F463115

General Info

Members Datasets Scaffolds Average Seq Length
555 280 1110 118

Family's Representative Sequence

Representative Sequence 3300025935|Ga0207709_10003951|Ga0207709_100039514
Length 138
Sequence VRGPRGGKPDSVDGMSTSEIATVLAWHDALNDSDIDTLLALSSDDVEVGGPQGAGQGLTALREWASSAGMTLTPGRMFVHEGVVVVEEEASWASKPDEKSTVATAFRVVHDQVTSIFRHNDLEAAFAATDLSEADAVS

Samples

Sample ID Description Type Environment
1 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
3 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
4 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
5 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
6 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
7 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
8 3300002073 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 Metagenome Rhizosphere
9 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
10 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
11 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
12 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
13 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
14 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
15 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
16 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
17 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
18 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
19 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
20 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
21 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
22 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
23 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
24 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
25 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
26 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
27 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
28 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
29 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
30 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
31 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
32 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
33 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
34 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
35 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
36 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
37 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
38 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
39 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
40 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
41 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
42 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
43 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
44 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
45 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
46 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
47 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
48 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
49 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
50 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
51 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
52 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
53 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
54 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
55 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
56 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
57 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
58 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
59 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
60 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
61 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
62 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
63 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
64 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
65 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
66 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
67 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
68 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
69 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
70 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
71 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
72 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
73 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
74 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
75 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
76 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
77 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
78 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
79 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
80 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
81 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
82 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
83 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
84 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
85 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
86 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
87 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
88 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
89 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
90 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
91 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
92 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
93 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
94 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
95 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
96 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
97 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
98 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
99 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
100 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
101 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
102 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
103 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
104 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
105 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
106 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
107 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
108 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
109 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
110 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
111 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
112 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
113 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
114 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
115 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
116 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
117 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
118 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
119 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
120 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
121 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
122 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
123 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
178 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
179 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
180 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
181 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
182 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
183 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
184 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
185 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
186 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
187 3300036459 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
188 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
189 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
190 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
191 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
192 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
193 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
194 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
195 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
196 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
197 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
198 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
199 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
200 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
201 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
202 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
203 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
204 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
205 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
206 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
207 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
208 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
209 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
210 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
211 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
212 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
213 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
214 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
215 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
216 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
217 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
218 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
219 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
220 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
221 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
222 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
223 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
224 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
225 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
226 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
227 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
228 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
229 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
230 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
231 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
232 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
233 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
234 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
235 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
236 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
237 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
238 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
239 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
240 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
241 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
242 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
243 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
244 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
245 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
246 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
247 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
248 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
249 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
250 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
251 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
252 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
253 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
254 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
255 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
256 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
257 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
258 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
259 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
260 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
261 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
262 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
263 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
264 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
265 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
266 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
267 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
268 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
269 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
270 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
271 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
272 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
273 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
274 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
275 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
276 2738543005 Rhodococcus sp. OK519 Isolate Unclassified
277 2738543011 Rhodococcus sp. OK611 Isolate Unclassified
278 2889300758 Rhodococcus sp. PvR099 Isolate Rhizosphere
279 2928142448 Prescottella equi DPS 2018 Isolate Unclassified
280 2939743619 Rhodococcus sp. PvR044 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.92
Metatranscriptomes 0.18
Isolates 0.9

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 10.63
Nodule 0
Rhizoplane 7.75
Rhizosphere 76.94
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207709_10003951 3300025935 Bacteria 8652
2 JGI24746J21847_1001168 3300001977 Bacteria 4151
3 JGI24739J22299_10114238 3300001989 Bacteria 809
4 JGI24737J22298_10091332 3300001990 Bacteria 903
5 JGI24743J22301_10009573 3300001991 Bacteria 1718
6 JGI24743J22301_10064213 3300001991 Bacteria 759
7 JGI24735J21928_10136578 3300002067 Bacteria 707
8 JGI24750J21931_1013700 3300002070 Bacteria 1085
9 JGI24745J21846_1005789 3300002073 Bacteria 1355
10 JGI24738J21930_10017803 3300002075 Bacteria 1491
11 JGI24744J21845_10001688 3300002077 Bacteria 4421
12 JGI24744J21845_10001990 3300002077 Bacteria 4135
13 JGI24744J21845_10045357 3300002077 Bacteria 816
14 JGI24034J26672_10076236 3300002239 Bacteria 607
15 JGI24742J22300_10004274 3300002244 Bacteria 2333
16 JGI24742J22300_10031064 3300002244 Bacteria 933
17 JGI24742J22300_10082200 3300002244 Bacteria 610
18 JGI24751J29686_10003837 3300002459 Bacteria 3034
19 Ga0070658_11038220 3300005327 Bacteria 713
20 Ga0070676_10041523 3300005328 Bacteria 2668
21 Ga0070676_10367546 3300005328 Bacteria 993
22 Ga0070683_100112109 3300005329 Bacteria 2574
23 Ga0070683_100144484 3300005329 Bacteria 2254
24 Ga0070690_100378011 3300005330 Bacteria 1035
25 Ga0068869_100010933 3300005334 Bacteria 5941
26 Ga0068869_100315942 3300005334 Bacteria 1265
27 Ga0070666_10031392 3300005335 Bacteria 3507
28 Ga0070680_101528339 3300005336 Bacteria 578
29 Ga0070682_100045942 3300005337 Bacteria 2709
30 Ga0070682_100077705 3300005337 Bacteria 2139
31 Ga0068868_100002425 3300005338 Bacteria 12921
32 Ga0068868_100433753 3300005338 Bacteria 1140
33 Ga0068868_100467372 3300005338 Bacteria 1100
34 Ga0070660_100087796 3300005339 Bacteria 2448
35 Ga0070660_100150546 3300005339 Bacteria 1870
36 Ga0070689_100058091 3300005340 Bacteria 3004
37 Ga0070689_100235831 3300005340 Bacteria 1505
38 Ga0070689_102029854 3300005340 Bacteria 526
39 Ga0070691_10004443 3300005341 Bacteria 6372
40 Ga0070691_10042388 3300005341 Bacteria 2154
41 Ga0070687_100118917 3300005343 Bacteria 1508
42 Ga0070692_10024234 3300005345 Bacteria 2981
43 Ga0070668_100000653 3300005347 Bacteria 23464
44 Ga0070668_100067351 3300005347 Bacteria 2781
45 Ga0070668_100104218 3300005347 Bacteria 2251
46 Ga0070669_100029798 3300005353 Bacteria 3936
47 Ga0070675_100286060 3300005354 Bacteria 1450
48 Ga0070671_101222863 3300005355 Bacteria 661
49 Ga0070674_100002534 3300005356 Bacteria 10117
50 Ga0070674_100071164 3300005356 Bacteria 2459
51 Ga0070673_100232072 3300005364 Bacteria 1601
52 Ga0070673_100360296 3300005364 Bacteria 1292
53 Ga0070688_100034452 3300005365 Bacteria 3067
54 Ga0070659_100197538 3300005366 Bacteria 1655
55 Ga0070667_100035241 3300005367 Bacteria 4191
56 Ga0070667_100305987 3300005367 Bacteria 1432
57 Ga0070667_100657533 3300005367 Bacteria 968
58 Ga0070703_10026616 3300005406 Bacteria 1720
59 Ga0070709_10276389 3300005434 Bacteria 1219
60 Ga0070709_10522321 3300005434 Bacteria 905
61 Ga0070714_100067616 3300005435 Bacteria 3081
62 Ga0070714_100103843 3300005435 Bacteria 2507
63 Ga0070714_100209537 3300005435 Bacteria 1786
64 Ga0070714_100860507 3300005435 Bacteria 879
65 Ga0070714_101194925 3300005435 Bacteria 742
66 Ga0070714_101329800 3300005435 Bacteria 701
67 Ga0070713_100076320 3300005436 Bacteria 2845
68 Ga0070713_102161072 3300005436 Bacteria 539
69 Ga0070710_10001529 3300005437 Bacteria 10928
70 Ga0070710_10052206 3300005437 Bacteria 2299
71 Ga0070710_10063431 3300005437 Bacteria 2111
72 Ga0070701_10004412 3300005438 Bacteria 5694
73 Ga0070701_10204665 3300005438 Bacteria 1168
74 Ga0070711_100013605 3300005439 Bacteria 5112
75 Ga0070711_100303956 3300005439 Bacteria 1269
76 Ga0070711_101325638 3300005439 Bacteria 625
77 Ga0070700_100001477 3300005441 Bacteria 11701
78 Ga0070700_100044013 3300005441 Bacteria 2747
79 Ga0070694_100005845 3300005444 Bacteria 7465
80 Ga0070694_100352748 3300005444 Bacteria 1140
81 Ga0070663_100027921 3300005455 Bacteria 3837
82 Ga0070663_100477936 3300005455 Bacteria 1031
83 Ga0070678_100000354 3300005456 Bacteria 21295
84 Ga0070678_100282415 3300005456 Bacteria 1404
85 Ga0070678_102232060 3300005456 Bacteria 519
86 Ga0070662_100031415 3300005457 Bacteria 3726
87 Ga0070662_100047317 3300005457 Bacteria 3094
88 Ga0068867_100025048 3300005459 Bacteria 4279
89 Ga0068867_100154427 3300005459 Bacteria 1805
90 Ga0070685_10183503 3300005466 Bacteria 1349
91 Ga0070679_101581629 3300005530 Bacteria 603
92 Ga0068853_100002909 3300005539 Bacteria 13012
93 Ga0068853_100099769 3300005539 Bacteria 2566
94 Ga0070686_101063401 3300005544 Bacteria 666
95 Ga0070686_101388996 3300005544 Bacteria 589
96 Ga0070695_100012433 3300005545 Bacteria 5108
97 Ga0070695_100787627 3300005545 Bacteria 761
98 Ga0070696_100077518 3300005546 Bacteria 2349
99 Ga0070696_100154284 3300005546 Bacteria 1688
100 Ga0070693_100031299 3300005547 Bacteria 2914
101 Ga0070693_100058214 3300005547 Bacteria 2236
102 Ga0070665_100008709 3300005548 Bacteria 10266
103 Ga0070665_100061098 3300005548 Bacteria 3777
104 Ga0070704_100004662 3300005549 Bacteria 7931
105 Ga0070704_100247407 3300005549 Bacteria 1462
106 Ga0068855_100340746 3300005563 Bacteria 1653
107 Ga0068854_100000627 3300005578 Bacteria 20901
108 Ga0068854_100113351 3300005578 Bacteria 2048
109 Ga0068856_100123208 3300005614 Bacteria 2595
110 Ga0068856_101033298 3300005614 Bacteria 840
111 Ga0070702_100002118 3300005615 Bacteria 8423
112 Ga0070702_100187899 3300005615 Bacteria 1357
113 Ga0068852_100127714 3300005616 Bacteria 2337
114 Ga0068852_100246010 3300005616 Bacteria 1711
115 Ga0068852_102846713 3300005616 Bacteria 502
116 Ga0068859_100023429 3300005617 Bacteria 6195
117 Ga0068859_100413746 3300005617 Bacteria 1444
118 Ga0068864_100142566 3300005618 Bacteria 2163
119 Ga0068866_10022410 3300005718 Bacteria 2923
120 Ga0068866_10030623 3300005718 Bacteria 2584
121 Ga0068861_100023348 3300005719 Bacteria 4460
122 Ga0068861_100428300 3300005719 Bacteria 1180
123 Ga0068870_10472963 3300005840 Bacteria 830
124 Ga0068863_100529689 3300005841 Bacteria 1162
125 Ga0068858_100001350 3300005842 Bacteria 25306
126 Ga0068858_100069863 3300005842 Bacteria 3255
127 Ga0068858_100695661 3300005842 Bacteria 989
128 Ga0068858_101401405 3300005842 Bacteria 689
129 Ga0068858_102193365 3300005842 Bacteria 546
130 Ga0068860_100090028 3300005843 Bacteria 2922
131 Ga0068862_100048729 3300005844 Bacteria 3617
132 Ga0068862_100151203 3300005844 Bacteria 2066
133 Ga0081455_10130098 3300005937 Bacteria 1970
134 Ga0081538_10072761 3300005981 Bacteria 1882
135 Ga0081538_10330672 3300005981 Bacteria 554
136 Ga0081539_10387008 3300005985 Bacteria 583
137 Ga0070717_10252391 3300006028 Bacteria 1559
138 Ga0075365_10003949 3300006038 Bacteria 7767
139 Ga0075365_10013362 3300006038 Bacteria 4907
140 Ga0075365_10092721 3300006038 Bacteria 2059
141 Ga0075368_10434348 3300006042 Bacteria 580
142 Ga0075363_100006637 3300006048 Bacteria 5273
143 Ga0075363_100076785 3300006048 Bacteria 1822
144 Ga0075363_100086229 3300006048 Bacteria 1723
145 Ga0075363_100574775 3300006048 Bacteria 674
146 Ga0075364_10008403 3300006051 Bacteria 6170
147 Ga0075364_10044912 3300006051 Bacteria 2875
148 Ga0075364_10236395 3300006051 Bacteria 1241
149 Ga0070715_10002625 3300006163 Bacteria 5556
150 Ga0070715_10070345 3300006163 Bacteria 1562
151 Ga0070716_100010794 3300006173 Bacteria 4591
152 Ga0070716_100137209 3300006173 Bacteria 1555
153 Ga0070716_100290842 3300006173 Bacteria 1132
154 Ga0070716_100340875 3300006173 Bacteria 1057
155 Ga0070712_100003061 3300006175 Bacteria 10344
156 Ga0070712_100008920 3300006175 Bacteria 6315
157 Ga0075362_10041171 3300006177 Bacteria 2036
158 Ga0075362_10131165 3300006177 Bacteria 1192
159 Ga0075362_10198908 3300006177 Bacteria 975
160 Ga0075362_10234285 3300006177 Bacteria 900
161 Ga0075367_10121915 3300006178 Bacteria 1607
162 Ga0075369_10004831 3300006186 Bacteria 5013
163 Ga0075369_10023785 3300006186 Bacteria 2535
164 Ga0075369_10203235 3300006186 Bacteria 914
165 Ga0075369_10427564 3300006186 Bacteria 626
166 Ga0097621_100389654 3300006237 Bacteria 1246
167 Ga0097621_100430497 3300006237 Bacteria 1186
168 Ga0075370_10015741 3300006353 Bacteria 4056
169 Ga0075370_10075412 3300006353 Bacteria 1933
170 Ga0075370_10202865 3300006353 Bacteria 1170
171 Ga0075370_10707029 3300006353 Bacteria 613
172 Ga0068871_100032858 3300006358 Bacteria 4103
173 Ga0068871_100169423 3300006358 Bacteria 1871
174 Ga0075431_100385090 3300006847 Bacteria 1406
175 Ga0075434_101762853 3300006871 Bacteria 626
176 Ga0068865_100048515 3300006881 Bacteria 2922
177 Ga0068865_100089244 3300006881 Bacteria 2232
178 Ga0068865_100231543 3300006881 Bacteria 1450
179 Ga0097620_100023429 3300006931 Bacteria 6195
180 Ga0097620_100413767 3300006931 Bacteria 1444
181 Ga0105250_10189039 3300009092 Bacteria 866
182 Ga0105240_10639675 3300009093 Bacteria 1167
183 Ga0111539_10535286 3300009094 Bacteria 1365
184 Ga0111539_10632611 3300009094 Bacteria 1246
185 Ga0111539_12669734 3300009094 Bacteria 579
186 Ga0105245_10001038 3300009098 Bacteria 25213
187 Ga0105245_10136882 3300009098 Bacteria 2303
188 Ga0105247_10001693 3300009101 Bacteria 15561
189 Ga0105247_10273417 3300009101 Bacteria 1163
190 Ga0105247_10694649 3300009101 Bacteria 765
191 Ga0105243_10000843 3300009148 Bacteria 29147
192 Ga0105243_10001998 3300009148 Bacteria 17345
193 Ga0105243_10517290 3300009148 Bacteria 1134
194 Ga0105241_10386592 3300009174 Bacteria 1224
195 Ga0105241_10799133 3300009174 Bacteria 869
196 Ga0105242_10007482 3300009176 Bacteria 8405
197 Ga0105242_10217401 3300009176 Bacteria 1706
198 Ga0105248_10004442 3300009177 Bacteria 15534
199 Ga0105248_10515323 3300009177 Bacteria 1348
200 Ga0105237_10070333 3300009545 Bacteria 3495
201 Ga0105237_10116688 3300009545 Bacteria 2663
202 Ga0105237_10321088 3300009545 Bacteria 1552
203 Ga0105237_10471155 3300009545 Bacteria 1262
204 Ga0105238_11474102 3300009551 Bacteria 709
205 Ga0105249_10000784 3300009553 Bacteria 28520
206 Ga0105249_10062183 3300009553 Bacteria 3428
207 Ga0105239_10028827 3300010375 Bacteria 6103
208 Ga0105239_10059620 3300010375 Bacteria 4189
209 Ga0105246_10013466 3300011119 Bacteria 5129
210 Ga0105246_10147750 3300011119 Bacteria 1776
211 Ga0157371_10201806 3300013102 Bacteria 1426
212 Ga0157369_10506041 3300013105 Bacteria 1249
213 Ga0157374_10019012 3300013296 Bacteria 6076
214 Ga0157374_10917664 3300013296 Bacteria 894
215 Ga0157378_10037492 3300013297 Bacteria 4294
216 Ga0163162_10007488 3300013306 Bacteria 10623
217 Ga0163162_10609926 3300013306 Bacteria 1217
218 Ga0163162_10950507 3300013306 Bacteria 970
219 Ga0157372_10213109 3300013307 Bacteria 2238
220 Ga0157375_10004444 3300013308 Bacteria 12182
221 Ga0157375_10723116 3300013308 Bacteria 1148
222 Ga0157375_10723117 3300013308 Bacteria 1148
223 Ga0163163_10244054 3300014325 Bacteria 1846
224 Ga0163163_12916474 3300014325 Bacteria 534
225 Ga0157380_10003150 3300014326 Bacteria 11264
226 Ga0157380_10069047 3300014326 Bacteria 2850
227 Ga0157377_10023666 3300014745 Bacteria 3259
228 Ga0157377_10144915 3300014745 Bacteria 1463
229 Ga0157379_10042680 3300014968 Bacteria 4049
230 Ga0157379_10429904 3300014968 Bacteria 1217
231 Ga0157379_10789676 3300014968 Bacteria 896
232 Ga0157376_10040203 3300014969 Bacteria 3821
233 Ga0163161_10001144 3300017792 Bacteria 19959
234 Ga0163161_10066742 3300017792 Bacteria 2627
235 Ga0213876_10077447 3300021384 Bacteria 1756
236 Ga0209051_1071872 3300025303 Bacteria 1037
237 Ga0207653_10011729 3300025885 Bacteria 2734
238 Ga0207692_10025260 3300025898 Bacteria 2772
239 Ga0207692_10144098 3300025898 Bacteria 1358
240 Ga0207692_10448200 3300025898 Bacteria 812
241 Ga0207642_10000456 3300025899 Bacteria 12464
242 Ga0207710_10005968 3300025900 Bacteria 5224
243 Ga0207710_10163528 3300025900 Bacteria 1085
244 Ga0207710_10349401 3300025900 Bacteria 753
245 Ga0207688_10001605 3300025901 Bacteria 11946
246 Ga0207688_10002177 3300025901 Bacteria 10553
247 Ga0207680_10019698 3300025903 Bacteria 3614
248 Ga0207680_10305377 3300025903 Bacteria 1110
249 Ga0207647_10024977 3300025904 Bacteria 3934
250 Ga0207647_10233975 3300025904 Bacteria 1057
251 Ga0207685_10038694 3300025905 Bacteria 1765
252 Ga0207685_10041232 3300025905 Bacteria 1726
253 Ga0207699_10129861 3300025906 Bacteria 1642
254 Ga0207699_10998513 3300025906 Bacteria 619
255 Ga0207645_10047285 3300025907 Bacteria 2748
256 Ga0207645_10188139 3300025907 Bacteria 1356
257 Ga0207643_10227583 3300025908 Bacteria 1143
258 Ga0207695_10899558 3300025913 Bacteria 765
259 Ga0207671_10081398 3300025914 Bacteria 2428
260 Ga0207671_10460433 3300025914 Bacteria 1013
261 Ga0207671_10790720 3300025914 Bacteria 753
262 Ga0207693_10000616 3300025915 Bacteria 31851
263 Ga0207693_10005615 3300025915 Bacteria 10430
264 Ga0207693_10491523 3300025915 Bacteria 958
265 Ga0207663_10013756 3300025916 Bacteria 4409
266 Ga0207663_10020877 3300025916 Bacteria 3717
267 Ga0207662_10078234 3300025918 Bacteria 2013
268 Ga0207662_10637697 3300025918 Bacteria 743
269 Ga0207657_10070615 3300025919 Bacteria 2959
270 Ga0207657_10303355 3300025919 Bacteria 1265
271 Ga0207681_10027737 3300025923 Bacteria 3664
272 Ga0207681_10178094 3300025923 Bacteria 1617
273 Ga0207694_10949516 3300025924 Bacteria 727
274 Ga0207659_10540098 3300025926 Bacteria 990
275 Ga0207687_10004616 3300025927 Bacteria 9165
276 Ga0207687_10086626 3300025927 Bacteria 2275
277 Ga0207664_10136511 3300025929 Bacteria 2070
278 Ga0207664_10220431 3300025929 Bacteria 1645
279 Ga0207664_10221703 3300025929 Bacteria 1640
280 Ga0207664_10424020 3300025929 Bacteria 1185
281 Ga0207644_10798262 3300025931 Bacteria 789
282 Ga0207690_10163552 3300025932 Bacteria 1661
283 Ga0207690_10284174 3300025932 Bacteria 1289
284 Ga0207706_10002810 3300025933 Bacteria 16897
285 Ga0207706_10082050 3300025933 Bacteria 2834
286 Ga0207686_10007012 3300025934 Bacteria 6062
287 Ga0207686_10329678 3300025934 Bacteria 1143
288 Ga0207709_10016566 3300025935 Bacteria 4099
289 Ga0207709_10328203 3300025935 Bacteria 1148
290 Ga0207670_10018652 3300025936 Bacteria 4224
291 Ga0207670_10503966 3300025936 Bacteria 983
292 Ga0207669_10000994 3300025937 Bacteria 12070
293 Ga0207669_10095062 3300025937 Bacteria 1952
294 Ga0207704_10001171 3300025938 Bacteria 11694
295 Ga0207704_10172195 3300025938 Bacteria 1554
296 Ga0207665_10001800 3300025939 Bacteria 14438
297 Ga0207665_10032708 3300025939 Bacteria 3444
298 Ga0207665_10440762 3300025939 Bacteria 998
299 Ga0207711_10093646 3300025941 Bacteria 2646
300 Ga0207689_10015810 3300025942 Bacteria 6390
301 Ga0207689_10019613 3300025942 Bacteria 5699
302 Ga0207661_10015302 3300025944 Bacteria 5642
303 Ga0207667_10085804 3300025949 Bacteria 3259
304 Ga0207651_10335788 3300025960 Bacteria 1268
305 Ga0207651_10802486 3300025960 Bacteria 834
306 Ga0207712_10007855 3300025961 Bacteria 6744
307 Ga0207712_10463761 3300025961 Bacteria 1077
308 Ga0207712_10906917 3300025961 Bacteria 779
309 Ga0207668_10000958 3300025972 Bacteria 17393
310 Ga0207668_10072425 3300025972 Bacteria 2465
311 Ga0207640_10011369 3300025981 Bacteria 5039
312 Ga0207658_10058180 3300025986 Bacteria 2875
313 Ga0207658_10546064 3300025986 Bacteria 1036
314 Ga0207677_10003591 3300026023 Bacteria 8218
315 Ga0207677_10210558 3300026023 Bacteria 1552
316 Ga0207677_11321278 3300026023 Bacteria 663
317 Ga0207703_10008252 3300026035 Bacteria 8227
318 Ga0207703_10161908 3300026035 Bacteria 1960
319 Ga0207703_11225629 3300026035 Bacteria 721
320 Ga0207639_10014331 3300026041 Bacteria 5573
321 Ga0207639_11312009 3300026041 Bacteria 679
322 Ga0207678_10019583 3300026067 Bacteria 5948
323 Ga0207678_10040732 3300026067 Bacteria 4027
324 Ga0207678_11410326 3300026067 Bacteria 616
325 Ga0207708_10001249 3300026075 Bacteria 19169
326 Ga0207708_10011837 3300026075 Bacteria 6496
327 Ga0207702_10038566 3300026078 Bacteria 4001
328 Ga0207641_10455337 3300026088 Bacteria 1237
329 Ga0207648_10002184 3300026089 Bacteria 21231
330 Ga0207648_10088431 3300026089 Bacteria 2705
331 Ga0207676_10117592 3300026095 Bacteria 2236
332 Ga0207675_100006237 3300026118 Bacteria 11317
333 Ga0207675_100007416 3300026118 Bacteria 10364
334 Ga0207683_10000649 3300026121 Bacteria 31834
335 Ga0207683_10024839 3300026121 Bacteria 5163
336 Ga0207698_10028555 3300026142 Bacteria 3980
337 Ga0207698_10140200 3300026142 Bacteria 2081
338 Ga0268266_10009911 3300028379 Bacteria 8370
339 Ga0268266_10199530 3300028379 Bacteria 1830
340 Ga0268265_10133737 3300028380 Bacteria 2065
341 Ga0268265_10952813 3300028380 Bacteria 845
342 Ga0268265_11276932 3300028380 Bacteria 734
343 Ga0268264_10046095 3300028381 Bacteria 3621
344 Ga0268264_10145565 3300028381 Bacteria 2118
345 Ga0307410_11005464 3300031852 Bacteria 719
346 Ga0307410_11121543 3300031852 Bacteria 683
347 Ga0307407_10059113 3300031903 Bacteria 2231
348 Ga0307409_102731294 3300031995 Bacteria 522
349 Ga0307416_100210055 3300032002 Bacteria 1856
350 Ga0373959_0047835 3300034820 Bacteria 916
351 Ga0373939_0178566 3300035114 Bacteria 790
352 Ga0373939_0213074 3300035114 Bacteria 736
353 Ga0373941_0291697 3300035115 Bacteria 648
354 Ga0373945_0248863 3300035116 Bacteria 750
355 Ga0316574_0624197 3300035398 Bacteria 665
356 Ga0373931_0021293 3300035691 Bacteria 3252
357 Ga0373931_0411232 3300035691 Bacteria 858
358 Ga0373931_0686621 3300035691 Bacteria 675
359 Ga0372808_031575 3300036459 Bacteria 760
360 Ga0316584_0154474 3300036712 Bacteria 1707
361 Ga0436364_0523498 3300037853 Bacteria 3152
362 Ga0436364_0727309 3300037853 Bacteria 1640
363 Ga0436365_0281282 3300039437 Bacteria 1024
364 Ga0436365_1146896 3300039437 Bacteria 7362
365 Ga0436365_1177772 3300039437 Bacteria 64815
366 Ga0436360_1039653 3300039438 Bacteria 920
367 Ga0436363_0498622 3300039450 Bacteria 2871
368 Ga0436363_0797078 3300039450 Bacteria 768
369 Ga0436363_1287725 3300039450 Bacteria 872
370 Ga0439466_0247486 3300041411 Bacteria 540
371 Ga0451797_0780390 3300041453 Bacteria 646
372 Ga0451802_1440010 3300041460 Bacteria 616
373 Ga0451853_3664947 3300041512 Bacteria 3145
374 Ga0439431_0110331 3300041997 Bacteria 761
375 Ga0466969_0047400 3300044656 Bacteria 2127
376 Ga0466969_0124849 3300044656 Bacteria 1196
377 Ga0466972_0031873 3300044658 Bacteria 2591
378 Ga0466972_0114027 3300044658 Bacteria 1276
379 Ga0466972_0297429 3300044658 Bacteria 754
380 Ga0466965_0054963 3300044683 Bacteria 1981
381 Ga0466965_0320558 3300044683 Bacteria 844
382 Ga0466966_0003202 3300044684 Bacteria 10782
383 Ga0466966_0008774 3300044684 Bacteria 6693
384 Ga0466966_0089977 3300044684 Bacteria 1906
385 Ga0466961_0011812 3300044693 Bacteria 5582
386 Ga0466961_0170492 3300044693 Bacteria 1354
387 Ga0466963_0029095 3300044694 Bacteria 3553
388 Ga0466963_0050364 3300044694 Bacteria 2757
389 Ga0466963_0063926 3300044694 Bacteria 2464
390 Ga0466963_0145423 3300044694 Bacteria 1644
391 Ga0466963_0322375 3300044694 Bacteria 1087
392 Ga0466963_0412242 3300044694 Bacteria 953
393 Ga0466964_0769216 3300044706 Bacteria 542
394 Ga0466968_0007641 3300044735 Bacteria 4117
395 Ga0466968_0042124 3300044735 Bacteria 1929
396 Ga0466968_0133931 3300044735 Bacteria 1129
397 Ga0466970_0035340 3300044765 Bacteria 2647
398 Ga0466970_0100364 3300044765 Bacteria 1576
399 Ga0466970_0869106 3300044765 Bacteria 530
400 Ga0466957_0000745 3300044842 Bacteria 16607
401 Ga0466957_0031958 3300044842 Bacteria 3149
402 Ga0466957_0172469 3300044842 Bacteria 1409
403 Ga0466960_0001163 3300044901 Bacteria 9454
404 Ga0466960_0001619 3300044901 Bacteria 8233
405 Ga0466960_0287279 3300044901 Bacteria 923
406 Ga0466960_0351221 3300044901 Bacteria 841
407 Ga0466959_0004991 3300045049 Bacteria 9002
408 Ga0466959_0007534 3300045049 Bacteria 7646
409 Ga0466959_0047288 3300045049 Bacteria 3164
410 Ga0466959_0229470 3300045049 Bacteria 1285
411 Ga0466958_0025883 3300045836 Bacteria 3463
412 Ga0466958_0056359 3300045836 Bacteria 2387
413 Ga0466958_0132818 3300045836 Bacteria 1564
414 Ga0466958_0323551 3300045836 Bacteria 991
415 Ga0466967_0004929 3300045976 Bacteria 9126
416 Ga0466967_0025571 3300045976 Bacteria 4871
417 Ga0466967_0055966 3300045976 Bacteria 3476
418 Ga0466967_0096497 3300045976 Bacteria 2697
419 Ga0466967_0119347 3300045976 Bacteria 2434
420 Ga0466967_0850674 3300045976 Bacteria 906
421 Ga0466967_0921098 3300045976 Bacteria 869
422 Ga0466967_1157453 3300045976 Bacteria 771
423 Ga0495580_0219072 3300046472 Bacteria 1308
424 Ga0495662_0516007 3300046476 Bacteria 586
425 Ga0495644_0123445 3300046523 Bacteria 986
426 Ga0495668_0000553 3300046616 Bacteria 46225
427 Ga0495588_0070117 3300046674 Bacteria 1822
428 Ga0496100_0000979 3300048903 Bacteria 13731
429 Ga0496101_0001550 3300048904 Bacteria 13779
430 Ga0496101_0097595 3300048904 Bacteria 2195
431 Ga0496101_0163174 3300048904 Bacteria 1710
432 Ga0496102_0001400 3300048905 Bacteria 21426
433 Ga0496102_0076687 3300048905 Bacteria 3075
434 Ga0496102_0080915 3300048905 Bacteria 2994
435 Ga0496102_0254250 3300048905 Bacteria 1656
436 Ga0496103_0003055 3300048906 Bacteria 10287
437 Ga0496103_0122411 3300048906 Bacteria 1658
438 Ga0496103_0198597 3300048906 Bacteria 1290
439 Ga0496103_0214577 3300048906 Bacteria 1237
440 Ga0496104_0162034 3300048907 Bacteria 2145
441 Ga0496105_0358031 3300048908 Bacteria 1164
442 Ga0496106_0003615 3300048909 Bacteria 11531
443 Ga0496106_0272424 3300048909 Bacteria 1355
444 Ga0496106_0565092 3300048909 Bacteria 912
445 Ga0496106_0928196 3300048909 Bacteria 686
446 Ga0496107_0000365 3300048910 Bacteria 24557
447 Ga0496107_0051318 3300048910 Bacteria 2975
448 Ga0496107_0106239 3300048910 Bacteria 2062
449 Ga0496108_0004412 3300048911 Bacteria 11322
450 Ga0496108_0291131 3300048911 Bacteria 1422
451 Ga0496108_0792149 3300048911 Bacteria 818
452 Ga0496108_1226847 3300048911 Bacteria 633
453 Ga0496109_0000747 3300048912 Bacteria 27044
454 Ga0496110_0256915 3300048913 Bacteria 1590
455 Ga0496111_0262514 3300048914 Bacteria 1281
456 Ga0496112_0009325 3300048915 Bacteria 8832
457 Ga0496112_0158341 3300048915 Bacteria 2231
458 Ga0496112_0308668 3300048915 Bacteria 1527
459 Ga0496112_0377073 3300048915 Bacteria 1360
460 Ga0496113_0142571 3300048916 Bacteria 1886
461 Ga0496113_0148907 3300048916 Bacteria 1845
462 Ga0496113_0689516 3300048916 Bacteria 816
463 Ga0496113_0768790 3300048916 Bacteria 766
464 Ga0496114_0001173 3300048917 Bacteria 19832
465 Ga0496114_0249614 3300048917 Bacteria 1561
466 Ga0496115_0001418 3300048918 Bacteria 17150
467 Ga0496115_0228244 3300048918 Bacteria 1536
468 Ga0496115_1413850 3300048918 Bacteria 513
469 Ga0496117_0280802 3300048920 Bacteria 892
470 Ga0496118_0513181 3300048921 Bacteria 593
471 Ga0496120_0272372 3300048923 Bacteria 786
472 Ga0496122_0049272 3300048925 Bacteria 3228
473 Ga0496123_0103622 3300048926 Bacteria 1647
474 Ga0496125_0016948 3300048928 Bacteria 6969
475 Ga0496125_0193380 3300048928 Bacteria 1341
476 Ga0496125_0660806 3300048928 Bacteria 561
477 Ga0496126_0006882 3300048929 Bacteria 12595
478 Ga0496126_0047354 3300048929 Bacteria 3936
479 Ga0496126_0048696 3300048929 Bacteria 3871
480 Ga0496126_0679702 3300048929 Bacteria 802
481 Ga0501032_0002761 3300049569 Bacteria 13674
482 Ga0501032_0106066 3300049569 Bacteria 1861
483 Ga0501034_0001497 3300049571 Bacteria 30701
484 Ga0501034_0007765 3300049571 Bacteria 11410
485 Ga0501036_0136007 3300049572 Bacteria 2074
486 Ga0501037_0000565 3300049573 Bacteria 29305
487 Ga0501037_0554451 3300049573 Bacteria 775
488 Ga0501038_0005864 3300049574 Bacteria 11364
489 Ga0501039_0042158 3300049575 Bacteria 3526
490 Ga0501040_0184168 3300049576 Bacteria 1481
491 Ga0501041_0636442 3300049577 Bacteria 681
492 Ga0501043_0003605 3300049579 Bacteria 12714
493 Ga0501043_0304059 3300049579 Bacteria 1218
494 Ga0501047_0013607 3300049581 Bacteria 7718
495 Ga0501047_0046100 3300049581 Bacteria 4214
496 Ga0501047_0152736 3300049581 Bacteria 2184
497 Ga0501047_0430100 3300049581 Bacteria 1151
498 Ga0501047_0532545 3300049581 Bacteria 1000
499 Ga0501047_1033332 3300049581 Bacteria 635
500 Ga0501068_0311473 3300049584 Bacteria 1008
501 Ga0501069_0177902 3300049585 Bacteria 1229
502 Ga0501070_0002790 3300049586 Bacteria 15252
503 Ga0501070_0558202 3300049586 Bacteria 916
504 Ga0501071_0484730 3300049587 Bacteria 948
505 Ga0501072_0804734 3300049588 Bacteria 736
506 Ga0501077_0157209 3300049593 Bacteria 1443
507 Ga0501079_1487051 3300049741 Bacteria 533
508 Ga0501080_0046200 3300049742 Bacteria 4056
509 Ga0501035_0000121 3300049822 Bacteria 94497
510 Ga0501044_0001588 3300049823 Bacteria 26614
511 Ga0501044_0011481 3300049823 Bacteria 9598
512 Ga0501044_0250736 3300049823 Bacteria 1711
513 Ga0501044_0600397 3300049823 Bacteria 994
514 nmdc:mga03683_10497_c2 3300050489 Bacteria 2471
515 nmdc:mga03683_199325_c1 3300050489 Bacteria 918
516 nmdc:mga03n38_12463_c1 3300050490 Bacteria 3200
517 nmdc:mga03n38_270108_c1 3300050490 Bacteria 904
518 nmdc:mga03n38_3177_c1 3300050490 Bacteria 5235
519 nmdc:mga03n38_33849_c1 3300050490 Bacteria 2177
520 nmdc:mga00v17_199820_c1 3300050491 Bacteria 1292
521 nmdc:mga00v17_364169_c1 3300050491 Bacteria 940
522 nmdc:mga00v17_375787_c1 3300050491 Bacteria 924
523 nmdc:mga00v17_8699_c1 3300050491 Bacteria 5469
524 nmdc:mga0yw44_17240_c1 3300050492 Bacteria 3925
525 nmdc:mga0yw44_26947_c1 3300050492 Bacteria 3287
526 nmdc:mga0yw44_774287_c1 3300050492 Bacteria 652
527 nmdc:mga06z11_101639_c1 3300050494 Bacteria 1578
528 nmdc:mga06z11_605009_c1 3300050494 Bacteria 667
529 nmdc:mga07m45_148427_c1 3300050496 Bacteria 1359
530 nmdc:mga07m45_222177_c1 3300050496 Bacteria 1099
531 nmdc:mga07m45_45088_c1 3300050496 Bacteria 2475
532 nmdc:mga07m45_714134_c1 3300050496 Bacteria 576
533 nmdc:mga07m45_72283_c1 3300050496 Bacteria 1963
534 nmdc:mga0n895_1972846_c1 3300050512 Bacteria 542
535 nmdc:mga0sz30_10654_c1 3300050516 Bacteria 3527
536 nmdc:mga0sz30_133323_c1 3300050516 Bacteria 1095
537 nmdc:mga0sz30_22654_c1 3300050516 Bacteria 2551
538 nmdc:mga0sz30_80558_c1 3300050516 Bacteria 1409
539 Ga0500635_0068142 3300053080 Bacteria 1257
540 Ga0500635_0215573 3300053080 Bacteria 748
541 Ga0500643_009209 3300053087 Bacteria 3791
542 Ga0500643_063859 3300053087 Bacteria 1030
543 Ga0500608_103572 3300053122 Bacteria 1315
544 Ga0500652_000274 3300053131 Bacteria 19163
545 Ga0500559_0043067 3300053136 Bacteria 1972
546 Ga0500559_0052503 3300053136 Bacteria 1802
547 Ga0500568_0129140 3300053139 Bacteria 940
548 Ga0500645_000081 3300053730 Bacteria 76748
549 Ga0466962_0044450 3300061719 Bacteria 2125
550 Ga0466962_0085532 3300061719 Bacteria 1510
551 2739204663 2738543005 Bacteria 5278128
552 2739237804 2738543011 Bacteria 5731169
553 2889303682 2889300758 Bacteria 5690814
554 2928145504 2928142448 Bacteria 5288925
555 2939747466 2939743619 Bacteria 5762299
556 Ga0207709_10003951
557 JGI24746J21847_1001168
558 JGI24739J22299_10114238
559 JGI24737J22298_10091332
560 JGI24743J22301_10009573
561 JGI24743J22301_10064213
562 JGI24735J21928_10136578
563 JGI24750J21931_1013700
564 JGI24745J21846_1005789
565 JGI24738J21930_10017803
566 JGI24744J21845_10001688
567 JGI24744J21845_10001990
568 JGI24744J21845_10045357
569 JGI24034J26672_10076236
570 JGI24742J22300_10004274
571 JGI24742J22300_10031064
572 JGI24742J22300_10082200
573 JGI24751J29686_10003837
574 Ga0070658_11038220
575 Ga0070676_10041523
576 Ga0070676_10367546
577 Ga0070683_100112109
578 Ga0070683_100144484
579 Ga0070690_100378011
580 Ga0068869_100010933
581 Ga0068869_100315942
582 Ga0070666_10031392
583 Ga0070680_101528339
584 Ga0070682_100045942
585 Ga0070682_100077705
586 Ga0068868_100002425
587 Ga0068868_100433753
588 Ga0068868_100467372
589 Ga0070660_100087796
590 Ga0070660_100150546
591 Ga0070689_100058091
592 Ga0070689_100235831
593 Ga0070689_102029854
594 Ga0070691_10004443
595 Ga0070691_10042388
596 Ga0070687_100118917
597 Ga0070692_10024234
598 Ga0070668_100000653
599 Ga0070668_100067351
600 Ga0070668_100104218
601 Ga0070669_100029798
602 Ga0070675_100286060
603 Ga0070671_101222863
604 Ga0070674_100002534
605 Ga0070674_100071164
606 Ga0070673_100232072
607 Ga0070673_100360296
608 Ga0070688_100034452
609 Ga0070659_100197538
610 Ga0070667_100035241
611 Ga0070667_100305987
612 Ga0070667_100657533
613 Ga0070703_10026616
614 Ga0070709_10276389
615 Ga0070709_10522321
616 Ga0070714_100067616
617 Ga0070714_100103843
618 Ga0070714_100209537
619 Ga0070714_100860507
620 Ga0070714_101194925
621 Ga0070714_101329800
622 Ga0070713_100076320
623 Ga0070713_102161072
624 Ga0070710_10001529
625 Ga0070710_10052206
626 Ga0070710_10063431
627 Ga0070701_10004412
628 Ga0070701_10204665
629 Ga0070711_100013605
630 Ga0070711_100303956
631 Ga0070711_101325638
632 Ga0070700_100001477
633 Ga0070700_100044013
634 Ga0070694_100005845
635 Ga0070694_100352748
636 Ga0070663_100027921
637 Ga0070663_100477936
638 Ga0070678_100000354
639 Ga0070678_100282415
640 Ga0070678_102232060
641 Ga0070662_100031415
642 Ga0070662_100047317
643 Ga0068867_100025048
644 Ga0068867_100154427
645 Ga0070685_10183503
646 Ga0070679_101581629
647 Ga0068853_100002909
648 Ga0068853_100099769
649 Ga0070686_101063401
650 Ga0070686_101388996
651 Ga0070695_100012433
652 Ga0070695_100787627
653 Ga0070696_100077518
654 Ga0070696_100154284
655 Ga0070693_100031299
656 Ga0070693_100058214
657 Ga0070665_100008709
658 Ga0070665_100061098
659 Ga0070704_100004662
660 Ga0070704_100247407
661 Ga0068855_100340746
662 Ga0068854_100000627
663 Ga0068854_100113351
664 Ga0068856_100123208
665 Ga0068856_101033298
666 Ga0070702_100002118
667 Ga0070702_100187899
668 Ga0068852_100127714
669 Ga0068852_100246010
670 Ga0068852_102846713
671 Ga0068859_100023429
672 Ga0068859_100413746
673 Ga0068864_100142566
674 Ga0068866_10022410
675 Ga0068866_10030623
676 Ga0068861_100023348
677 Ga0068861_100428300
678 Ga0068870_10472963
679 Ga0068863_100529689
680 Ga0068858_100001350
681 Ga0068858_100069863
682 Ga0068858_100695661
683 Ga0068858_101401405
684 Ga0068858_102193365
685 Ga0068860_100090028
686 Ga0068862_100048729
687 Ga0068862_100151203
688 Ga0081455_10130098
689 Ga0081538_10072761
690 Ga0081538_10330672
691 Ga0081539_10387008
692 Ga0070717_10252391
693 Ga0075365_10003949
694 Ga0075365_10013362
695 Ga0075365_10092721
696 Ga0075368_10434348
697 Ga0075363_100006637
698 Ga0075363_100076785
699 Ga0075363_100086229
700 Ga0075363_100574775
701 Ga0075364_10008403
702 Ga0075364_10044912
703 Ga0075364_10236395
704 Ga0070715_10002625
705 Ga0070715_10070345
706 Ga0070716_100010794
707 Ga0070716_100137209
708 Ga0070716_100290842
709 Ga0070716_100340875
710 Ga0070712_100003061
711 Ga0070712_100008920
712 Ga0075362_10041171
713 Ga0075362_10131165
714 Ga0075362_10198908
715 Ga0075362_10234285
716 Ga0075367_10121915
717 Ga0075369_10004831
718 Ga0075369_10023785
719 Ga0075369_10203235
720 Ga0075369_10427564
721 Ga0097621_100389654
722 Ga0097621_100430497
723 Ga0075370_10015741
724 Ga0075370_10075412
725 Ga0075370_10202865
726 Ga0075370_10707029
727 Ga0068871_100032858
728 Ga0068871_100169423
729 Ga0075431_100385090
730 Ga0075434_101762853
731 Ga0068865_100048515
732 Ga0068865_100089244
733 Ga0068865_100231543
734 Ga0097620_100023429
735 Ga0097620_100413767
736 Ga0105250_10189039
737 Ga0105240_10639675
738 Ga0111539_10535286
739 Ga0111539_10632611
740 Ga0111539_12669734
741 Ga0105245_10001038
742 Ga0105245_10136882
743 Ga0105247_10001693
744 Ga0105247_10273417
745 Ga0105247_10694649
746 Ga0105243_10000843
747 Ga0105243_10001998
748 Ga0105243_10517290
749 Ga0105241_10386592
750 Ga0105241_10799133
751 Ga0105242_10007482
752 Ga0105242_10217401
753 Ga0105248_10004442
754 Ga0105248_10515323
755 Ga0105237_10070333
756 Ga0105237_10116688
757 Ga0105237_10321088
758 Ga0105237_10471155
759 Ga0105238_11474102
760 Ga0105249_10000784
761 Ga0105249_10062183
762 Ga0105239_10028827
763 Ga0105239_10059620
764 Ga0105246_10013466
765 Ga0105246_10147750
766 Ga0157371_10201806
767 Ga0157369_10506041
768 Ga0157374_10019012
769 Ga0157374_10917664
770 Ga0157378_10037492
771 Ga0163162_10007488
772 Ga0163162_10609926
773 Ga0163162_10950507
774 Ga0157372_10213109
775 Ga0157375_10004444
776 Ga0157375_10723116
777 Ga0157375_10723117
778 Ga0163163_10244054
779 Ga0163163_12916474
780 Ga0157380_10003150
781 Ga0157380_10069047
782 Ga0157377_10023666
783 Ga0157377_10144915
784 Ga0157379_10042680
785 Ga0157379_10429904
786 Ga0157379_10789676
787 Ga0157376_10040203
788 Ga0163161_10001144
789 Ga0163161_10066742
790 Ga0213876_10077447
791 Ga0209051_1071872
792 Ga0207653_10011729
793 Ga0207692_10025260
794 Ga0207692_10144098
795 Ga0207692_10448200
796 Ga0207642_10000456
797 Ga0207710_10005968
798 Ga0207710_10163528
799 Ga0207710_10349401
800 Ga0207688_10001605
801 Ga0207688_10002177
802 Ga0207680_10019698
803 Ga0207680_10305377
804 Ga0207647_10024977
805 Ga0207647_10233975
806 Ga0207685_10038694
807 Ga0207685_10041232
808 Ga0207699_10129861
809 Ga0207699_10998513
810 Ga0207645_10047285
811 Ga0207645_10188139
812 Ga0207643_10227583
813 Ga0207695_10899558
814 Ga0207671_10081398
815 Ga0207671_10460433
816 Ga0207671_10790720
817 Ga0207693_10000616
818 Ga0207693_10005615
819 Ga0207693_10491523
820 Ga0207663_10013756
821 Ga0207663_10020877
822 Ga0207662_10078234
823 Ga0207662_10637697
824 Ga0207657_10070615
825 Ga0207657_10303355
826 Ga0207681_10027737
827 Ga0207681_10178094
828 Ga0207694_10949516
829 Ga0207659_10540098
830 Ga0207687_10004616
831 Ga0207687_10086626
832 Ga0207664_10136511
833 Ga0207664_10220431
834 Ga0207664_10221703
835 Ga0207664_10424020
836 Ga0207644_10798262
837 Ga0207690_10163552
838 Ga0207690_10284174
839 Ga0207706_10002810
840 Ga0207706_10082050
841 Ga0207686_10007012
842 Ga0207686_10329678
843 Ga0207709_10016566
844 Ga0207709_10328203
845 Ga0207670_10018652
846 Ga0207670_10503966
847 Ga0207669_10000994
848 Ga0207669_10095062
849 Ga0207704_10001171
850 Ga0207704_10172195
851 Ga0207665_10001800
852 Ga0207665_10032708
853 Ga0207665_10440762
854 Ga0207711_10093646
855 Ga0207689_10015810
856 Ga0207689_10019613
857 Ga0207661_10015302
858 Ga0207667_10085804
859 Ga0207651_10335788
860 Ga0207651_10802486
861 Ga0207712_10007855
862 Ga0207712_10463761
863 Ga0207712_10906917
864 Ga0207668_10000958
865 Ga0207668_10072425
866 Ga0207640_10011369
867 Ga0207658_10058180
868 Ga0207658_10546064
869 Ga0207677_10003591
870 Ga0207677_10210558
871 Ga0207677_11321278
872 Ga0207703_10008252
873 Ga0207703_10161908
874 Ga0207703_11225629
875 Ga0207639_10014331
876 Ga0207639_11312009
877 Ga0207678_10019583
878 Ga0207678_10040732
879 Ga0207678_11410326
880 Ga0207708_10001249
881 Ga0207708_10011837
882 Ga0207702_10038566
883 Ga0207641_10455337
884 Ga0207648_10002184
885 Ga0207648_10088431
886 Ga0207676_10117592
887 Ga0207675_100006237
888 Ga0207675_100007416
889 Ga0207683_10000649
890 Ga0207683_10024839
891 Ga0207698_10028555
892 Ga0207698_10140200
893 Ga0268266_10009911
894 Ga0268266_10199530
895 Ga0268265_10133737
896 Ga0268265_10952813
897 Ga0268265_11276932
898 Ga0268264_10046095
899 Ga0268264_10145565
900 Ga0307410_11005464
901 Ga0307410_11121543
902 Ga0307407_10059113
903 Ga0307409_102731294
904 Ga0307416_100210055
905 Ga0373959_0047835
906 Ga0373939_0178566
907 Ga0373939_0213074
908 Ga0373941_0291697
909 Ga0373945_0248863
910 Ga0316574_0624197
911 Ga0373931_0021293
912 Ga0373931_0411232
913 Ga0373931_0686621
914 Ga0372808_031575
915 Ga0316584_0154474
916 Ga0436364_0523498
917 Ga0436364_0727309
918 Ga0436365_0281282
919 Ga0436365_1146896
920 Ga0436365_1177772
921 Ga0436360_1039653
922 Ga0436363_0498622
923 Ga0436363_0797078
924 Ga0436363_1287725
925 Ga0439466_0247486
926 Ga0451797_0780390
927 Ga0451802_1440010
928 Ga0451853_3664947
929 Ga0439431_0110331
930 Ga0466969_0047400
931 Ga0466969_0124849
932 Ga0466972_0031873
933 Ga0466972_0114027
934 Ga0466972_0297429
935 Ga0466965_0054963
936 Ga0466965_0320558
937 Ga0466966_0003202
938 Ga0466966_0008774
939 Ga0466966_0089977
940 Ga0466961_0011812
941 Ga0466961_0170492
942 Ga0466963_0029095
943 Ga0466963_0050364
944 Ga0466963_0063926
945 Ga0466963_0145423
946 Ga0466963_0322375
947 Ga0466963_0412242
948 Ga0466964_0769216
949 Ga0466968_0007641
950 Ga0466968_0042124
951 Ga0466968_0133931
952 Ga0466970_0035340
953 Ga0466970_0100364
954 Ga0466970_0869106
955 Ga0466957_0000745
956 Ga0466957_0031958
957 Ga0466957_0172469
958 Ga0466960_0001163
959 Ga0466960_0001619
960 Ga0466960_0287279
961 Ga0466960_0351221
962 Ga0466959_0004991
963 Ga0466959_0007534
964 Ga0466959_0047288
965 Ga0466959_0229470
966 Ga0466958_0025883
967 Ga0466958_0056359
968 Ga0466958_0132818
969 Ga0466958_0323551
970 Ga0466967_0004929
971 Ga0466967_0025571
972 Ga0466967_0055966
973 Ga0466967_0096497
974 Ga0466967_0119347
975 Ga0466967_0850674
976 Ga0466967_0921098
977 Ga0466967_1157453
978 Ga0495580_0219072
979 Ga0495662_0516007
980 Ga0495644_0123445
981 Ga0495668_0000553
982 Ga0495588_0070117
983 Ga0496100_0000979
984 Ga0496101_0001550
985 Ga0496101_0097595
986 Ga0496101_0163174
987 Ga0496102_0001400
988 Ga0496102_0076687
989 Ga0496102_0080915
990 Ga0496102_0254250
991 Ga0496103_0003055
992 Ga0496103_0122411
993 Ga0496103_0198597
994 Ga0496103_0214577
995 Ga0496104_0162034
996 Ga0496105_0358031
997 Ga0496106_0003615
998 Ga0496106_0272424
999 Ga0496106_0565092
1000 Ga0496106_0928196
1001 Ga0496107_0000365
1002 Ga0496107_0051318
1003 Ga0496107_0106239
1004 Ga0496108_0004412
1005 Ga0496108_0291131
1006 Ga0496108_0792149
1007 Ga0496108_1226847
1008 Ga0496109_0000747
1009 Ga0496110_0256915
1010 Ga0496111_0262514
1011 Ga0496112_0009325
1012 Ga0496112_0158341
1013 Ga0496112_0308668
1014 Ga0496112_0377073
1015 Ga0496113_0142571
1016 Ga0496113_0148907
1017 Ga0496113_0689516
1018 Ga0496113_0768790
1019 Ga0496114_0001173
1020 Ga0496114_0249614
1021 Ga0496115_0001418
1022 Ga0496115_0228244
1023 Ga0496115_1413850
1024 Ga0496117_0280802
1025 Ga0496118_0513181
1026 Ga0496120_0272372
1027 Ga0496122_0049272
1028 Ga0496123_0103622
1029 Ga0496125_0016948
1030 Ga0496125_0193380
1031 Ga0496125_0660806
1032 Ga0496126_0006882
1033 Ga0496126_0047354
1034 Ga0496126_0048696
1035 Ga0496126_0679702
1036 Ga0501032_0002761
1037 Ga0501032_0106066
1038 Ga0501034_0001497
1039 Ga0501034_0007765
1040 Ga0501036_0136007
1041 Ga0501037_0000565
1042 Ga0501037_0554451
1043 Ga0501038_0005864
1044 Ga0501039_0042158
1045 Ga0501040_0184168
1046 Ga0501041_0636442
1047 Ga0501043_0003605
1048 Ga0501043_0304059
1049 Ga0501047_0013607
1050 Ga0501047_0046100
1051 Ga0501047_0152736
1052 Ga0501047_0430100
1053 Ga0501047_0532545
1054 Ga0501047_1033332
1055 Ga0501068_0311473
1056 Ga0501069_0177902
1057 Ga0501070_0002790
1058 Ga0501070_0558202
1059 Ga0501071_0484730
1060 Ga0501072_0804734
1061 Ga0501077_0157209
1062 Ga0501079_1487051
1063 Ga0501080_0046200
1064 Ga0501035_0000121
1065 Ga0501044_0001588
1066 Ga0501044_0011481
1067 Ga0501044_0250736
1068 Ga0501044_0600397
1069 nmdc:mga03683_10497_c2
1070 nmdc:mga03683_199325_c1
1071 nmdc:mga03n38_12463_c1
1072 nmdc:mga03n38_270108_c1
1073 nmdc:mga03n38_3177_c1
1074 nmdc:mga03n38_33849_c1
1075 nmdc:mga00v17_199820_c1
1076 nmdc:mga00v17_364169_c1
1077 nmdc:mga00v17_375787_c1
1078 nmdc:mga00v17_8699_c1
1079 nmdc:mga0yw44_17240_c1
1080 nmdc:mga0yw44_26947_c1
1081 nmdc:mga0yw44_774287_c1
1082 nmdc:mga06z11_101639_c1
1083 nmdc:mga06z11_605009_c1
1084 nmdc:mga07m45_148427_c1
1085 nmdc:mga07m45_222177_c1
1086 nmdc:mga07m45_45088_c1
1087 nmdc:mga07m45_714134_c1
1088 nmdc:mga07m45_72283_c1
1089 nmdc:mga0n895_1972846_c1
1090 nmdc:mga0sz30_10654_c1
1091 nmdc:mga0sz30_133323_c1
1092 nmdc:mga0sz30_22654_c1
1093 nmdc:mga0sz30_80558_c1
1094 Ga0500635_0068142
1095 Ga0500635_0215573
1096 Ga0500643_009209
1097 Ga0500643_063859
1098 Ga0500608_103572
1099 Ga0500652_000274
1100 Ga0500559_0043067
1101 Ga0500559_0052503
1102 Ga0500568_0129140
1103 Ga0500645_000081
1104 Ga0466962_0044450
1105 Ga0466962_0085532
1106 2739204663
1107 2739237804
1108 2889303682
1109 2928145504
1110 2939747466

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF12680

SnoaL_2

SnoaL-like domain

23

121

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
4u13-assembly1.cif.gz_B crystal structure of putative polyketide cyclase (protein sma1630) from sinorhizobium meliloti at 2.3 a resolution 0.8766 7 86
3f40-assembly1.cif.gz_A-2 crystal structure of ntf2-like protein of unknown function (yp_677363.1) from cytophaga hutchinsonii atcc 33406 at 1.27 a resolution 0.8416 1 86
5whr-assembly1.cif.gz_A discovery of a novel and selective ido-1 inhibitor pf-06840003 and its characterization as a potential clinical candidate. 0.8367 4 26
4bl3-assembly1.cif.gz_A crystal structure of pbp2a clinical mutant n146k from mrsa 0.8312 8 29
3d9r-assembly2.cif.gz_D crystal structure of ketosteroid isomerase-like protein (yp_049581.1) from erwinia carotovora atroseptica scri1043 at 2.40 a resolution 0.822 7 53
ID Description Score Start End Superfamily
af_O33273_3_104_3.10.450.50 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.9422 3 87 3.10.450.50
af_A0A1D6P6K6_422_531_1.25.40.10 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 0.9012 3 26 1.25.40.10
af_I1KPA0_371_483_1.25.40.10 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 0.8732 4 26 1.25.40.10
af_A4HZ68_18_142_3.10.450.50 Alpha Beta;Roll;Nuclear Transport Factor 2; Chain: A,; 0.87 4 86 3.10.450.50
af_C4J6U5_384_494_1.25.40.10 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 0.8674 4 26 1.25.40.10
ID Description Score Start End GO Terms
AF-A0A2S9FMV5-F1-model_v4 SnoaL-like domain-containing protein 0.9437 1 71
AF-A0A4R6HTR5-F1-model_v4 deleted 0.9281 4 52
AF-A0A5R8YZH2-F1-model_v4 Nuclear transport factor 2 family protein 0.9226 4 52
AF-A0A1X1SY21-F1-model_v4 deleted 0.913 1 107
AF-A0A7W0KK52-F1-model_v4 Nuclear transport factor 2 family protein 0.9062 6 101

Map