0011287 3300049581 Bacteria 8456
539 Ga0501047_0773248 3300049581 Bacteria 776
540 Ga0501048_0041932 3300049582 Bacteria 3279
541 Ga0501070_0068724 3300049586 Bacteria 2933
542 Ga0501070_0334038 3300049586 Bacteria 1231
543 Ga0501070_0403480 3300049586 Bacteria 1105
544 Ga0501073_0018854 3300049589 Bacteria 4986
545 Ga0501073_0039812 3300049589 Bacteria 3329
546 Ga0501080_0014166 3300049742 Bacteria 7339
547 Ga0501035_0168491 3300049822 Bacteria 1893
548 Ga0501035_0182448 3300049822 Bacteria 1808
549 Ga0501044_0027240 3300049823 Bacteria 6042
550 Ga0501044_0061163 3300049823 Bacteria 3853
551 Ga0495601_0461962 3300053077 Unclassified 821
552 Ga0495619_0197192 3300053085 Bacteria 1394
553 Ga0500651_0000005 3300053093 Bacteria 384761
554 Ga0500595_000004 3300053119 Bacteria 410922
555 Ga0500595_007997 3300053119 Bacteria 4343
556 Ga0500661_002167 3300055283 Bacteria 3705
557 2884217804 2884215851 Bacteria 4554841
558 Ga0068853_100000367
559 LJNas_1005829
560 rootH2_10009426
561 rootH1_10212810
562 Ga0070658_10000121
563 Ga0070658_10016394
564 Ga0070658_10024939
565 Ga0070658_10079725
566 Ga0070658_10237104
567 Ga0070658_10251170
568 Ga0070658_10345814
569 Ga0070683_100002041
570 Ga0070683_100019183
571 Ga0070683_100045076
572 Ga0070683_100060569
573 Ga0070683_100397430
574 Ga0070670_100348337
575 Ga0068869_100001577
576 Ga0070682_100088991
577 Ga0068868_100000066
578 Ga0070660_100029979
579 Ga0070660_100080584
580 Ga0070660_100153157
581 Ga0070661_100026342
582 Ga0070661_100035316
583 Ga0070661_100078552
584 Ga0070661_100240572
585 Ga0070671_100007733
586 Ga0070671_100019026
587 Ga0070671_100198513
588 Ga0070671_100474754
589 Ga0070659_100039546
590 Ga0070659_100125529
591 Ga0070667_100046288
592 Ga0070714_100002654
593 Ga0070714_100243936
594 Ga0070713_100140660
595 Ga0070713_100202201
596 Ga0070713_100262209
597 Ga0070663_100088869
598 Ga0070681_10178163
599 Ga0070679_100083871
600 Ga0070679_100092454
601 Ga0070679_100106995
602 Ga0070679_100754701
603 Ga0070684_100043733
604 Ga0070684_100117871
605 Ga0070684_100294775
606 Ga0070684_100378336
607 Ga0068853_100000222
608 Ga0068853_100067118
609 Ga0068853_100107800
610 Ga0068853_100115336
611 Ga0068853_100429508
612 Ga0068853_100449619
613 Ga0070665_100005637
614 Ga0070665_100035648
615 Ga0070665_100303206
616 Ga0068855_100000277
617 Ga0068855_100002688
618 Ga0068855_100010384
619 Ga0068855_100011915
620 Ga0068855_100035334
621 Ga0068855_100052910
622 Ga0068855_100060121
623 Ga0068855_100110833
624 Ga0068855_100127193
625 Ga0068855_100187371
626 Ga0068855_100264509
627 Ga0070664_100058239
628 Ga0068857_100003191
629 Ga0068857_100048791
630 Ga0068857_100114600
631 Ga0068854_100000019
632 Ga0068854_100130839
633 Ga0068854_100437872
634 Ga0068856_100003529
635 Ga0068856_100041779
636 Ga0068856_100062110
637 Ga0068856_100730844
638 Ga0068852_100000019
639 Ga0068852_100000097
640 Ga0068852_100032008
641 Ga0068852_100068135
642 Ga0068852_100259189
643 Ga0068852_100264972
644 Ga0068852_100286115
645 Ga0068864_100000625
646 Ga0068864_100086854
647 Ga0068864_100403628
648 Ga0068851_10085117
649 Ga0068863_100001753
650 Ga0068863_100001814
651 Ga0068863_100315699
652 Ga0068858_100014586
653 Ga0068860_100000689
654 Ga0081540_1004351
655 Ga0070717_10523552
656 Ga0070712_100658460
657 Ga0097621_100000349
658 Ga0068871_100002325
659 Ga0075436_100009109
660 Ga0105240_10000372
661 Ga0105240_10000496
662 Ga0105240_10009346
663 Ga0105240_10010838
664 Ga0105240_10030875
665 Ga0105240_10064615
666 Ga0105240_10087131
667 Ga0105240_10132371
668 Ga0105240_10244112
669 Ga0105240_10379291
670 Ga0105240_10663251
671 Ga0105240_11152276
672 Ga0105245_10000486
673 Ga0105245_10504514
674 Ga0105247_10002346
675 Ga0105243_10008481
676 Ga0105241_10000026
677 Ga0105241_10000121
678 Ga0105241_10002032
679 Ga0105241_10139161
680 Ga0105241_10179856
681 Ga0105248_10006539
682 Ga0105248_10007017
683 Ga0105248_10016372
684 Ga0105248_10029618
685 Ga0105248_10039332
686 Ga0105248_10108464
687 Ga0105248_10131792
688 Ga0105237_10000590
689 Ga0105237_10006331
690 Ga0105237_10055825
691 Ga0105237_10167008
692 Ga0105237_10210199
693 Ga0105237_10215892
694 Ga0105238_10000197
695 Ga0105238_10000509
696 Ga0105238_10054460
697 Ga0105238_10111078
698 Ga0105238_10207045
699 Ga0105238_10309477
700 Ga0105238_10556750
701 Ga0105238_10996964
702 Ga0105238_11025474
703 Ga0105249_10003449
704 Ga0105239_10001533
705 Ga0105239_10003046
706 Ga0105239_10047654
707 Ga0105239_10129889
708 Ga0105246_10001192
709 Ga0157373_10273517
710 Ga0157371_10118539
711 Ga0157371_10321687
712 Ga0157370_10013763
713 Ga0157370_10056931
714 Ga0157370_10143683
715 Ga0157370_10144774
716 Ga0157370_10150526
717 Ga0157370_10337514
718 Ga0157369_10000085
719 Ga0157369_10000430
720 Ga0157369_10002421
721 Ga0157369_10009218
722 Ga0157369_10010533
723 Ga0157369_10012659
724 Ga0157369_10069226
725 Ga0157369_10187110
726 Ga0157369_10247562
727 Ga0157369_10330569
728 Ga0157369_10373773
729 Ga0157369_10399786
730 Ga0157369_10446063
731 Ga0157369_10591061
732 Ga0157374_10023020
733 Ga0157374_10035016
734 Ga0157374_10083746
735 Ga0157374_10652418
736 Ga0157374_10652854
737 Ga0157378_10004251
738 Ga0157378_10117504
739 Ga0157378_10340671
740 Ga0163162_10043334
741 Ga0163162_10115403
742 Ga0163162_10692608
743 Ga0157372_10000217
744 Ga0157372_10020181
745 Ga0157372_10072143
746 Ga0157372_10106002
747 Ga0157372_10117248
748 Ga0157372_10226977
749 Ga0157372_10300417
750 Ga0157372_10308318
751 Ga0157372_10312122
752 Ga0157372_10320090
753 Ga0157372_10373289
754 Ga0157372_10835314
755 Ga0157375_10067022
756 Ga0157375_10157485
757 Ga0157375_10518255
758 Ga0163163_10001161
759 Ga0163163_10017757
760 Ga0163163_10020844
761 Ga0163163_10192750
762 Ga0182008_10170467
763 Ga0157379_10002312
764 Ga0157379_10157854
765 Ga0157379_10606583
766 Ga0157376_10000296
767 Ga0157376_10023888
768 Ga0157376_10032166
769 Ga0157376_11002475
770 Ga0154015_1016114
771 Ga0228598_1028824
772 Ga0209437_108001
773 Ga0209233_1001442
774 Ga0207656_10021009
775 Ga0207656_10056823
776 Ga0207656_10165533
777 Ga0207647_10014872
778 Ga0207705_10000021
779 Ga0207705_10002125
780 Ga0207705_10027435
781 Ga0207705_10032912
782 Ga0207705_10041847
783 Ga0207705_10080943
784 Ga0207705_10167344
785 Ga0207705_10205584
786 Ga0207654_10000054
787 Ga0207654_10026092
788 Ga0207654_10122981
789 Ga0207654_10156579
790 Ga0207707_10085789
791 Ga0207707_10337448
792 Ga0207707_10572265
793 Ga0207695_10000080
794 Ga0207695_10000113
795 Ga0207695_10000167
796 Ga0207695_10000263
797 Ga0207695_10033351
798 Ga0207695_10105111
799 Ga0207695_10138447
800 Ga0207695_10188139
801 Ga0207695_10607515
802 Ga0207671_10000065
803 Ga0207671_10000123
804 Ga0207671_10000139
805 Ga0207671_10068441
806 Ga0207671_10380688
807 Ga0207693_10540728
808 Ga0207660_10039132
809 Ga0207660_10047824
810 Ga0207657_10020248
811 Ga0207657_10022299
812 Ga0207657_10114026
813 Ga0207649_10054539
814 Ga0207649_10171445
815 Ga0207652_10041920
816 Ga0207652_10115347
817 Ga0207652_10285488
818 Ga0207694_10000248
819 Ga0207694_10000711
820 Ga0207694_10086769
821 Ga0207694_10177601
822 Ga0207694_10245121
823 Ga0207694_10248546
824 Ga0207650_10141600
825 Ga0207650_10552744
826 Ga0207687_10000978
827 Ga0207700_10381105
828 Ga0207700_10506661
829 Ga0207664_10017916
830 Ga0207664_10064130
831 Ga0207644_10004420
832 Ga0207644_10215112
833 Ga0207690_10084349
834 Ga0207709_10017040
835 Ga0207711_10014059
836 Ga0207711_10043809
837 Ga0207711_10058450
838 Ga0207711_10155934
839 Ga0207711_10903978
840 Ga0207689_10000724
841 Ga0207661_10001283
842 Ga0207661_10059682
843 Ga0207661_10138935
844 Ga0207661_10314799
845 Ga0207661_10433514
846 Ga0207679_10061885
847 Ga0207667_10006194
848 Ga0207667_10007633
849 Ga0207667_10009516
850 Ga0207667_10012818
851 Ga0207667_10025432
852 Ga0207667_10026234
853 Ga0207667_10035816
854 Ga0207667_10073432
855 Ga0207667_10212215
856 Ga0207712_10030122
857 Ga0207640_10000028
858 Ga0207640_10020918
859 Ga0207640_10354319
860 Ga0207658_10003428
861 Ga0207677_10000143
862 Ga0207677_10585248
863 Ga0207703_10004820
864 Ga0207639_10000088
865 Ga0207639_10000371
866 Ga0207639_10016992
867 Ga0207639_10102623
868 Ga0207639_10194100
869 Ga0207639_10259218
870 Ga0207639_10339955
871 Ga0207678_10003339
872 Ga0207678_10017744
873 Ga0207678_10056161
874 Ga0207678_10149736
875 Ga0207702_10001334
876 Ga0207702_10002672
877 Ga0207702_10084650
878 Ga0207641_10383631
879 Ga0207676_10002595
880 Ga0207676_10052862
881 Ga0207676_10495121
882 Ga0207674_10000669
883 Ga0207674_10005472
884 Ga0207674_10048839
885 Ga0207674_10430583
886 Ga0207674_10705703
887 Ga0207698_10000003
888 Ga0207698_10000708
889 Ga0207698_10099445
890 Ga0207698_10105923
891 Ga0207698_10144796
892 Ga0268266_10005265
893 Ga0268266_10006399
894 Ga0268266_10008807
895 Ga0268264_10000598
896 Ga0265338_10017734
897 Ga0265338_10117655
898 Ga0265338_10225494
899 Ga0265324_10009104
900 Ga0265760_10133851
901 Ga0265330_10000273
902 Ga0265330_10116345
903 Ga0265328_10005053
904 Ga0265328_10049572
905 Ga0265325_10000266
906 Ga0265325_10023750
907 Ga0265325_10024784
908 Ga0265340_10012505
909 Ga0265339_10000124
910 Ga0265339_10000194
911 Ga0265339_10009288
912 Ga0265316_10003105
913 Ga0265316_10006699
914 Ga0265316_10012685
915 Ga0265313_10002216
916 Ga0265313_10005380
917 Ga0265313_10021496
918 Ga0265313_10093326
919 Ga0265314_10002987
920 Ga0265314_10021888
921 Ga0265342_10000225
922 Ga0265342_10001536
923 Ga0265342_10027916
924 Ga0265342_10181726
925 Ga0307510_10071107
926 Ga0307510_10094785
927 Ga0373956_0021847
928 Ga0373955_0007147
929 Ga0373937_0019961
930 Ga0373937_0180871
931 Ga0373937_0266593
932 Ga0373937_0297238
933 Ga0373925_0401553
934 Ga0395900_0025848
935 Ga0395898_0027814
936 Ga0395898_0459394
937 Ga0439448_0015255
938 Ga0466969_0024581
939 Ga0466966_0040099
940 Ga0466966_0256512
941 Ga0466966_0382439
942 Ga0466961_0122066
943 Ga0466961_0305674
944 Ga0466963_0000494
945 Ga0466963_0010164
946 Ga0466963_0098713
947 Ga0466963_0215755
948 Ga0466958_0007910
949 Ga0466958_0219357
950 Ga0466967_0001401
951 Ga0466967_0001893
952 Ga0466967_0046813
953 Ga0495592_0418821
954 Ga0495603_0009924
955 Ga0495629_0011020
956 Ga0495629_0092572
957 Ga0495629_0190528
958 Ga0495651_0290033
959 Ga0495650_0000038
960 Ga0495650_0002342
961 Ga0495580_0089761
962 Ga0495580_0103353
963 Ga0495580_0320237
964 Ga0495580_0447252
965 Ga0495582_0001853
966 Ga0495582_0067225
967 Ga0495582_0080396
968 Ga0495639_0004538
969 Ga0495662_0006308
970 Ga0495664_0001348
971 Ga0495664_0049296
972 Ga0495664_0065290
973 Ga0495585_0025037
974 Ga0495594_0001190
975 Ga0495594_0004431
976 Ga0495594_0043704
977 Ga0495594_0056792
978 Ga0495596_0116450
979 Ga0495606_0024321
980 Ga0495606_0026137
981 Ga0495618_0037508
982 Ga0495628_0015738
983 Ga0495628_0033438
984 Ga0495631_0010490
985 Ga0495631_0038676
986 Ga0495644_0000048
987 Ga0495648_0228481
988 Ga0495666_0024917
989 Ga0495652_0006640
990 Ga0495652_0020698
991 Ga0495665_0009651
992 Ga0495665_0194702
993 Ga0495640_0004801
994 Ga0495640_0270223
995 Ga0495586_0019711
996 Ga0495587_0007267
997 Ga0495609_0048103
998 Ga0495645_0004272
999 Ga0495645_0014554
1000 Ga0495645_0039222
1001 Ga0495645_0120435
1002 Ga0495622_0112645
1003 Ga0495633_0013243
1004 Ga0495667_0015039
1005 Ga0495667_0161695
1006 Ga0495634_0006225
1007 Ga0495611_0005877
1008 Ga0495625_0000985
1009 Ga0495625_0017473
1010 Ga0495625_0026175
1011 Ga0495635_0002836
1012 Ga0495635_0197292
1013 Ga0495635_0396171
1014 Ga0495661_0021941
1015 Ga0495588_0068626
1016 Ga0495599_0037006
1017 Ga0495599_0163875
1018 Ga0495623_0073201
1019 Ga0495646_0013211
1020 Ga0495646_0087913
1021 Ga0495646_0115119
1022 Ga0495669_0015601
1023 Ga0495613_0003966
1024 Ga0495613_0048075
1025 Ga0495613_0164464
1026 Ga0495649_0200934
1027 Ga0495600_0012858
1028 Ga0495600_0126930
1029 Ga0495600_0292340
1030 Ga0495581_0001976
1031 Ga0495581_0044298
1032 Ga0495604_0009666
1033 Ga0495604_0032429
1034 Ga0495636_0118561
1035 Ga0495674_0011368
1036 Ga0495674_0014334
1037 Ga0495674_0410310
1038 Ga0495672_0021506
1039 Ga0495672_0051848
1040 Ga0495676_0008961
1041 Ga0495680_0017467
1042 Ga0495683_0112571
1043 Ga0495675_0079836
1044 Ga0495685_085712
1045 Ga0495684_0087091
1046 Ga0495684_0114087
1047 Ga0495686_0000178
1048 Ga0495686_0001621
1049 Ga0495686_0016441
1050 Ga0495686_0022023
1051 Ga0495686_0062732
1052 Ga0495686_0096671
1053 Ga0495686_0107665
1054 Ga0495593_0061551
1055 Ga0495602_0446209
1056 Ga0495614_0000972
1057 Ga0495614_0009178
1058 Ga0496100_0062884
1059 Ga0496104_0000053
1060 Ga0496104_0187129
1061 Ga0496105_0063911
1062 Ga0496106_0042478
1063 Ga0496106_0141941
1064 Ga0496107_0250908
1065 Ga0496108_0226841
1066 Ga0496112_0021005
1067 Ga0496113_0102885
1068 Ga0496114_0203080
1069 Ga0496114_0410947
1070 Ga0496114_0523799
1071 Ga0496115_0240623
1072 Ga0496115_0444936
1073 Ga0496118_0174174
1074 Ga0496126_0000014
1075 Ga0496126_0000100
1076 Ga0496126_0000154
1077 Ga0496126_0018324
1078 Ga0496126_0032919
1079 Ga0496126_0742955
1080 Ga0495682_0028164
1081 Ga0495682_0046605
1082 Ga0495682_0184060
1083 Ga0501031_0152929
1084 Ga0501032_0001912
1085 Ga0501033_0060607
1086 Ga0501034_0169330
1087 Ga0501036_0081969
1088 Ga0501036_0775796
1089 Ga0501037_0193654
1090 Ga0501038_0005281
1091 Ga0501043_0003983
1092 Ga0501043_0083888
1093 Ga0501046_0000056
1094 Ga0501047_0008947
1095 Ga0501047_0011287
1096 Ga0501047_0773248
1097 Ga0501048_0041932
1098 Ga0501070_0068724
1099 Ga0501070_0334038
1100 Ga0501070_0403480
1101 Ga0501073_0018854
1102 Ga0501073_0039812
1103 Ga0501080_0014166
1104 Ga0501035_0168491
1105 Ga0501035_0182448
1106 Ga0501044_0027240
1107 Ga0501044_0061163
1108 Ga0495601_0461962
1109 Ga0495619_0197192
1110 Ga0500651_0000005
1111 Ga0500595_000004
1112 Ga0500595_007997
1113 Ga0500661_002167
1114 2884217804

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00977

His_biosynth

Histidine biosynthesis protein

21

243

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
3tdm-assembly2.cif.gz_C computationally designed tim-barrel protein, halfflr 0.8814 121 220
3tdn-assembly1.cif.gz_A computationally designed two-fold symmetric tim-barrel protein, flr 0.876 121 222
4tx9-assembly1.cif.gz_A crystal structure of hisap from streptomyces sviceus with degraded profar 0.8713 1 223
5a5w-assembly1.cif.gz_A crystal structure of salmonella enterica hisa d7n d176a with profar 0.8607 1 223
4u28-assembly1.cif.gz_A crystal structure of apo phosphoribosyl isomerase a from streptomyces sviceus atcc 29083 0.8567 1 223
ID Description Score Start End Superfamily
af_Q58927_1_237_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.9216 1 224 3.20.20.70
af_Q58927_1_237_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.8899 1 224 3.20.20.70
af_Q2FUU2_4_232_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.8853 1 217 3.20.20.70
3tdnA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.876 121 222 3.40.50.12600
af_P10371_1_245_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.8713 1 224 3.20.20.70
ID Description Score Start End GO Terms
AF-A0A1Q3QSG6-F1-model_v4 1-(5-phosphoribosyl)-5-((5-phosphoribosylamino)methylideneamino)imidazole-4-carboxamide isomerase 0.9947 1 225 GO:0000105
GO:0000162
GO:0003949
GO:0005737
AF-A0A2V9PB54-F1-model_v4 1-(5-phosphoribosyl)-5-((5-phosphoribosylamino)methylideneamino)imidazole-4-carboxamide isomerase 0.9931 118 225 GO:0000105
GO:0000162
GO:0003949
GO:0005737
AF-A0A2V9U255-F1-model_v4 1-(5-phosphoribosyl)-5-((5-phosphoribosylamino)methylideneamino)imidazole-4-carboxamide isomerase 0.9929 124 223 GO:0000105
GO:0000162
GO:0003949
GO:0005737
AF-A0A6L7WT22-F1-model_v4 1-(5-phosphoribosyl)-5-((5-phosphoribosylamino)methylideneamino)imidazole-4-carboxamide isomerase 0.9835 107 224 GO:0000105
GO:0000162
GO:0003949
GO:0005737
AF-A0A2V8BMN4-F1-model_v4 1-(5-phosphoribosyl)-5-((5-phosphoribosylamino)methylideneamino)imidazole-4-carboxamide isomerase 0.9809 109 209 GO:0000105
GO:0000162
GO:0003949
GO:0005737

Map