F463159

General Info

Members Datasets Scaffolds Average Seq Length
555 259 1110 328

Family's Representative Sequence

Representative Sequence 3300053085|Ga0495619_0117131|Ga0495619_0117131_21_1406
Length 320
Sequence VKGRGTVIFPMVESARGLSLELMSFDVAPKQDLYTRQGVAVTVEAVAQIKVKSDPESILTAAEQFLTKSPEEREGLIRLVMEGHLRGIIGQLTVEQIVKEPEMVADRMRSTCADDMNKMGLEVVSFTIKEVRDKNQYIMNMGRPDIARIKRDADIAAVAEAVAVDRVRKEGEIKVQEAEILRRERELAATVLKDAEAQRKRIETEYNEAAVIDKLIGGLPEVVRAFAEPLSKVDKITVVSTGGDGGAGVNKITADMAQMVAQVPALIESLTGKNLHELMQRVRRIDSNDGTPVKSPADVSIGTSSTTVRKSRAEEGKGGR

Samples

Sample ID Description Type Environment
1 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
15 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
16 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
17 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
18 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
19 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
20 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
21 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
22 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
23 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
24 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
25 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
26 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
27 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
28 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
29 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
30 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
31 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
32 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
33 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
34 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
35 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
36 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
37 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
38 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
39 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
40 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
41 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
42 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
43 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
44 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
45 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
46 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
47 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
48 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
49 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
50 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
51 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
52 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
53 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
54 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
55 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
56 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
57 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
58 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
59 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
60 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
61 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
62 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
63 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
64 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
65 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
66 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
67 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
68 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
69 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
70 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
71 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
72 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
73 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
74 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
75 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
76 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
77 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
78 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
79 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
80 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
81 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
82 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
83 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
84 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
85 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
86 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
87 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
88 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
89 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
90 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
91 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
92 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
93 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
94 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
95 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
96 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
97 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
98 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
99 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
100 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
101 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
102 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
103 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
104 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
105 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
106 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
164 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
165 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
166 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
167 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
168 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
169 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
170 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
171 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
172 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
173 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
174 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
175 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
176 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
177 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
178 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
179 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
180 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
181 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
182 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
183 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
184 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
185 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
186 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
187 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
188 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
189 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
190 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
191 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
192 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
193 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
194 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
195 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
196 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
197 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
198 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
199 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
200 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
201 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
202 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
203 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
204 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
205 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
206 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
207 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
208 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
209 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
210 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
211 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
212 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
213 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
214 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
215 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
216 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
217 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
218 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
219 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
220 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
221 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
222 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
223 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
224 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
225 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
226 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
227 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
228 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
229 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
230 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
231 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
232 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
233 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
234 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
235 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
236 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
237 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
238 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
239 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
240 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
241 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
242 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
243 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
244 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
245 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
246 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
247 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
248 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
249 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
250 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
251 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
252 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
253 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
254 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
255 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
256 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
257 3300059511 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
258 3300059513 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 59R_AW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
259 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.92
Metatranscriptomes 1.08
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 2.7
Rhizosphere 94.77
Stem 0
Stem Tuber 0
Unclassified 4.68

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495619_0117131 3300053085 Bacteria 1824
2 JGI25406J46586_10032927 3300003203 Bacteria 1920
3 Ga0065712_10076384 3300005290 Bacteria 3672
4 Ga0065715_10002194 3300005293 Bacteria 6608
5 Ga0070676_10037577 3300005328 Bacteria 2793
6 Ga0070683_100004020 3300005329 Bacteria 12043
7 Ga0070683_100021544 3300005329 Bacteria 5753
8 Ga0070683_100096066 3300005329 Bacteria 2787
9 Ga0070690_100012600 3300005330 Bacteria 4977
10 Ga0070690_100014122 3300005330 Bacteria 4734
11 Ga0070690_100020132 3300005330 Bacteria 4061
12 Ga0070670_100004616 3300005331 Bacteria 11557
13 Ga0070670_100007257 3300005331 Bacteria 9395
14 Ga0070670_100007701 3300005331 Bacteria 9156
15 Ga0070670_100022213 3300005331 Bacteria 5461
16 Ga0068869_100036135 3300005334 Bacteria 3506
17 Ga0070666_10005814 3300005335 Bacteria 7579
18 Ga0070666_10011999 3300005335 Bacteria 5453
19 Ga0070666_10024461 3300005335 Bacteria 3934
20 Ga0070666_10029379 3300005335 Bacteria 3613
21 Ga0070680_100005355 3300005336 Bacteria 9708
22 Ga0070680_100007894 3300005336 Bacteria 8116
23 Ga0068868_100000844 3300005338 Bacteria 20760
24 Ga0068868_100002730 3300005338 Bacteria 12227
25 Ga0068868_100004230 3300005338 Bacteria 10040
26 Ga0068868_100015978 3300005338 Bacteria 5566
27 Ga0068868_100030580 3300005338 Bacteria 4129
28 Ga0068868_100041608 3300005338 Bacteria 3580
29 Ga0068868_100076406 3300005338 Bacteria 2678
30 Ga0070660_100003668 3300005339 Bacteria 10602
31 Ga0070660_100023246 3300005339 Bacteria 4592
32 Ga0070687_100001054 3300005343 Bacteria 9430
33 Ga0070661_100022211 3300005344 Bacteria 4541
34 Ga0070692_10009015 3300005345 Bacteria 4478
35 Ga0070668_100002463 3300005347 Bacteria 13629
36 Ga0070669_100040509 3300005353 Bacteria 3386
37 Ga0070675_100011164 3300005354 Bacteria 7028
38 Ga0070675_100034798 3300005354 Bacteria 4089
39 Ga0070673_100000787 3300005364 Bacteria 17668
40 Ga0070673_100021628 3300005364 Bacteria 4668
41 Ga0070673_100046203 3300005364 Bacteria 3381
42 Ga0070673_100134988 3300005364 Bacteria 2076
43 Ga0070659_100007534 3300005366 Bacteria 7909
44 Ga0070659_100021419 3300005366 Bacteria 4923
45 Ga0070659_100055313 3300005366 Bacteria 3127
46 Ga0070667_100006479 3300005367 Bacteria 9735
47 Ga0070667_100075233 3300005367 Bacteria 2882
48 Ga0070709_10011011 3300005434 Bacteria 5025
49 Ga0070709_10094546 3300005434 Bacteria 1978
50 Ga0070714_100027108 3300005435 Bacteria 4741
51 Ga0070714_100091693 3300005435 Bacteria 2662
52 Ga0070714_100095957 3300005435 Bacteria 2604
53 Ga0070714_100120146 3300005435 Bacteria 2336
54 Ga0070714_100155104 3300005435 Bacteria 2066
55 Ga0070713_100001107 3300005436 Bacteria 17171
56 Ga0070713_100054750 3300005436 Bacteria 3311
57 Ga0070713_100074067 3300005436 Bacteria 2884
58 Ga0070713_100076754 3300005436 Bacteria 2839
59 Ga0070713_100095873 3300005436 Bacteria 2560
60 Ga0070713_100140664 3300005436 Bacteria 2137
61 Ga0070711_100052613 3300005439 Bacteria 2803
62 Ga0070705_100061052 3300005440 Bacteria 2239
63 Ga0070708_100004535 3300005445 Bacteria 10936
64 Ga0070708_100038025 3300005445 Unclassified 4201
65 Ga0070708_100123945 3300005445 Unclassified 2386
66 Ga0070678_100022384 3300005456 Bacteria 4187
67 Ga0070678_100024025 3300005456 Bacteria 4072
68 Ga0070678_100078196 3300005456 Bacteria 2498
69 Ga0070662_100032687 3300005457 Bacteria 3657
70 Ga0070681_10003322 3300005458 Bacteria 15032
71 Ga0070681_10006241 3300005458 Bacteria 11592
72 Ga0070681_10009604 3300005458 Bacteria 9513
73 Ga0070681_10027068 3300005458 Bacteria 5766
74 Ga0070681_10035376 3300005458 Bacteria 5017
75 Ga0068867_100065724 3300005459 Bacteria 2700
76 Ga0070706_100001042 3300005467 Bacteria 30061
77 Ga0070706_100037594 3300005467 Bacteria 4470
78 Ga0070706_100052647 3300005467 Unclassified 3757
79 Ga0070706_100057976 3300005467 Bacteria 3574
80 Ga0070706_100086899 3300005467 Bacteria 2898
81 Ga0070706_100090333 3300005467 Unclassified 2840
82 Ga0070707_100001289 3300005468 Bacteria 24657
83 Ga0070707_100003096 3300005468 Bacteria 15744
84 Ga0070707_100054061 3300005468 Unclassified 3849
85 Ga0070707_100056320 3300005468 Unclassified 3770
86 Ga0070698_100000027 3300005471 Bacteria 98052
87 Ga0070698_100000185 3300005471 Bacteria 59098
88 Ga0070699_100016804 3300005518 Bacteria 6282
89 Ga0070699_100025754 3300005518 Bacteria 5070
90 Ga0070699_100120953 3300005518 Bacteria 2302
91 Ga0070679_100024956 3300005530 Bacteria 5860
92 Ga0070679_100057197 3300005530 Bacteria 3887
93 Ga0070679_100182751 3300005530 Bacteria 2069
94 Ga0070684_100011983 3300005535 Bacteria 6928
95 Ga0070684_100016110 3300005535 Bacteria 6107
96 Ga0070684_100204931 3300005535 Bacteria 1797
97 Ga0070697_100000183 3300005536 Bacteria 51905
98 Ga0070697_100006896 3300005536 Bacteria 8827
99 Ga0070697_100098899 3300005536 Unclassified 2421
100 Ga0070697_100152221 3300005536 Bacteria 1950
101 Ga0070697_100207147 3300005536 Bacteria 1669
102 Ga0068853_100132991 3300005539 Bacteria 2228
103 Ga0070672_100008301 3300005543 Bacteria 7095
104 Ga0070672_100066355 3300005543 Bacteria 2857
105 Ga0070695_100032117 3300005545 Bacteria 3281
106 Ga0070696_100010145 3300005546 Bacteria 6305
107 Ga0070693_100011003 3300005547 Bacteria 4548
108 Ga0068855_100005590 3300005563 Bacteria 15341
109 Ga0068855_100050798 3300005563 Bacteria 4884
110 Ga0068855_100134337 3300005563 Unclassified 2823
111 Ga0068855_100167120 3300005563 Bacteria 2493
112 Ga0070664_100000301 3300005564 Bacteria 35830
113 Ga0070664_100034964 3300005564 Bacteria 4217
114 Ga0070664_100040838 3300005564 Bacteria 3913
115 Ga0068857_100000103 3300005577 Bacteria 49957
116 Ga0068854_100004048 3300005578 Bacteria 9205
117 Ga0068854_100046015 3300005578 Bacteria 3105
118 Ga0068856_100001280 3300005614 Bacteria 26462
119 Ga0068856_100003228 3300005614 Bacteria 16600
120 Ga0068856_100003702 3300005614 Bacteria 15340
121 Ga0068852_100008164 3300005616 Bacteria 7688
122 Ga0068852_100038698 3300005616 Bacteria 4009
123 Ga0068859_100002719 3300005617 Bacteria 17930
124 Ga0068859_100017542 3300005617 Bacteria 7197
125 Ga0068859_100042231 3300005617 Bacteria 4580
126 Ga0068859_100074097 3300005617 Bacteria 3443
127 Ga0068864_100001748 3300005618 Bacteria 17856
128 Ga0068864_100001761 3300005618 Bacteria 17817
129 Ga0068864_100003558 3300005618 Bacteria 12876
130 Ga0068864_100004732 3300005618 Bacteria 11146
131 Ga0068866_10004179 3300005718 Bacteria 5923
132 Ga0068861_100031071 3300005719 Bacteria 3919
133 Ga0068870_10001845 3300005840 Bacteria 8714
134 Ga0068863_100001797 3300005841 Bacteria 21288
135 Ga0068863_100012777 3300005841 Bacteria 8097
136 Ga0068863_100057801 3300005841 Bacteria 3670
137 Ga0068863_100079878 3300005841 Bacteria 3098
138 Ga0068858_100007549 3300005842 Bacteria 10509
139 Ga0068858_100008063 3300005842 Bacteria 10144
140 Ga0068858_100009434 3300005842 Bacteria 9310
141 Ga0068858_100033742 3300005842 Bacteria 4747
142 Ga0068860_100047715 3300005843 Bacteria 4081
143 Ga0068860_100062464 3300005843 Bacteria 3539
144 Ga0068862_100047568 3300005844 Bacteria 3661
145 Ga0081455_10023072 3300005937 Bacteria 5797
146 Ga0081539_10000237 3300005985 Bacteria 129370
147 Ga0070717_10001985 3300006028 Bacteria 14304
148 Ga0070717_10003732 3300006028 Bacteria 10941
149 Ga0070717_10014154 3300006028 Bacteria 6133
150 Ga0070717_10064888 3300006028 Bacteria 3034
151 Ga0070712_100010243 3300006175 Bacteria 5911
152 Ga0070712_100014090 3300006175 Bacteria 5127
153 Ga0097621_100000535 3300006237 Bacteria 26691
154 Ga0097621_100050934 3300006237 Bacteria 3368
155 Ga0097621_100203948 3300006237 Bacteria 1718
156 Ga0068871_100005651 3300006358 Bacteria 8772
157 Ga0068871_100007875 3300006358 Bacteria 7637
158 Ga0068871_100012292 3300006358 Bacteria 6307
159 Ga0075428_100036657 3300006844 Bacteria 5401
160 Ga0075431_100056694 3300006847 Bacteria 4040
161 Ga0075433_10000915 3300006852 Bacteria 20739
162 Ga0075433_10022505 3300006852 Bacteria 5290
163 Ga0075434_100010220 3300006871 Bacteria 8790
164 Ga0075434_100017692 3300006871 Bacteria 6871
165 Ga0075434_100038690 3300006871 Bacteria 4725
166 Ga0075434_100100284 3300006871 Bacteria 2902
167 Ga0075434_100153266 3300006871 Unclassified 2324
168 Ga0075429_100043479 3300006880 Unclassified 3909
169 Ga0075429_100053661 3300006880 Bacteria 3507
170 Ga0068865_100006668 3300006881 Bacteria 7062
171 Ga0068865_100043579 3300006881 Bacteria 3067
172 Ga0075436_100002429 3300006914 Bacteria 12836
173 Ga0075436_100043356 3300006914 Bacteria 3102
174 Ga0075436_100085234 3300006914 Bacteria 2193
175 Ga0097620_100002719 3300006931 Bacteria 17930
176 Ga0097620_100017540 3300006931 Bacteria 7197
177 Ga0097620_100042228 3300006931 Bacteria 4580
178 Ga0097620_100074095 3300006931 Bacteria 3443
179 Ga0075435_100008334 3300007076 Bacteria 7428
180 Ga0075435_100038641 3300007076 Bacteria 3805
181 Ga0075435_100054691 3300007076 Bacteria 3222
182 Ga0105240_10006009 3300009093 Bacteria 17948
183 Ga0105240_10105939 3300009093 Bacteria 3412
184 Ga0105240_10150857 3300009093 Bacteria 2768
185 Ga0105240_10188043 3300009093 Bacteria 2431
186 Ga0111539_10230898 3300009094 Bacteria 2154
187 Ga0105245_10003727 3300009098 Bacteria 13582
188 Ga0105245_10085903 3300009098 Bacteria 2884
189 Ga0105247_10014131 3300009101 Bacteria 4789
190 Ga0114129_10001255 3300009147 Bacteria 33858
191 Ga0114129_10136377 3300009147 Bacteria 3367
192 Ga0114129_10251705 3300009147 Bacteria 2371
193 Ga0114129_10412741 3300009147 Bacteria 1777
194 Ga0105243_10016267 3300009148 Bacteria 5629
195 Ga0105242_10051547 3300009176 Bacteria 3354
196 Ga0105242_10125019 3300009176 Bacteria 2212
197 Ga0105248_10016904 3300009177 Bacteria 8033
198 Ga0105248_10020531 3300009177 Bacteria 7322
199 Ga0105248_10287473 3300009177 Bacteria 1851
200 Ga0105237_10006907 3300009545 Bacteria 12518
201 Ga0105237_10016506 3300009545 Bacteria 7671
202 Ga0105238_10013500 3300009551 Bacteria 8247
203 Ga0105238_10014699 3300009551 Bacteria 7914
204 Ga0105238_10015292 3300009551 Bacteria 7773
205 Ga0105238_10125169 3300009551 Bacteria 2550
206 Ga0105238_10248926 3300009551 Bacteria 1755
207 Ga0099796_10008281 3300010159 Bacteria 2766
208 Ga0105239_10022785 3300010375 Bacteria 6903
209 Ga0105239_10050506 3300010375 Bacteria 4561
210 Ga0105239_10073949 3300010375 Bacteria 3747
211 Ga0105239_10255637 3300010375 Bacteria 1968
212 Ga0157373_10006716 3300013100 Bacteria 8566
213 Ga0157371_10007154 3300013102 Bacteria 9064
214 Ga0157371_10079125 3300013102 Bacteria 2329
215 Ga0157370_10009367 3300013104 Bacteria 10474
216 Ga0157370_10076830 3300013104 Bacteria 3145
217 Ga0157369_10000739 3300013105 Bacteria 42128
218 Ga0157369_10070041 3300013105 Bacteria 3768
219 Ga0157369_10184035 3300013105 Unclassified 2197
220 Ga0157369_10184685 3300013105 Bacteria 2193
221 Ga0157374_10000628 3300013296 Bacteria 31060
222 Ga0157374_10002075 3300013296 Bacteria 16865
223 Ga0157374_10007435 3300013296 Bacteria 9343
224 Ga0157374_10010750 3300013296 Bacteria 7890
225 Ga0157374_10018562 3300013296 Bacteria 6141
226 Ga0157378_10000570 3300013297 Bacteria 34853
227 Ga0157378_10075353 3300013297 Unclassified 3038
228 Ga0157378_10079904 3300013297 Bacteria 2953
229 Ga0163162_10043813 3300013306 Bacteria 4480
230 Ga0157372_10004647 3300013307 Bacteria 14596
231 Ga0157372_10022295 3300013307 Bacteria 6851
232 Ga0157375_10022018 3300013308 Bacteria 5860
233 Ga0157375_10022655 3300013308 Bacteria 5784
234 Ga0157375_10035315 3300013308 Bacteria 4770
235 Ga0157375_10036921 3300013308 Bacteria 4677
236 Ga0157375_10068756 3300013308 Bacteria 3545
237 Ga0163163_10001699 3300014325 Bacteria 18602
238 Ga0163163_10002554 3300014325 Bacteria 15423
239 Ga0163163_10012085 3300014325 Bacteria 7856
240 Ga0163163_10054068 3300014325 Bacteria 3966
241 Ga0163163_10078430 3300014325 Bacteria 3299
242 Ga0163163_10085972 3300014325 Bacteria 3153
243 Ga0163163_10215278 3300014325 Bacteria 1970
244 Ga0157379_10005151 3300014968 Bacteria 11221
245 Ga0157376_10000976 3300014969 Bacteria 18660
246 Ga0157376_10008851 3300014969 Bacteria 7283
247 Ga0157376_10021284 3300014969 Bacteria 5036
248 Ga0157376_10120013 3300014969 Bacteria 2328
249 Ga0197907_10001997 3300020069 Bacteria 3203
250 Ga0206356_10311795 3300020070 Unclassified 2730
251 Ga0213873_10006983 3300021358 Bacteria 2244
252 Ga0213872_10000243 3300021361 Bacteria 48124
253 Ga0213875_10000017 3300021388 Bacteria 239813
254 Ga0213875_10010010 3300021388 Bacteria 4769
255 Ga0213875_10045794 3300021388 Bacteria 2053
256 Ga0213875_10054049 3300021388 Bacteria 1881
257 Ga0213875_10073815 3300021388 Bacteria 1592
258 Ga0213871_10002691 3300021441 Bacteria 3310
259 Ga0213871_10019145 3300021441 Bacteria 1683
260 Ga0224712_10006657 3300022467 Unclassified 3313
261 Ga0207682_10013078 3300025893 Bacteria 3234
262 Ga0207688_10004558 3300025901 Bacteria 7541
263 Ga0207680_10012846 3300025903 Bacteria 4278
264 Ga0207647_10005231 3300025904 Bacteria 9553
265 Ga0207647_10016345 3300025904 Bacteria 5066
266 Ga0207647_10026388 3300025904 Bacteria 3802
267 Ga0207699_10040072 3300025906 Unclassified 2697
268 Ga0207699_10119004 3300025906 Bacteria 1705
269 Ga0207645_10020169 3300025907 Bacteria 4365
270 Ga0207643_10000546 3300025908 Bacteria 24125
271 Ga0207684_10001740 3300025910 Bacteria 23019
272 Ga0207684_10002001 3300025910 Bacteria 21005
273 Ga0207684_10076992 3300025910 Bacteria 2836
274 Ga0207654_10039024 3300025911 Bacteria 2668
275 Ga0207654_10052719 3300025911 Bacteria 2345
276 Ga0207707_10004046 3300025912 Bacteria 12995
277 Ga0207707_10017650 3300025912 Bacteria 6224
278 Ga0207707_10018544 3300025912 Bacteria 6066
279 Ga0207707_10021117 3300025912 Bacteria 5690
280 Ga0207707_10043747 3300025912 Bacteria 3905
281 Ga0207707_10054558 3300025912 Bacteria 3479
282 Ga0207707_10064032 3300025912 Bacteria 3200
283 Ga0207707_10100307 3300025912 Unclassified 2530
284 Ga0207695_10002039 3300025913 Bacteria 30971
285 Ga0207695_10020345 3300025913 Bacteria 7606
286 Ga0207695_10063389 3300025913 Bacteria 3812
287 Ga0207671_10039928 3300025914 Bacteria 3475
288 Ga0207671_10049698 3300025914 Bacteria 3105
289 Ga0207671_10053409 3300025914 Bacteria 2994
290 Ga0207693_10000517 3300025915 Bacteria 34803
291 Ga0207693_10001987 3300025915 Bacteria 17937
292 Ga0207693_10011436 3300025915 Bacteria 7184
293 Ga0207693_10065771 3300025915 Bacteria 2838
294 Ga0207663_10066840 3300025916 Bacteria 2303
295 Ga0207660_10007199 3300025917 Bacteria 7202
296 Ga0207660_10011893 3300025917 Bacteria 5677
297 Ga0207662_10001281 3300025918 Bacteria 12101
298 Ga0207657_10002880 3300025919 Bacteria 18488
299 Ga0207657_10033933 3300025919 Bacteria 4595
300 Ga0207649_10000666 3300025920 Bacteria 22943
301 Ga0207652_10052638 3300025921 Bacteria 3495
302 Ga0207652_10056450 3300025921 Unclassified 3380
303 Ga0207646_10001845 3300025922 Bacteria 25580
304 Ga0207646_10016099 3300025922 Bacteria 7027
305 Ga0207646_10059356 3300025922 Bacteria 3416
306 Ga0207681_10007705 3300025923 Bacteria 6595
307 Ga0207694_10002164 3300025924 Bacteria 16156
308 Ga0207694_10164245 3300025924 Unclassified 1795
309 Ga0207650_10000097 3300025925 Bacteria 115583
310 Ga0207650_10004072 3300025925 Bacteria 9992
311 Ga0207650_10004597 3300025925 Bacteria 9439
312 Ga0207650_10005601 3300025925 Bacteria 8582
313 Ga0207659_10018070 3300025926 Bacteria 4616
314 Ga0207687_10008830 3300025927 Bacteria 6586
315 Ga0207687_10039855 3300025927 Bacteria 3218
316 Ga0207700_10043303 3300025928 Bacteria 3306
317 Ga0207700_10082987 3300025928 Unclassified 2508
318 Ga0207700_10102776 3300025928 Bacteria 2283
319 Ga0207664_10047540 3300025929 Bacteria 3371
320 Ga0207664_10087640 3300025929 Bacteria 2545
321 Ga0207664_10093865 3300025929 Bacteria 2465
322 Ga0207644_10006658 3300025931 Bacteria 7530
323 Ga0207644_10013687 3300025931 Bacteria 5415
324 Ga0207690_10002849 3300025932 Bacteria 10434
325 Ga0207690_10020371 3300025932 Bacteria 4097
326 Ga0207706_10001115 3300025933 Bacteria 27316
327 Ga0207706_10148852 3300025933 Bacteria 2059
328 Ga0207686_10041301 3300025934 Bacteria 2811
329 Ga0207686_10095394 3300025934 Bacteria 1974
330 Ga0207704_10010246 3300025938 Bacteria 4563
331 Ga0207665_10000188 3300025939 Bacteria 41567
332 Ga0207665_10038450 3300025939 Bacteria 3186
333 Ga0207665_10039865 3300025939 Bacteria 3133
334 Ga0207691_10025144 3300025940 Bacteria 5594
335 Ga0207711_10005198 3300025941 Bacteria 11021
336 Ga0207711_10053858 3300025941 Bacteria 3451
337 Ga0207689_10000078 3300025942 Bacteria 79810
338 Ga0207689_10032305 3300025942 Bacteria 4355
339 Ga0207661_10000124 3300025944 Bacteria 49095
340 Ga0207661_10072366 3300025944 Bacteria 2820
341 Ga0207661_10089881 3300025944 Bacteria 2556
342 Ga0207661_10102153 3300025944 Bacteria 2410
343 Ga0207679_10000065 3300025945 Bacteria 97825
344 Ga0207679_10011857 3300025945 Bacteria 5665
345 Ga0207679_10034589 3300025945 Bacteria 3567
346 Ga0207667_10026812 3300025949 Bacteria 6288
347 Ga0207667_10040306 3300025949 Bacteria 4974
348 Ga0207667_10089376 3300025949 Bacteria 3184
349 Ga0207667_10162531 3300025949 Unclassified 2296
350 Ga0207667_10173099 3300025949 Bacteria 2219
351 Ga0207651_10007316 3300025960 Bacteria 5869
352 Ga0207651_10031525 3300025960 Bacteria 3390
353 Ga0207651_10034427 3300025960 Bacteria 3280
354 Ga0207712_10071270 3300025961 Bacteria 2499
355 Ga0207640_10004484 3300025981 Bacteria 7572
356 Ga0207640_10029742 3300025981 Bacteria 3356
357 Ga0207640_10136390 3300025981 Unclassified 1782
358 Ga0207640_10151262 3300025981 Bacteria 1705
359 Ga0207658_10002380 3300025986 Bacteria 13779
360 Ga0207658_10012823 3300025986 Bacteria 5724
361 Ga0207677_10003984 3300026023 Bacteria 7877
362 Ga0207677_10009003 3300026023 Bacteria 5601
363 Ga0207677_10027571 3300026023 Bacteria 3580
364 Ga0207677_10034288 3300026023 Bacteria 3285
365 Ga0207677_10102007 3300026023 Bacteria 2114
366 Ga0207703_10044126 3300026035 Bacteria 3581
367 Ga0207678_10002115 3300026067 Bacteria 17982
368 Ga0207678_10078888 3300026067 Bacteria 2820
369 Ga0207708_10007547 3300026075 Bacteria 8042
370 Ga0207702_10001813 3300026078 Bacteria 21024
371 Ga0207702_10004510 3300026078 Bacteria 12351
372 Ga0207702_10027973 3300026078 Bacteria 4684
373 Ga0207702_10156349 3300026078 Bacteria 2079
374 Ga0207702_10280080 3300026078 Bacteria 1576
375 Ga0207641_10000183 3300026088 Bacteria 87085
376 Ga0207641_10007002 3300026088 Bacteria 9432
377 Ga0207641_10028155 3300026088 Bacteria 4642
378 Ga0207648_10001532 3300026089 Bacteria 25442
379 Ga0207648_10051023 3300026089 Bacteria 3616
380 Ga0207676_10000428 3300026095 Bacteria 35461
381 Ga0207676_10002661 3300026095 Bacteria 12691
382 Ga0207676_10005679 3300026095 Bacteria 8828
383 Ga0207676_10067015 3300026095 Bacteria 2866
384 Ga0207674_10002308 3300026116 Bacteria 24156
385 Ga0207674_10007560 3300026116 Bacteria 12659
386 Ga0207683_10011542 3300026121 Bacteria 7542
387 Ga0207683_10074033 3300026121 Bacteria 3013
388 Ga0207698_10042559 3300026142 Bacteria 3395
389 Ga0268266_10012603 3300028379 Bacteria 7304
390 Ga0268265_10005701 3300028380 Bacteria 8504
391 Ga0268265_10083929 3300028380 Bacteria 2524
392 Ga0268264_10080102 3300028381 Bacteria 2788
393 Ga0265318_10008530 3300028577 Bacteria 4556
394 Ga0265323_10001748 3300028653 Bacteria 10307
395 Ga0265338_10012801 3300028800 Bacteria 9537
396 Ga0265338_10029627 3300028800 Bacteria 5419
397 Ga0265330_10008795 3300031235 Bacteria 4836
398 Ga0265332_10020452 3300031238 Bacteria 2922
399 Ga0265328_10006329 3300031239 Bacteria 5025
400 Ga0265325_10000662 3300031241 Bacteria 25143
401 Ga0265329_10015010 3300031242 Bacteria 2719
402 Ga0265340_10010908 3300031247 Bacteria 4847
403 Ga0265339_10010067 3300031249 Bacteria 5892
404 Ga0265339_10013023 3300031249 Bacteria 5056
405 Ga0265339_10023888 3300031249 Bacteria 3528
406 Ga0265316_10004619 3300031344 Bacteria 13660
407 Ga0265316_10009039 3300031344 Bacteria 9183
408 Ga0265316_10009297 3300031344 Bacteria 9056
409 Ga0265316_10015148 3300031344 Bacteria 6753
410 Ga0265316_10018857 3300031344 Bacteria 5923
411 Ga0265316_10119648 3300031344 Bacteria 1990
412 Ga0265316_10162469 3300031344 Bacteria 1669
413 Ga0265313_10006090 3300031595 Bacteria 8686
414 Ga0265314_10001321 3300031711 Bacteria 28108
415 Ga0265314_10028632 3300031711 Bacteria 4151
416 Ga0265342_10001391 3300031712 Bacteria 22622
417 Ga0265342_10057911 3300031712 Bacteria 2292
418 Ga0307410_10031845 3300031852 Bacteria 3388
419 Ga0307406_10016182 3300031901 Bacteria 4329
420 Ga0307409_100020506 3300031995 Bacteria 4508
421 Ga0307409_100106731 3300031995 Bacteria 2338
422 Ga0307411_10033410 3300032005 Bacteria 3191
423 Ga0307411_10081097 3300032005 Bacteria 2233
424 Ga0307415_100032005 3300032126 Bacteria 3397
425 Ga0373945_0002278 3300035116 Bacteria 6006
426 Ga0373956_0000706 3300035119 Bacteria 13756
427 Ga0373943_0010533 3300035170 Bacteria 4143
428 Ga0373924_0000972 3300035410 Bacteria 9074
429 Ga0373931_0019810 3300035691 Bacteria 3362
430 Ga0373935_0024605 3300035692 Bacteria 3708
431 Ga0373927_0002182 3300035695 Bacteria 14382
432 Ga0373927_0045807 3300035695 Bacteria 2829
433 Ga0373927_0046432 3300035695 Bacteria 2810
434 Ga0373927_0132418 3300035695 Bacteria 1629
435 Ga0373947_0011132 3300035725 Bacteria 5166
436 Ga0373947_0028871 3300035725 Bacteria 3253
437 Ga0373947_0093015 3300035725 Bacteria 1884
438 Ga0373937_0001970 3300036401 Bacteria 17179
439 Ga0373937_0002510 3300036401 Bacteria 15242
440 Ga0373937_0016950 3300036401 Bacteria 6478
441 Ga0373937_0022662 3300036401 Bacteria 5649
442 Ga0373937_0050323 3300036401 Bacteria 3816
443 Ga0373937_0127951 3300036401 Bacteria 2370
444 Ga0373925_0036610 3300037068 Bacteria 3622
445 Ga0373925_0115851 3300037068 Bacteria 2075
446 Ga0395905_0007860 3300037471 Bacteria 10563
447 Ga0395905_0070831 3300037471 Bacteria 3268
448 Ga0436364_0334239 3300037853 Bacteria 90865
449 Ga0436364_0339530 3300037853 Bacteria 240640
450 Ga0436364_0536423 3300037853 Bacteria 8209
451 Ga0436364_0783564 3300037853 Bacteria 3371
452 Ga0436364_0911386 3300037853 Bacteria 4171
453 Ga0436364_1293557 3300037853 Bacteria 2210
454 Ga0436364_1478897 3300037853 Bacteria 3194
455 Ga0436365_0144600 3300039437 Unclassified 2275
456 Ga0436365_0420645 3300039437 Bacteria 5489
457 Ga0436360_0161141 3300039438 Bacteria 12438
458 Ga0436360_1320695 3300039438 Bacteria 3063
459 Ga0436361_0335407 3300039447 Bacteria 151349
460 Ga0436362_0854104 3300039453 Bacteria 3262
461 Ga0436362_1295671 3300039453 Bacteria 1991
462 Ga0453683_0051122 3300044673 Bacteria 2589
463 Ga0466958_0014695 3300045836 Bacteria 4471
464 Ga0466967_0162667 3300045976 Bacteria 2096
465 Ga0495580_0000220 3300046472 Bacteria 44125
466 Ga0495580_0005164 3300046472 Bacteria 10859
467 Ga0495580_0005951 3300046472 Bacteria 10002
468 Ga0495580_0011061 3300046472 Bacteria 6997
469 Ga0495580_0017197 3300046472 Bacteria 5413
470 Ga0495580_0028999 3300046472 Bacteria 4020
471 Ga0495580_0076873 3300046472 Bacteria 2328
472 Ga0495582_0000979 3300046473 Bacteria 15974
473 Ga0495639_0020359 3300046475 Bacteria 2900
474 Ga0495662_0057689 3300046476 Bacteria 1875
475 Ga0495594_0025124 3300046499 Bacteria 3202
476 Ga0495608_0006025 3300046511 Bacteria 8617
477 Ga0495665_0006249 3300046531 Bacteria 6426
478 Ga0495665_0059121 3300046531 Bacteria 2023
479 Ga0495640_0126293 3300046533 Bacteria 1659
480 Ga0495586_0103954 3300046535 Bacteria 1578
481 Ga0495586_0107741 3300046535 Bacteria 1550
482 Ga0495645_0016382 3300046543 Bacteria 5290
483 Ga0495667_0000663 3300046559 Bacteria 21978
484 Ga0495634_0168423 3300046642 Bacteria 1378
485 Ga0495657_0010036 3300046675 Bacteria 7142
486 Ga0495658_0061304 3300046683 Bacteria 2159
487 Ga0495669_0022587 3300046684 Bacteria 2733
488 Ga0495604_0100222 3300047317 Bacteria 2130
489 Ga0495684_0088574 3300047471 Bacteria 2346
490 Ga0495593_0032117 3300047673 Bacteria 2864
491 Ga0496106_0045322 3300048909 Bacteria 3303
492 Ga0496108_0000263 3300048911 Bacteria 45358
493 Ga0496109_0000335 3300048912 Bacteria 43760
494 Ga0496109_0171439 3300048912 Bacteria 2036
495 Ga0496110_0001842 3300048913 Bacteria 15640
496 Ga0496111_0009746 3300048914 Bacteria 6421
497 Ga0496111_0074262 3300048914 Bacteria 2477
498 Ga0496112_0001799 3300048915 Bacteria 16870
499 Ga0496112_0005770 3300048915 Bacteria 10768
500 Ga0496112_0006803 3300048915 Bacteria 10076
501 Ga0496112_0007995 3300048915 Bacteria 9433
502 Ga0496112_0294587 3300048915 Bacteria 1568
503 Ga0496113_0000840 3300048916 Bacteria 16082
504 Ga0496113_0006317 3300048916 Bacteria 7497
505 Ga0496115_0116051 3300048918 Bacteria 2202
506 Ga0501031_0025457 3300049568 Bacteria 3858
507 Ga0501032_0001129 3300049569 Bacteria 21346
508 Ga0501033_0003504 3300049570 Bacteria 12863
509 Ga0501036_0000754 3300049572 Bacteria 23971
510 Ga0501037_0002378 3300049573 Bacteria 13582
511 Ga0501038_0003812 3300049574 Bacteria 14019
512 Ga0501039_0003317 3300049575 Bacteria 12041
513 Ga0501042_0119938 3300049578 Bacteria 1894
514 Ga0501043_0008597 3300049579 Bacteria 8047
515 Ga0501046_0002933 3300049580 Bacteria 15779
516 Ga0501048_0050348 3300049582 Bacteria 2967
517 Ga0501067_0004070 3300049583 Bacteria 8065
518 Ga0501068_0001857 3300049584 Bacteria 11215
519 Ga0501069_0002347 3300049585 Bacteria 9584
520 Ga0501070_0006464 3300049586 Bacteria 9976
521 Ga0501074_0087263 3300049590 Bacteria 2234
522 Ga0501079_0003914 3300049741 Bacteria 10998
523 Ga0501080_0000221 3300049742 Bacteria 42495
524 Ga0501083_0000648 3300049744 Bacteria 22482
525 Ga0501035_0013979 3300049822 Bacteria 7405
526 Ga0501044_0046677 3300049823 Bacteria 4483
527 nmdc:mga05p37_11828_c1 3300050507 Bacteria 10403
528 nmdc:mga05p37_165848_c1 3300050507 Bacteria 1777
529 nmdc:mga05p37_53786_c1 3300050507 Bacteria 4952
530 nmdc:mga05p37_8809_c1 3300050507 Bacteria 10240
531 nmdc:mga0qj67_55689_c1 3300050509 Unclassified 3133
532 nmdc:mga06r32_10940_c1 3300050510 Bacteria 8171
533 nmdc:mga06r32_273717_c1 3300050510 Bacteria 1676
534 nmdc:mga0n895_16650_c1 3300050512 Bacteria 6751
535 nmdc:mga0n895_190072_c1 3300050512 Bacteria 2084
536 nmdc:mga0n895_40316_c1 3300050512 Bacteria 4535
537 nmdc:mga0n895_77594_c1 3300050512 Bacteria 3305
538 nmdc:mga0rr50_19543_c1 3300050513 Bacteria 4576
539 nmdc:mga0rr50_200_c1 3300050513 Bacteria 32649
540 nmdc:mga0rr50_9039_c1 3300050513 Bacteria 6235
541 nmdc:mga0rr50_99993_c1 3300050513 Unclassified 2276
542 nmdc:mga08x19_1148_c1 3300050514 Bacteria 16534
543 nmdc:mga08x19_30597_c1 3300050514 Bacteria 3383
544 nmdc:mga08x19_49307_c1 3300050514 Unclassified 2700
545 nmdc:mga0a205_141025_c1 3300050515 Bacteria 2310
546 nmdc:mga0a205_14506_c1 3300050515 Bacteria 7352
547 nmdc:mga0a205_3819_c1 3300050515 Bacteria 13499
548 nmdc:mga0a205_67687_c1 3300050515 Bacteria 3450
549 Ga0495619_0133918 3300053085 Bacteria 1704
550 Ga0501084_0001446 3300054114 Bacteria 18876
551 Ga0587077_001670 3300059493 Bacteria 2441
552 Ga0587091_000858 3300059511 Unclassified 2970
553 Ga0587094_000803 3300059513 Bacteria 2701
554 Ga0501082_0000143 3300060353 Bacteria 59481
555 Ga0501082_0020856 3300060353 Bacteria 5652
556 Ga0495619_0117131
557 JGI25406J46586_10032927
558 Ga0065712_10076384
559 Ga0065715_10002194
560 Ga0070676_10037577
561 Ga0070683_100004020
562 Ga0070683_100021544
563 Ga0070683_100096066
564 Ga0070690_100012600
565 Ga0070690_100014122
566 Ga0070690_100020132
567 Ga0070670_100004616
568 Ga0070670_100007257
569 Ga0070670_100007701
570 Ga0070670_100022213
571 Ga0068869_100036135
572 Ga0070666_10005814
573 Ga0070666_10011999
574 Ga0070666_10024461
575 Ga0070666_10029379
576 Ga0070680_100005355
577 Ga0070680_100007894
578 Ga0068868_100000844
579 Ga0068868_100002730
580 Ga0068868_100004230
581 Ga0068868_100015978
582 Ga0068868_100030580
583 Ga0068868_100041608
584 Ga0068868_100076406
585 Ga0070660_100003668
586 Ga0070660_100023246
587 Ga0070687_100001054
588 Ga0070661_100022211
589 Ga0070692_10009015
590 Ga0070668_100002463
591 Ga0070669_100040509
592 Ga0070675_100011164
593 Ga0070675_100034798
594 Ga0070673_100000787
595 Ga0070673_100021628
596 Ga0070673_100046203
597 Ga0070673_100134988
598 Ga0070659_100007534
599 Ga0070659_100021419
600 Ga0070659_100055313
601 Ga0070667_100006479
602 Ga0070667_100075233
603 Ga0070709_10011011
604 Ga0070709_10094546
605 Ga0070714_100027108
606 Ga0070714_100091693
607 Ga0070714_100095957
608 Ga0070714_100120146
609 Ga0070714_100155104
610 Ga0070713_100001107
611 Ga0070713_100054750
612 Ga0070713_100074067
613 Ga0070713_100076754
614 Ga0070713_100095873
615 Ga0070713_100140664
616 Ga0070711_100052613
617 Ga0070705_100061052
618 Ga0070708_100004535
619 Ga0070708_100038025
620 Ga0070708_100123945
621 Ga0070678_100022384
622 Ga0070678_100024025
623 Ga0070678_100078196
624 Ga0070662_100032687
625 Ga0070681_10003322
626 Ga0070681_10006241
627 Ga0070681_10009604
628 Ga0070681_10027068
629 Ga0070681_10035376
630 Ga0068867_100065724
631 Ga0070706_100001042
632 Ga0070706_100037594
633 Ga0070706_100052647
634 Ga0070706_100057976
635 Ga0070706_100086899
636 Ga0070706_100090333
637 Ga0070707_100001289
638 Ga0070707_100003096
639 Ga0070707_100054061
640 Ga0070707_100056320
641 Ga0070698_100000027
642 Ga0070698_100000185
643 Ga0070699_100016804
644 Ga0070699_100025754
645 Ga0070699_100120953
646 Ga0070679_100024956
647 Ga0070679_100057197
648 Ga0070679_100182751
649 Ga0070684_100011983
650 Ga0070684_100016110
651 Ga0070684_100204931
652 Ga0070697_100000183
653 Ga0070697_100006896
654 Ga0070697_100098899
655 Ga0070697_100152221
656 Ga0070697_100207147
657 Ga0068853_100132991
658 Ga0070672_100008301
659 Ga0070672_100066355
660 Ga0070695_100032117
661 Ga0070696_100010145
662 Ga0070693_100011003
663 Ga0068855_100005590
664 Ga0068855_100050798
665 Ga0068855_100134337
666 Ga0068855_100167120
667 Ga0070664_100000301
668 Ga0070664_100034964
669 Ga0070664_100040838
670 Ga0068857_100000103
671 Ga0068854_100004048
672 Ga0068854_100046015
673 Ga0068856_100001280
674 Ga0068856_100003228
675 Ga0068856_100003702
676 Ga0068852_100008164
677 Ga0068852_100038698
678 Ga0068859_100002719
679 Ga0068859_100017542
680 Ga0068859_100042231
681 Ga0068859_100074097
682 Ga0068864_100001748
683 Ga0068864_100001761
684 Ga0068864_100003558
685 Ga0068864_100004732
686 Ga0068866_10004179
687 Ga0068861_100031071
688 Ga0068870_10001845
689 Ga0068863_100001797
690 Ga0068863_100012777
691 Ga0068863_100057801
692 Ga0068863_100079878
693 Ga0068858_100007549
694 Ga0068858_100008063
695 Ga0068858_100009434
696 Ga0068858_100033742
697 Ga0068860_100047715
698 Ga0068860_100062464
699 Ga0068862_100047568
700 Ga0081455_10023072
701 Ga0081539_10000237
702 Ga0070717_10001985
703 Ga0070717_10003732
704 Ga0070717_10014154
705 Ga0070717_10064888
706 Ga0070712_100010243
707 Ga0070712_100014090
708 Ga0097621_100000535
709 Ga0097621_100050934
710 Ga0097621_100203948
711 Ga0068871_100005651
712 Ga0068871_100007875
713 Ga0068871_100012292
714 Ga0075428_100036657
715 Ga0075431_100056694
716 Ga0075433_10000915
717 Ga0075433_10022505
718 Ga0075434_100010220
719 Ga0075434_100017692
720 Ga0075434_100038690
721 Ga0075434_100100284
722 Ga0075434_100153266
723 Ga0075429_100043479
724 Ga0075429_100053661
725 Ga0068865_100006668
726 Ga0068865_100043579
727 Ga0075436_100002429
728 Ga0075436_100043356
729 Ga0075436_100085234
730 Ga0097620_100002719
731 Ga0097620_100017540
732 Ga0097620_100042228
733 Ga0097620_100074095
734 Ga0075435_100008334
735 Ga0075435_100038641
736 Ga0075435_100054691
737 Ga0105240_10006009
738 Ga0105240_10105939
739 Ga0105240_10150857
740 Ga0105240_10188043
741 Ga0111539_10230898
742 Ga0105245_10003727
743 Ga0105245_10085903
744 Ga0105247_10014131
745 Ga0114129_10001255
746 Ga0114129_10136377
747 Ga0114129_10251705
748 Ga0114129_10412741
749 Ga0105243_10016267
750 Ga0105242_10051547
751 Ga0105242_10125019
752 Ga0105248_10016904
753 Ga0105248_10020531
754 Ga0105248_10287473
755 Ga0105237_10006907
756 Ga0105237_10016506
757 Ga0105238_10013500
758 Ga0105238_10014699
759 Ga0105238_10015292
760 Ga0105238_10125169
761 Ga0105238_10248926
762 Ga0099796_10008281
763 Ga0105239_10022785
764 Ga0105239_10050506
765 Ga0105239_10073949
766 Ga0105239_10255637
767 Ga0157373_10006716
768 Ga0157371_10007154
769 Ga0157371_10079125
770 Ga0157370_10009367
771 Ga0157370_10076830
772 Ga0157369_10000739
773 Ga0157369_10070041
774 Ga0157369_10184035
775 Ga0157369_10184685
776 Ga0157374_10000628
777 Ga0157374_10002075
778 Ga0157374_10007435
779 Ga0157374_10010750
780 Ga0157374_10018562
781 Ga0157378_10000570
782 Ga0157378_10075353
783 Ga0157378_10079904
784 Ga0163162_10043813
785 Ga0157372_10004647
786 Ga0157372_10022295
787 Ga0157375_10022018
788 Ga0157375_10022655
789 Ga0157375_10035315
790 Ga0157375_10036921
791 Ga0157375_10068756
792 Ga0163163_10001699
793 Ga0163163_10002554
794 Ga0163163_10012085
795 Ga0163163_10054068
796 Ga0163163_10078430
797 Ga0163163_10085972
798 Ga0163163_10215278
799 Ga0157379_10005151
800 Ga0157376_10000976
801 Ga0157376_10008851
802 Ga0157376_10021284
803 Ga0157376_10120013
804 Ga0197907_10001997
805 Ga0206356_10311795
806 Ga0213873_10006983
807 Ga0213872_10000243
808 Ga0213875_10000017
809 Ga0213875_10010010
810 Ga0213875_10045794
811 Ga0213875_10054049
812 Ga0213875_10073815
813 Ga0213871_10002691
814 Ga0213871_10019145
815 Ga0224712_10006657
816 Ga0207682_10013078
817 Ga0207688_10004558
818 Ga0207680_10012846
819 Ga0207647_10005231
820 Ga0207647_10016345
821 Ga0207647_10026388
822 Ga0207699_10040072
823 Ga0207699_10119004
824 Ga0207645_10020169
825 Ga0207643_10000546
826 Ga0207684_10001740
827 Ga0207684_10002001
828 Ga0207684_10076992
829 Ga0207654_10039024
830 Ga0207654_10052719
831 Ga0207707_10004046
832 Ga0207707_10017650
833 Ga0207707_10018544
834 Ga0207707_10021117
835 Ga0207707_10043747
836 Ga0207707_10054558
837 Ga0207707_10064032
838 Ga0207707_10100307
839 Ga0207695_10002039
840 Ga0207695_10020345
841 Ga0207695_10063389
842 Ga0207671_10039928
843 Ga0207671_10049698
844 Ga0207671_10053409
845 Ga0207693_10000517
846 Ga0207693_10001987
847 Ga0207693_10011436
848 Ga0207693_10065771
849 Ga0207663_10066840
850 Ga0207660_10007199
851 Ga0207660_10011893
852 Ga0207662_10001281
853 Ga0207657_10002880
854 Ga0207657_10033933
855 Ga0207649_10000666
856 Ga0207652_10052638
857 Ga0207652_10056450
858 Ga0207646_10001845
859 Ga0207646_10016099
860 Ga0207646_10059356
861 Ga0207681_10007705
862 Ga0207694_10002164
863 Ga0207694_10164245
864 Ga0207650_10000097
865 Ga0207650_10004072
866 Ga0207650_10004597
867 Ga0207650_10005601
868 Ga0207659_10018070
869 Ga0207687_10008830
870 Ga0207687_10039855
871 Ga0207700_10043303
872 Ga0207700_10082987
873 Ga0207700_10102776
874 Ga0207664_10047540
875 Ga0207664_10087640
876 Ga0207664_10093865
877 Ga0207644_10006658
878 Ga0207644_10013687
879 Ga0207690_10002849
880 Ga0207690_10020371
881 Ga0207706_10001115
882 Ga0207706_10148852
883 Ga0207686_10041301
884 Ga0207686_10095394
885 Ga0207704_10010246
886 Ga0207665_10000188
887 Ga0207665_10038450
888 Ga0207665_10039865
889 Ga0207691_10025144
890 Ga0207711_10005198
891 Ga0207711_10053858
892 Ga0207689_10000078
893 Ga0207689_10032305
894 Ga0207661_10000124
895 Ga0207661_10072366
896 Ga0207661_10089881
897 Ga0207661_10102153
898 Ga0207679_10000065
899 Ga0207679_10011857
900 Ga0207679_10034589
901 Ga0207667_10026812
902 Ga0207667_10040306
903 Ga0207667_10089376
904 Ga0207667_10162531
905 Ga0207667_10173099
906 Ga0207651_10007316
907 Ga0207651_10031525
908 Ga0207651_10034427
909 Ga0207712_10071270
910 Ga0207640_10004484
911 Ga0207640_10029742
912 Ga0207640_10136390
913 Ga0207640_10151262
914 Ga0207658_10002380
915 Ga0207658_10012823
916 Ga0207677_10003984
917 Ga0207677_10009003
918 Ga0207677_10027571
919 Ga0207677_10034288
920 Ga0207677_10102007
921 Ga0207703_10044126
922 Ga0207678_10002115
923 Ga0207678_10078888
924 Ga0207708_10007547
925 Ga0207702_10001813
926 Ga0207702_10004510
927 Ga0207702_10027973
928 Ga0207702_10156349
929 Ga0207702_10280080
930 Ga0207641_10000183
931 Ga0207641_10007002
932 Ga0207641_10028155
933 Ga0207648_10001532
934 Ga0207648_10051023
935 Ga0207676_10000428
936 Ga0207676_10002661
937 Ga0207676_10005679
938 Ga0207676_10067015
939 Ga0207674_10002308
940 Ga0207674_10007560
941 Ga0207683_10011542
942 Ga0207683_10074033
943 Ga0207698_10042559
944 Ga0268266_10012603
945 Ga0268265_10005701
946 Ga0268265_10083929
947 Ga0268264_10080102
948 Ga0265318_10008530
949 Ga0265323_10001748
950 Ga0265338_10012801
951 Ga0265338_10029627
952 Ga0265330_10008795
953 Ga0265332_10020452
954 Ga0265328_10006329
955 Ga0265325_10000662
956 Ga0265329_10015010
957 Ga0265340_10010908
958 Ga0265339_10010067
959 Ga0265339_10013023
960 Ga0265339_10023888
961 Ga0265316_10004619
962 Ga0265316_10009039
963 Ga0265316_10009297
964 Ga0265316_10015148
965 Ga0265316_10018857
966 Ga0265316_10119648
967 Ga0265316_10162469
968 Ga0265313_10006090
969 Ga0265314_10001321
970 Ga0265314_10028632
971 Ga0265342_10001391
972 Ga0265342_10057911
973 Ga0307410_10031845
974 Ga0307406_10016182
975 Ga0307409_100020506
976 Ga0307409_100106731
977 Ga0307411_10033410
978 Ga0307411_10081097
979 Ga0307415_100032005
980 Ga0373945_0002278
981 Ga0373956_0000706
982 Ga0373943_0010533
983 Ga0373924_0000972
984 Ga0373931_0019810
985 Ga0373935_0024605
986 Ga0373927_0002182
987 Ga0373927_0045807
988 Ga0373927_0046432
989 Ga0373927_0132418
990 Ga0373947_0011132
991 Ga0373947_0028871
992 Ga0373947_0093015
993 Ga0373937_0001970
994 Ga0373937_0002510
995 Ga0373937_0016950
996 Ga0373937_0022662
997 Ga0373937_0050323
998 Ga0373937_0127951
999 Ga0373925_0036610
1000 Ga0373925_0115851
1001 Ga0395905_0007860
1002 Ga0395905_0070831
1003 Ga0436364_0334239
1004 Ga0436364_0339530
1005 Ga0436364_0536423
1006 Ga0436364_0783564
1007 Ga0436364_0911386
1008 Ga0436364_1293557
1009 Ga0436364_1478897
1010 Ga0436365_0144600
1011 Ga0436365_0420645
1012 Ga0436360_0161141
1013 Ga0436360_1320695
1014 Ga0436361_0335407
1015 Ga0436362_0854104
1016 Ga0436362_1295671
1017 Ga0453683_0051122
1018 Ga0466958_0014695
1019 Ga0466967_0162667
1020 Ga0495580_0000220
1021 Ga0495580_0005164
1022 Ga0495580_0005951
1023 Ga0495580_0011061
1024 Ga0495580_0017197
1025 Ga0495580_0028999
1026 Ga0495580_0076873
1027 Ga0495582_0000979
1028 Ga0495639_0020359
1029 Ga0495662_0057689
1030 Ga0495594_0025124
1031 Ga0495608_0006025
1032 Ga0495665_0006249
1033 Ga0495665_0059121
1034 Ga0495640_0126293
1035 Ga0495586_0103954
1036 Ga0495586_0107741
1037 Ga0495645_0016382
1038 Ga0495667_0000663
1039 Ga0495634_0168423
1040 Ga0495657_0010036
1041 Ga0495658_0061304
1042 Ga0495669_0022587
1043 Ga0495604_0100222
1044 Ga0495684_0088574
1045 Ga0495593_0032117
1046 Ga0496106_0045322
1047 Ga0496108_0000263
1048 Ga0496109_0000335
1049 Ga0496109_0171439
1050 Ga0496110_0001842
1051 Ga0496111_0009746
1052 Ga0496111_0074262
1053 Ga0496112_0001799
1054 Ga0496112_0005770
1055 Ga0496112_0006803
1056 Ga0496112_0007995
1057 Ga0496112_0294587
1058 Ga0496113_0000840
1059 Ga0496113_0006317
1060 Ga0496115_0116051
1061 Ga0501031_0025457
1062 Ga0501032_0001129
1063 Ga0501033_0003504
1064 Ga0501036_0000754
1065 Ga0501037_0002378
1066 Ga0501038_0003812
1067 Ga0501039_0003317
1068 Ga0501042_0119938
1069 Ga0501043_0008597
1070 Ga0501046_0002933
1071 Ga0501048_0050348
1072 Ga0501067_0004070
1073 Ga0501068_0001857
1074 Ga0501069_0002347
1075 Ga0501070_0006464
1076 Ga0501074_0087263
1077 Ga0501079_0003914
1078 Ga0501080_0000221
1079 Ga0501083_0000648
1080 Ga0501035_0013979
1081 Ga0501044_0046677
1082 nmdc:mga05p37_11828_c1
1083 nmdc:mga05p37_165848_c1
1084 nmdc:mga05p37_53786_c1
1085 nmdc:mga05p37_8809_c1
1086 nmdc:mga0qj67_55689_c1
1087 nmdc:mga06r32_10940_c1
1088 nmdc:mga06r32_273717_c1
1089 nmdc:mga0n895_16650_c1
1090 nmdc:mga0n895_190072_c1
1091 nmdc:mga0n895_40316_c1
1092 nmdc:mga0n895_77594_c1
1093 nmdc:mga0rr50_19543_c1
1094 nmdc:mga0rr50_200_c1
1095 nmdc:mga0rr50_9039_c1
1096 nmdc:mga0rr50_99993_c1
1097 nmdc:mga08x19_1148_c1
1098 nmdc:mga08x19_30597_c1
1099 nmdc:mga08x19_49307_c1
1100 nmdc:mga0a205_141025_c1
1101 nmdc:mga0a205_14506_c1
1102 nmdc:mga0a205_3819_c1
1103 nmdc:mga0a205_67687_c1
1104 Ga0495619_0133918
1105 Ga0501084_0001446
1106 Ga0587077_001670
1107 Ga0587091_000858
1108 Ga0587094_000803
1109 Ga0501082_0000143
1110 Ga0501082_0020856

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01145

Band_7

SPFH domain / Band 7 family

1

179

0.93

Map