F463105

General Info

Members Datasets Scaffolds Average Seq Length
555 250 1110 250

Family's Representative Sequence

Representative Sequence 3300013296|Ga0157374_10032932|Ga0157374_100329324
Length 254
Sequence MNEKISRRKLITTGLAAVGGLSGVAVAARIASKYGLIPPDCKGLYGAGETLTYASQRLLTRHSLAREFPRHMISKAPFANGKPPELEDFKKLQSGGFADWRLEIDGMVAHPGSFSIRELQTFPVRSHITQTTCEEGWSYIAEWIGTPLSHVLEVAGMLPQAKFVVYYSIEKADWWDSLDMADALHPQTLLTYGFNGSDLPVGFGGPLRMRVPRQLGYKSIKYINRLTVTDNIKRFGKGLGSSAPEGGYSWYAGM

Samples

Sample ID Description Type Environment
1 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
2 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
3 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
4 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
5 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
6 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
13 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
14 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
15 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
16 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
17 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
18 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
19 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
20 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
21 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
22 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
23 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
24 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
25 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
26 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
27 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
28 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
29 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
30 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
31 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
32 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
33 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
34 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
35 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
36 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
37 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
38 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
39 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
40 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
41 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
42 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
43 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
44 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
45 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
46 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
47 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
48 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
49 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
50 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
51 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
52 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
53 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
54 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
55 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
56 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
57 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
58 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
59 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
60 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
61 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
62 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
63 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
64 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
65 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
66 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
67 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
68 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
69 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
70 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
71 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
72 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
73 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
74 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
75 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
76 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
77 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
78 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
79 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
80 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
81 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
82 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
83 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
84 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
85 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
86 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
87 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
88 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
89 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
90 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
91 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
92 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
93 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
94 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
95 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
96 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
97 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
98 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
99 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
100 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
101 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
102 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
103 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
104 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
105 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
106 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
107 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
108 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
109 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
110 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
111 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
112 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
113 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
114 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
115 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
116 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
117 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300031018 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
183 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
184 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
185 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
186 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
187 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
188 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
189 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
190 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
191 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
192 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
193 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
194 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
195 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
196 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
197 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
198 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
199 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
200 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
201 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
202 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
203 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
204 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
205 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
206 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
207 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
208 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
209 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
210 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
211 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
212 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
213 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
214 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
215 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
216 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
217 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
218 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
219 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
220 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
221 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
222 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
223 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
224 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
225 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
226 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
227 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
228 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
229 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
230 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
231 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
232 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
233 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
234 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
235 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
236 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
237 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
238 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
239 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
240 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
241 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
242 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
243 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
244 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
245 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
246 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
247 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
248 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
249 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
250 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.82
Metatranscriptomes 0.18
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 6.67
Rhizosphere 92.79
Stem 0
Stem Tuber 0
Unclassified 16.58

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0157374_10032932 3300013296 Unclassified 4724
2 JGI24034J26672_10000721 3300002239 Unclassified 4255
3 JGI24751J29686_10001350 3300002459 Bacteria 5163
4 rootH2_10141393 3300003320 Bacteria 8230
5 Ga0065704_10177496 3300005289 Bacteria 1256
6 Ga0065712_10083367 3300005290 Bacteria 2842
7 Ga0070658_10042647 3300005327 Bacteria 3665
8 Ga0070658_10056161 3300005327 Bacteria 3200
9 Ga0070676_10001423 3300005328 Bacteria 12085
10 Ga0070676_10093692 3300005328 Unclassified 1844
11 Ga0070683_100000006 3300005329 Bacteria 361071
12 Ga0070683_100018229 3300005329 Bacteria 6215
13 Ga0070690_100116765 3300005330 Bacteria 1787
14 Ga0070690_100143980 3300005330 Bacteria 1620
15 Ga0070670_100024002 3300005331 Bacteria 5246
16 Ga0070670_100101769 3300005331 Bacteria 2474
17 Ga0070670_100396234 3300005331 Bacteria 1218
18 Ga0070677_10001238 3300005333 Bacteria 8201
19 Ga0068869_100000750 3300005334 Bacteria 18473
20 Ga0068869_100008732 3300005334 Bacteria 6546
21 Ga0068869_100049496 3300005334 Bacteria 3042
22 Ga0070666_10417150 3300005335 Unclassified 966
23 Ga0070680_100029242 3300005336 Bacteria 4426
24 Ga0070682_100015388 3300005337 Unclassified 4432
25 Ga0070682_100142891 3300005337 Bacteria 1633
26 Ga0068868_100003088 3300005338 Bacteria 11588
27 Ga0068868_100685126 3300005338 Unclassified 916
28 Ga0070660_100015739 3300005339 Bacteria 5470
29 Ga0070660_100033409 3300005339 Unclassified 3878
30 Ga0070689_100063419 3300005340 Bacteria 2876
31 Ga0070691_10014278 3300005341 Bacteria 3641
32 Ga0070687_100008244 3300005343 Unclassified 4401
33 Ga0070661_100020956 3300005344 Bacteria 4666
34 Ga0070668_100008073 3300005347 Bacteria 7816
35 Ga0070668_100026727 3300005347 Bacteria 4381
36 Ga0070669_100002345 3300005353 Bacteria 13686
37 Ga0070669_100004223 3300005353 Bacteria 10389
38 Ga0070669_100115794 3300005353 Bacteria 2039
39 Ga0070675_100011780 3300005354 Bacteria 6851
40 Ga0070675_100018956 3300005354 Bacteria 5480
41 Ga0070671_100003918 3300005355 Bacteria 11705
42 Ga0070671_100088918 3300005355 Bacteria 2585
43 Ga0070671_100192535 3300005355 Bacteria 1728
44 Ga0070673_100142640 3300005364 Bacteria 2022
45 Ga0070688_100004100 3300005365 Bacteria 7560
46 Ga0070688_100019056 3300005365 Bacteria 3972
47 Ga0070688_100121251 3300005365 Bacteria 1752
48 Ga0070688_100210482 3300005365 Bacteria 1365
49 Ga0070659_100013223 3300005366 Bacteria 6138
50 Ga0070659_100026867 3300005366 Unclassified 4430
51 Ga0070709_10018574 3300005434 Bacteria 4006
52 Ga0070709_10026404 3300005434 Bacteria 3442
53 Ga0070709_10416605 3300005434 Unclassified 1006
54 Ga0070714_100261264 3300005435 Unclassified 1603
55 Ga0070713_100024549 3300005436 Bacteria 4697
56 Ga0070713_100153649 3300005436 Bacteria 2049
57 Ga0070713_100269187 3300005436 Bacteria 1559
58 Ga0070710_10009947 3300005437 Unclassified 4663
59 Ga0070710_10061373 3300005437 Bacteria 2141
60 Ga0070710_10144706 3300005437 Bacteria 1461
61 Ga0070711_100007260 3300005439 Bacteria 6732
62 Ga0070711_100062310 3300005439 Bacteria 2599
63 Ga0070711_100157079 3300005439 Unclassified 1721
64 Ga0070700_100004349 3300005441 Bacteria 7394
65 Ga0070700_100021865 3300005441 Bacteria 3723
66 Ga0070694_100023176 3300005444 Bacteria 3989
67 Ga0070694_100434201 3300005444 Bacteria 1034
68 Ga0070708_100195301 3300005445 Bacteria 1893
69 Ga0070663_100011823 3300005455 Bacteria 5497
70 Ga0070662_100186721 3300005457 Bacteria 1637
71 Ga0070662_100634008 3300005457 Unclassified 901
72 Ga0070681_10045075 3300005458 Bacteria 4414
73 Ga0070681_10075909 3300005458 Bacteria 3321
74 Ga0068867_100017478 3300005459 Bacteria 5094
75 Ga0068867_100034985 3300005459 Unclassified 3642
76 Ga0068867_100121195 3300005459 Bacteria 2022
77 Ga0068867_100150479 3300005459 Bacteria 1827
78 Ga0070685_10003199 3300005466 Bacteria 8335
79 Ga0070685_10157404 3300005466 Bacteria 1445
80 Ga0070698_100271368 3300005471 Bacteria 1628
81 Ga0070699_100808775 3300005518 Unclassified 858
82 Ga0070679_100162793 3300005530 Bacteria 2205
83 Ga0070684_100000063 3300005535 Bacteria 70046
84 Ga0070684_100016001 3300005535 Bacteria 6126
85 Ga0070684_100286084 3300005535 Bacteria 1511
86 Ga0068853_100014479 3300005539 Bacteria 6460
87 Ga0068853_100053419 3300005539 Bacteria 3479
88 Ga0068853_100174870 3300005539 Bacteria 1944
89 Ga0070672_100144555 3300005543 Bacteria 1964
90 Ga0070672_100255499 3300005543 Bacteria 1477
91 Ga0070686_100020928 3300005544 Unclassified 3879
92 Ga0070695_100009249 3300005545 Bacteria 5857
93 Ga0070695_100056808 3300005545 Bacteria 2527
94 Ga0070695_100270606 3300005545 Bacteria 1244
95 Ga0070695_100437245 3300005545 Bacteria 999
96 Ga0070696_100021596 3300005546 Bacteria 4365
97 Ga0070693_100034061 3300005547 Bacteria 2816
98 Ga0070693_100108367 3300005547 Bacteria 1704
99 Ga0070665_100001433 3300005548 Bacteria 27947
100 Ga0070665_100119975 3300005548 Bacteria 2632
101 Ga0070704_100060239 3300005549 Bacteria 2711
102 Ga0070704_100627981 3300005549 Bacteria 946
103 Ga0068855_100042525 3300005563 Bacteria 5383
104 Ga0068855_100055718 3300005563 Bacteria 4642
105 Ga0070664_100006019 3300005564 Bacteria 9806
106 Ga0070664_100032459 3300005564 Unclassified 4368
107 Ga0070664_100473045 3300005564 Bacteria 1152
108 Ga0068857_100007720 3300005577 Bacteria 9268
109 Ga0068857_100057866 3300005577 Bacteria 3441
110 Ga0068857_100269489 3300005577 Bacteria 1564
111 Ga0068854_100022882 3300005578 Unclassified 4263
112 Ga0068854_100024537 3300005578 Bacteria 4129
113 Ga0068854_100061115 3300005578 Bacteria 2728
114 Ga0068854_100246579 3300005578 Bacteria 1424
115 Ga0068856_100068174 3300005614 Bacteria 3516
116 Ga0068856_100115332 3300005614 Bacteria 2686
117 Ga0068856_100213204 3300005614 Unclassified 1946
118 Ga0070702_100011936 3300005615 Unclassified 4335
119 Ga0070702_100015051 3300005615 Bacteria 3939
120 Ga0068852_100003988 3300005616 Bacteria 10375
121 Ga0068859_100004045 3300005617 Bacteria 14950
122 Ga0068859_100022783 3300005617 Bacteria 6280
123 Ga0068864_100003539 3300005618 Bacteria 12917
124 Ga0068864_100084832 3300005618 Bacteria 2784
125 Ga0068864_100098020 3300005618 Bacteria 2596
126 Ga0068866_10001206 3300005718 Bacteria 11251
127 Ga0068866_10012055 3300005718 Bacteria 3760
128 Ga0068861_100023095 3300005719 Unclassified 4483
129 Ga0068861_100075906 3300005719 Bacteria 2617
130 Ga0068861_100478499 3300005719 Bacteria 1121
131 Ga0068851_10010732 3300005834 Unclassified 4280
132 Ga0068851_10017477 3300005834 Bacteria 3445
133 Ga0068863_100000820 3300005841 Bacteria 31119
134 Ga0068863_100023332 3300005841 Bacteria 5910
135 Ga0068863_100026410 3300005841 Bacteria 5540
136 Ga0068863_100032841 3300005841 Bacteria 4945
137 Ga0068863_100036815 3300005841 Bacteria 4660
138 Ga0068863_100774308 3300005841 Unclassified 956
139 Ga0068858_100004207 3300005842 Bacteria 14170
140 Ga0068858_100023024 3300005842 Bacteria 5809
141 Ga0068858_100029102 3300005842 Bacteria 5129
142 Ga0068858_100047054 3300005842 Unclassified 4000
143 Ga0068858_100316205 3300005842 Bacteria 1491
144 Ga0068858_100496873 3300005842 Bacteria 1178
145 Ga0068860_100040877 3300005843 Bacteria 4430
146 Ga0068860_100058227 3300005843 Bacteria 3673
147 Ga0068862_100003733 3300005844 Bacteria 12994
148 Ga0068862_100072868 3300005844 Unclassified 2967
149 Ga0068862_100131100 3300005844 Bacteria 2217
150 Ga0081455_10044776 3300005937 Bacteria 3856
151 Ga0081539_10003416 3300005985 Bacteria 19549
152 Ga0070717_10160371 3300006028 Bacteria 1951
153 Ga0070715_10013614 3300006163 Bacteria 2992
154 Ga0070715_10174580 3300006163 Unclassified 1073
155 Ga0070716_100000160 3300006173 Bacteria 26567
156 Ga0070716_100010632 3300006173 Bacteria 4618
157 Ga0070716_100070384 3300006173 Bacteria 2054
158 Ga0070716_100110339 3300006173 Bacteria 1704
159 Ga0070716_100139197 3300006173 Bacteria 1545
160 Ga0070716_100184082 3300006173 Bacteria 1374
161 Ga0070716_100376665 3300006173 Bacteria 1013
162 Ga0070716_100437300 3300006173 Bacteria 950
163 Ga0070712_100000670 3300006175 Bacteria 20264
164 Ga0070712_100011279 3300006175 Bacteria 5662
165 Ga0070712_100084872 3300006175 Bacteria 2304
166 Ga0070712_100777192 3300006175 Bacteria 821
167 Ga0097621_100019366 3300006237 Bacteria 5221
168 Ga0097621_100019475 3300006237 Bacteria 5208
169 Ga0097621_100277030 3300006237 Bacteria 1476
170 Ga0097621_100461267 3300006237 Unclassified 1146
171 Ga0097621_100631698 3300006237 Bacteria 981
172 Ga0068871_100086332 3300006358 Bacteria 2607
173 Ga0068871_100139351 3300006358 Bacteria 2062
174 Ga0075433_10000583 3300006852 Bacteria 24162
175 Ga0075433_10129702 3300006852 Bacteria 2240
176 Ga0075434_100000328 3300006871 Bacteria 34123
177 Ga0075434_100000432 3300006871 Bacteria 30983
178 Ga0075434_100044878 3300006871 Bacteria 4385
179 Ga0075434_100481232 3300006871 Bacteria 1262
180 Ga0068865_100004881 3300006881 Bacteria 8110
181 Ga0068865_100032417 3300006881 Bacteria 3490
182 Ga0068865_100057894 3300006881 Bacteria 2705
183 Ga0068865_100082937 3300006881 Bacteria 2306
184 Ga0075436_100021817 3300006914 Plasmid 4395
185 Ga0075436_100074784 3300006914 Bacteria 2345
186 Ga0075436_100131134 3300006914 Bacteria 1758
187 Ga0097620_100004044 3300006931 Bacteria 14950
188 Ga0097620_100022783 3300006931 Bacteria 6280
189 Ga0075435_100001913 3300007076 Bacteria 13559
190 Ga0105240_10005582 3300009093 Bacteria 18696
191 Ga0105240_10040322 3300009093 Bacteria 5973
192 Ga0105240_10230093 3300009093 Unclassified 2155
193 Ga0111539_10009991 3300009094 Bacteria 11960
194 Ga0111539_10019517 3300009094 Bacteria 8364
195 Ga0111539_10186751 3300009094 Bacteria 2420
196 Ga0111539_10279779 3300009094 Bacteria 1941
197 Ga0105245_10002817 3300009098 Bacteria 15634
198 Ga0105245_10022576 3300009098 Bacteria 5524
199 Ga0105245_10064791 3300009098 Bacteria 3303
200 Ga0105245_10100088 3300009098 Bacteria 2681
201 Ga0105245_10368492 3300009098 Bacteria 1427
202 Ga0105247_10002806 3300009101 Bacteria 11651
203 Ga0105247_10004911 3300009101 Bacteria 8501
204 Ga0105247_10056139 3300009101 Bacteria 2432
205 Ga0105247_10576022 3300009101 Bacteria 831
206 Ga0114129_10734888 3300009147 Unclassified 1265
207 Ga0105243_10032718 3300009148 Unclassified 4020
208 Ga0105243_10147124 3300009148 Unclassified 2017
209 Ga0105241_10015266 3300009174 Bacteria 5624
210 Ga0105241_10018643 3300009174 Bacteria 5108
211 Ga0105241_10247643 3300009174 Unclassified 1509
212 Ga0105242_10028262 3300009176 Bacteria 4463
213 Ga0105242_10034435 3300009176 Unclassified 4059
214 Ga0105242_10809977 3300009176 Unclassified 928
215 Ga0105248_10003636 3300009177 Bacteria 17115
216 Ga0105248_10060390 3300009177 Bacteria 4256
217 Ga0105248_10062993 3300009177 Unclassified 4162
218 Ga0105248_10130572 3300009177 Bacteria 2834
219 Ga0105248_10137723 3300009177 Bacteria 2754
220 Ga0105248_10209290 3300009177 Unclassified 2197
221 Ga0105248_10217449 3300009177 Bacteria 2152
222 Ga0105248_10290661 3300009177 Bacteria 1840
223 Ga0105248_10563676 3300009177 Bacteria 1285
224 Ga0105237_10036469 3300009545 Unclassified 4976
225 Ga0105237_10103764 3300009545 Bacteria 2835
226 Ga0105237_10164679 3300009545 Bacteria 2216
227 Ga0105238_10019064 3300009551 Bacteria 6989
228 Ga0105238_10544607 3300009551 Bacteria 1164
229 Ga0105249_10024152 3300009553 Bacteria 5462
230 Ga0105249_10139864 3300009553 Bacteria 2320
231 Ga0105249_10314555 3300009553 Bacteria 1575
232 Ga0105239_10012076 3300010375 Bacteria 9631
233 Ga0105239_10022360 3300010375 Bacteria 6972
234 Ga0105239_10042345 3300010375 Unclassified 4991
235 Ga0105239_10643872 3300010375 Bacteria 1210
236 Ga0105246_10085488 3300011119 Unclassified 2259
237 Ga0105246_10644996 3300011119 Unclassified 921
238 Ga0157373_10006607 3300013100 Bacteria 8651
239 Ga0157373_10240443 3300013100 Bacteria 1280
240 Ga0157371_10009204 3300013102 Bacteria 7797
241 Ga0157371_10023726 3300013102 Bacteria 4484
242 Ga0157371_10045512 3300013102 Bacteria 3122
243 Ga0157370_10284657 3300013104 Bacteria 1527
244 Ga0157369_10021924 3300013105 Bacteria 7140
245 Ga0157369_10080957 3300013105 Bacteria 3476
246 Ga0157369_10116171 3300013105 Unclassified 2841
247 Ga0157369_10235623 3300013105 Bacteria 1913
248 Ga0157369_10742373 3300013105 Bacteria 1010
249 Ga0157374_10005438 3300013296 Bacteria 10701
250 Ga0157374_10036933 3300013296 Bacteria 4478
251 Ga0157374_10065522 3300013296 Unclassified 3412
252 Ga0157374_10234102 3300013296 Bacteria 1805
253 Ga0157378_10001462 3300013297 Bacteria 21311
254 Ga0157378_10002948 3300013297 Bacteria 15135
255 Ga0157378_10080636 3300013297 Bacteria 2940
256 Ga0157378_10141574 3300013297 Bacteria 2234
257 Ga0157378_10147608 3300013297 Unclassified 2189
258 Ga0157378_10576094 3300013297 Bacteria 1134
259 Ga0163162_10003513 3300013306 Bacteria 14987
260 Ga0163162_10032418 3300013306 Bacteria 5190
261 Ga0163162_10148426 3300013306 Bacteria 2462
262 Ga0163162_10232099 3300013306 Bacteria 1976
263 Ga0163162_10464317 3300013306 Bacteria 1397
264 Ga0163162_10648520 3300013306 Bacteria 1179
265 Ga0157372_10001742 3300013307 Bacteria 23593
266 Ga0157372_10008239 3300013307 Bacteria 11079
267 Ga0157372_10699284 3300013307 Unclassified 1180
268 Ga0157375_10043142 3300013308 Unclassified 4372
269 Ga0157375_10103764 3300013308 Unclassified 2931
270 Ga0157375_10211962 3300013308 Bacteria 2095
271 Ga0157375_11204609 3300013308 Bacteria 888
272 Ga0163163_10000056 3300014325 Bacteria 125232
273 Ga0163163_10002625 3300014325 Bacteria 15218
274 Ga0163163_10057374 3300014325 Bacteria 3850
275 Ga0163163_10096342 3300014325 Bacteria 2979
276 Ga0163163_10117884 3300014325 Bacteria 2687
277 Ga0163163_10368417 3300014325 Bacteria 1493
278 Ga0157380_10182141 3300014326 Bacteria 1847
279 Ga0157380_10516175 3300014326 Unclassified 1164
280 Ga0157380_11135567 3300014326 Bacteria 822
281 Ga0182008_10028508 3300014497 Bacteria 2823
282 Ga0157377_10002978 3300014745 Bacteria 7582
283 Ga0157377_10133457 3300014745 Bacteria 1519
284 Ga0157377_10323459 3300014745 Bacteria 1025
285 Ga0157377_10544629 3300014745 Bacteria 819
286 Ga0157379_10033920 3300014968 Bacteria 4551
287 Ga0157379_10034452 3300014968 Unclassified 4515
288 Ga0157376_10028316 3300014969 Unclassified 4452
289 Ga0157376_10076673 3300014969 Bacteria 2857
290 Ga0157376_10096554 3300014969 Bacteria 2572
291 Ga0157376_10157760 3300014969 Bacteria 2054
292 Ga0157376_10201296 3300014969 Bacteria 1832
293 Ga0182006_1124183 3300015261 Unclassified 894
294 Ga0182007_10012156 3300015262 Bacteria 3323
295 Ga0163161_10001538 3300017792 Bacteria 17036
296 Ga0224572_1009145 3300024225 Bacteria 1844
297 Ga0207697_10028778 3300025315 Bacteria 2273
298 Ga0207656_10002592 3300025321 Bacteria 6116
299 Ga0207682_10002913 3300025893 Bacteria 7545
300 Ga0207692_10005988 3300025898 Unclassified 4914
301 Ga0207692_10025058 3300025898 Bacteria 2782
302 Ga0207692_10076834 3300025898 Bacteria 1775
303 Ga0207642_10009425 3300025899 Bacteria 3395
304 Ga0207642_10164613 3300025899 Bacteria 1194
305 Ga0207710_10005265 3300025900 Bacteria 5589
306 Ga0207710_10035585 3300025900 Bacteria 2191
307 Ga0207688_10001584 3300025901 Bacteria 11994
308 Ga0207688_10119939 3300025901 Bacteria 1534
309 Ga0207680_10060722 3300025903 Bacteria 2302
310 Ga0207647_10006939 3300025904 Bacteria 8208
311 Ga0207647_10007118 3300025904 Bacteria 8111
312 Ga0207647_10007119 3300025904 Bacteria 8111
313 Ga0207647_10017303 3300025904 Unclassified 4901
314 Ga0207685_10009825 3300025905 Bacteria 2796
315 Ga0207699_10014211 3300025906 Bacteria 4097
316 Ga0207645_10000451 3300025907 Bacteria 34167
317 Ga0207645_10001098 3300025907 Bacteria 22307
318 Ga0207705_10271809 3300025909 Unclassified 1296
319 Ga0207654_10027788 3300025911 Bacteria 3078
320 Ga0207654_10132956 3300025911 Bacteria 1577
321 Ga0207707_10246298 3300025912 Unclassified 1553
322 Ga0207695_10007671 3300025913 Bacteria 13664
323 Ga0207695_10145055 3300025913 Unclassified 2319
324 Ga0207671_10033816 3300025914 Unclassified 3802
325 Ga0207671_10217852 3300025914 Bacteria 1495
326 Ga0207671_10252677 3300025914 Bacteria 1386
327 Ga0207693_10000384 3300025915 Bacteria 40563
328 Ga0207693_10003415 3300025915 Bacteria 13558
329 Ga0207693_10028014 3300025915 Plasmid 4453
330 Ga0207693_10050840 3300025915 Bacteria 3254
331 Ga0207693_10071880 3300025915 Unclassified 2708
332 Ga0207693_10074949 3300025915 Unclassified 2650
333 Ga0207663_10007761 3300025916 Bacteria 5587
334 Ga0207663_10043392 3300025916 Unclassified 2753
335 Ga0207663_10374108 3300025916 Unclassified 1084
336 Ga0207663_10450921 3300025916 Bacteria 992
337 Ga0207662_10012658 3300025918 Unclassified 4702
338 Ga0207657_10000565 3300025919 Bacteria 39272
339 Ga0207657_10010535 3300025919 Bacteria 9218
340 Ga0207649_10004664 3300025920 Bacteria 7417
341 Ga0207649_10214887 3300025920 Bacteria 1366
342 Ga0207652_10558728 3300025921 Bacteria 1028
343 Ga0207646_10422937 3300025922 Bacteria 1202
344 Ga0207681_10011697 3300025923 Bacteria 5394
345 Ga0207681_10011832 3300025923 Bacteria 5369
346 Ga0207681_10097139 3300025923 Bacteria 2116
347 Ga0207694_10185281 3300025924 Bacteria 1689
348 Ga0207650_10000024 3300025925 Bacteria 299184
349 Ga0207650_10057212 3300025925 Bacteria 2899
350 Ga0207650_10223334 3300025925 Bacteria 1517
351 Ga0207659_10026339 3300025926 Unclassified 3922
352 Ga0207687_10001517 3300025927 Bacteria 15910
353 Ga0207687_10101390 3300025927 Bacteria 2119
354 Ga0207687_10228063 3300025927 Bacteria 1470
355 Ga0207700_10132945 3300025928 Bacteria 2034
356 Ga0207700_10205555 3300025928 Bacteria 1662
357 Ga0207664_10363508 3300025929 Bacteria 1282
358 Ga0207664_10698546 3300025929 Unclassified 912
359 Ga0207644_10006410 3300025931 Bacteria 7668
360 Ga0207690_10703074 3300025932 Bacteria 831
361 Ga0207706_10000258 3300025933 Bacteria 57913
362 Ga0207706_10026833 3300025933 Bacteria 5156
363 Ga0207686_10023616 3300025934 Bacteria 3554
364 Ga0207686_10183801 3300025934 Bacteria 1484
365 Ga0207686_10227248 3300025934 Bacteria 1351
366 Ga0207670_10023597 3300025936 Bacteria 3832
367 Ga0207670_10096563 3300025936 Bacteria 2102
368 Ga0207669_10021312 3300025937 Unclassified 3419
369 Ga0207704_10007989 3300025938 Bacteria 5031
370 Ga0207704_10023046 3300025938 Bacteria 3348
371 Ga0207704_10422957 3300025938 Bacteria 1056
372 Ga0207665_10000546 3300025939 Bacteria 25345
373 Ga0207665_10050389 3300025939 Bacteria 2800
374 Ga0207665_10262711 3300025939 Bacteria 1279
375 Ga0207665_10284988 3300025939 Bacteria 1230
376 Ga0207665_10389372 3300025939 Bacteria 1059
377 Ga0207665_10491067 3300025939 Bacteria 947
378 Ga0207691_10000683 3300025940 Bacteria 33513
379 Ga0207691_10021933 3300025940 Bacteria 6026
380 Ga0207691_10133373 3300025940 Bacteria 2192
381 Ga0207711_10015746 3300025941 Bacteria 6272
382 Ga0207711_10254417 3300025941 Bacteria 1613
383 Ga0207711_10358605 3300025941 Bacteria 1350
384 Ga0207711_10390382 3300025941 Bacteria 1292
385 Ga0207711_10399819 3300025941 Bacteria 1276
386 Ga0207711_10528084 3300025941 Unclassified 1100
387 Ga0207689_10000570 3300025942 Bacteria 35269
388 Ga0207689_10000941 3300025942 Bacteria 27968
389 Ga0207689_10040179 3300025942 Bacteria 3872
390 Ga0207689_10123798 3300025942 Unclassified 2127
391 Ga0207661_10000011 3300025944 Bacteria 361200
392 Ga0207661_10022264 3300025944 Unclassified 4768
393 Ga0207679_10000327 3300025945 Bacteria 35497
394 Ga0207679_10021878 3300025945 Bacteria 4344
395 Ga0207667_10045917 3300025949 Bacteria 4625
396 Ga0207667_10124345 3300025949 Unclassified 2657
397 Ga0207667_10181191 3300025949 Bacteria 2163
398 Ga0207667_10247681 3300025949 Bacteria 1823
399 Ga0207651_10003901 3300025960 Bacteria 7405
400 Ga0207651_10126631 3300025960 Bacteria 1947
401 Ga0207712_10141353 3300025961 Bacteria 1848
402 Ga0207640_10016026 3300025981 Unclassified 4349
403 Ga0207658_10024328 3300025986 Unclassified 4236
404 Ga0207658_10165298 3300025986 Bacteria 1817
405 Ga0207677_10009107 3300026023 Bacteria 5573
406 Ga0207677_10046515 3300026023 Bacteria 2906
407 Ga0207677_10069021 3300026023 Bacteria 2484
408 Ga0207703_10014812 3300026035 Bacteria 6085
409 Ga0207703_10026945 3300026035 Unclassified 4527
410 Ga0207703_10142673 3300026035 Unclassified 2080
411 Ga0207639_10220214 3300026041 Bacteria 1639
412 Ga0207678_10001815 3300026067 Bacteria 19563
413 Ga0207708_10005202 3300026075 Bacteria 9593
414 Ga0207702_10037290 3300026078 Bacteria 4068
415 Ga0207641_10000317 3300026088 Bacteria 59841
416 Ga0207641_10000948 3300026088 Bacteria 29798
417 Ga0207641_10005838 3300026088 Bacteria 10449
418 Ga0207641_10013527 3300026088 Bacteria 6694
419 Ga0207641_10022449 3300026088 Bacteria 5195
420 Ga0207641_10316361 3300026088 Bacteria 1479
421 Ga0207641_10361441 3300026088 Bacteria 1386
422 Ga0207648_10000031 3300026089 Bacteria 129124
423 Ga0207648_10006228 3300026089 Bacteria 11882
424 Ga0207648_10036790 3300026089 Bacteria 4312
425 Ga0207648_10067307 3300026089 Bacteria 3123
426 Ga0207648_10147321 3300026089 Unclassified 2077
427 Ga0207648_10394967 3300026089 Bacteria 1252
428 Ga0207676_10000334 3300026095 Bacteria 40515
429 Ga0207676_10003385 3300026095 Bacteria 11270
430 Ga0207676_10250980 3300026095 Bacteria 1592
431 Ga0207674_10000150 3300026116 Bacteria 81671
432 Ga0207674_10062584 3300026116 Bacteria 3759
433 Ga0207675_100063556 3300026118 Unclassified 3449
434 Ga0207675_100079646 3300026118 Bacteria 3070
435 Ga0207675_100624115 3300026118 Bacteria 1082
436 Ga0207683_10001859 3300026121 Bacteria 18652
437 Ga0209588_1029516 3300027671 Bacteria 1749
438 Ga0268266_10007967 3300028379 Bacteria 9473
439 Ga0268266_10294011 3300028379 Bacteria 1513
440 Ga0268265_10010333 3300028380 Bacteria 6303
441 Ga0268265_10022682 3300028380 Bacteria 4414
442 Ga0268265_10073192 3300028380 Bacteria 2675
443 Ga0268265_10207781 3300028380 Bacteria 1703
444 Ga0268265_10524294 3300028380 Bacteria 1120
445 Ga0268265_10567888 3300028380 Bacteria 1079
446 Ga0268264_10009831 3300028381 Bacteria 7917
447 Ga0268264_10039539 3300028381 Unclassified 3897
448 Ga0268264_10110179 3300028381 Bacteria 2410
449 Ga0268264_10127160 3300028381 Bacteria 2254
450 Ga0265773_1002644 3300031018 Bacteria 1107
451 Ga0265339_10147177 3300031249 Unclassified 1194
452 Ga0265331_10072269 3300031250 Bacteria 1612
453 Ga0307408_100637678 3300031548 Bacteria 951
454 Ga0265314_10001398 3300031711 Bacteria 27049
455 Ga0373941_0068755 3300035115 Unclassified 1171
456 Ga0373953_0003424 3300035117 Bacteria 4938
457 Ga0373960_0137473 3300035121 Bacteria 825
458 Ga0373943_0190974 3300035170 Bacteria 1130
459 Ga0373955_0008033 3300035172 Bacteria 4878
460 Ga0373955_0023597 3300035172 Bacteria 3136
461 Ga0373961_0041610 3300035241 Bacteria 1329
462 Ga0373935_0339100 3300035692 Bacteria 1070
463 Ga0373933_0011511 3300035724 Bacteria 4880
464 Ga0373947_0144401 3300035725 Bacteria 1529
465 Ga0373937_0533463 3300036401 Unclassified 1115
466 Ga0373925_0098717 3300037068 Bacteria 2242
467 Ga0436365_1067624 3300039437 Bacteria 2276
468 Ga0436362_0755166 3300039453 Bacteria 7631
469 Ga0436362_0842885 3300039453 Bacteria 2071
470 Ga0451577_0171734 3300042876 Unclassified 1954
471 Ga0453684_0009588 3300044712 Bacteria 16892
472 Ga0451576_0009910 3300045051 Bacteria 11002
473 Ga0451576_0148620 3300045051 Bacteria 2444
474 Ga0466967_0586950 3300045976 Unclassified 1099
475 Ga0495603_0090710 3300046455 Bacteria 1787
476 Ga0495650_0000006 3300046471 Bacteria 721347
477 Ga0495580_0209228 3300046472 Bacteria 1342
478 Ga0495608_0057718 3300046511 Bacteria 2561
479 Ga0495628_0135946 3300046516 Bacteria 1879
480 Ga0495630_0268411 3300046517 Bacteria 1304
481 Ga0495587_0021771 3300046536 Bacteria 3955
482 Ga0495645_0004810 3300046543 Bacteria 9231
483 Ga0495645_0238873 3300046543 Unclassified 1213
484 Ga0495667_0059869 3300046559 Bacteria 2499
485 Ga0495656_0137178 3300046615 Bacteria 1170
486 Ga0495635_0366575 3300046663 Unclassified 960
487 Ga0495623_0100072 3300046679 Bacteria 1767
488 Ga0495647_0010728 3300046681 Bacteria 3126
489 Ga0495669_0076102 3300046684 Bacteria 1536
490 Ga0495600_0079286 3300046809 Bacteria 2144
491 Ga0495581_0172787 3300047315 Unclassified 1264
492 Ga0495604_0022610 3300047317 Bacteria 5020
493 Ga0495604_0226941 3300047317 Bacteria 1283
494 Ga0495680_0077799 3300047322 Bacteria 2512
495 Ga0495687_044763 3300047443 Bacteria 1921
496 Ga0495684_0027305 3300047471 Bacteria 4383
497 Ga0495602_0020548 3300048088 Bacteria 6523
498 Ga0496102_0068709 3300048905 Bacteria 3251
499 Ga0496102_0100619 3300048905 Bacteria 2685
500 Ga0496102_0554066 3300048905 Bacteria 1072
501 Ga0496103_0033667 3300048906 Bacteria 3131
502 Ga0496104_0128137 3300048907 Bacteria 2437
503 Ga0496104_0324459 3300048907 Bacteria 1453
504 Ga0496104_0350706 3300048907 Bacteria 1389
505 Ga0496104_0489434 3300048907 Bacteria 1141
506 Ga0496105_0141563 3300048908 Bacteria 1980
507 Ga0496105_0413448 3300048908 Bacteria 1069
508 Ga0496106_0101879 3300048909 Bacteria 2227
509 Ga0496106_0377177 3300048909 Bacteria 1140
510 Ga0496107_0341593 3300048910 Bacteria 1114
511 Ga0496108_0002773 3300048911 Bacteria 14037
512 Ga0496108_0044443 3300048911 Bacteria 3708
513 Ga0496109_0000825 3300048912 Bacteria 25868
514 Ga0496109_0410455 3300048912 Bacteria 1279
515 Ga0496110_0013434 3300048913 Bacteria 6770
516 Ga0496110_0024737 3300048913 Bacteria 5122
517 Ga0496110_0120133 3300048913 Bacteria 2367
518 Ga0496111_0006500 3300048914 Bacteria 7594
519 Ga0496111_0132132 3300048914 Bacteria 1847
520 Ga0496111_0261178 3300048914 Bacteria 1285
521 Ga0496112_0000097 3300048915 Bacteria 56970
522 Ga0496112_0016354 3300048915 Bacteria 6947
523 Ga0496112_0066343 3300048915 Unclassified 3561
524 Ga0496112_0165335 3300048915 Unclassified 2179
525 Ga0496112_0320017 3300048915 Bacteria 1495
526 Ga0496113_0041846 3300048916 Bacteria 3384
527 Ga0496113_0051492 3300048916 Bacteria 3073
528 Ga0496113_0376994 3300048916 Unclassified 1139
529 Ga0496113_0578189 3300048916 Bacteria 900
530 Ga0496114_0140775 3300048917 Bacteria 2088
531 Ga0496114_0411556 3300048917 Bacteria 1198
532 Ga0496115_0059525 3300048918 Bacteria 3076
533 Ga0496115_0115289 3300048918 Bacteria 2209
534 Ga0496115_0516276 3300048918 Unclassified 958
535 Ga0496119_0176288 3300048922 Bacteria 1125
536 Ga0501041_0252665 3300049577 Bacteria 1108
537 Ga0501071_0213904 3300049587 Bacteria 1450
538 Ga0501072_0434556 3300049588 Unclassified 1040
539 Ga0501076_0223961 3300049592 Bacteria 1537
540 nmdc:mga05p37_584440_c1 3300050507 Unclassified 1264
541 nmdc:mga08y16_60937_c1 3300050511 Bacteria 3940
542 nmdc:mga08y16_78940_c1 3300050511 Bacteria 3431
543 nmdc:mga0n895_584618_c1 3300050512 Unclassified 1120
544 nmdc:mga0n895_63245_c1 3300050512 Bacteria 3659
545 nmdc:mga0n895_729_c1 3300050512 Bacteria 23148
546 nmdc:mga0rr50_882_c1 3300050513 Bacteria 16222
547 nmdc:mga08x19_136341_c1 3300050514 Bacteria 1655
548 nmdc:mga08x19_373672_c1 3300050514 Unclassified 998
549 nmdc:mga08x19_53910_c1 3300050514 Bacteria 2588
550 nmdc:mga08x19_65149_c1 3300050514 Bacteria 2366
551 nmdc:mga08x19_927_c1 3300050514 Bacteria 18484
552 nmdc:mga0a205_635411_c1 3300050515 Bacteria 919
553 nmdc:mga0a205_74618_c1 3300050515 Bacteria 3277
554 nmdc:mga0a205_992_c1 3300050515 Bacteria 23492
555 Ga0495619_0059228 3300053085 Bacteria 2544
556 Ga0157374_10032932
557 JGI24034J26672_10000721
558 JGI24751J29686_10001350
559 rootH2_10141393
560 Ga0065704_10177496
561 Ga0065712_10083367
562 Ga0070658_10042647
563 Ga0070658_10056161
564 Ga0070676_10001423
565 Ga0070676_10093692
566 Ga0070683_100000006
567 Ga0070683_100018229
568 Ga0070690_100116765
569 Ga0070690_100143980
570 Ga0070670_100024002
571 Ga0070670_100101769
572 Ga0070670_100396234
573 Ga0070677_10001238
574 Ga0068869_100000750
575 Ga0068869_100008732
576 Ga0068869_100049496
577 Ga0070666_10417150
578 Ga0070680_100029242
579 Ga0070682_100015388
580 Ga0070682_100142891
581 Ga0068868_100003088
582 Ga0068868_100685126
583 Ga0070660_100015739
584 Ga0070660_100033409
585 Ga0070689_100063419
586 Ga0070691_10014278
587 Ga0070687_100008244
588 Ga0070661_100020956
589 Ga0070668_100008073
590 Ga0070668_100026727
591 Ga0070669_100002345
592 Ga0070669_100004223
593 Ga0070669_100115794
594 Ga0070675_100011780
595 Ga0070675_100018956
596 Ga0070671_100003918
597 Ga0070671_100088918
598 Ga0070671_100192535
599 Ga0070673_100142640
600 Ga0070688_100004100
601 Ga0070688_100019056
602 Ga0070688_100121251
603 Ga0070688_100210482
604 Ga0070659_100013223
605 Ga0070659_100026867
606 Ga0070709_10018574
607 Ga0070709_10026404
608 Ga0070709_10416605
609 Ga0070714_100261264
610 Ga0070713_100024549
611 Ga0070713_100153649
612 Ga0070713_100269187
613 Ga0070710_10009947
614 Ga0070710_10061373
615 Ga0070710_10144706
616 Ga0070711_100007260
617 Ga0070711_100062310
618 Ga0070711_100157079
619 Ga0070700_100004349
620 Ga0070700_100021865
621 Ga0070694_100023176
622 Ga0070694_100434201
623 Ga0070708_100195301
624 Ga0070663_100011823
625 Ga0070662_100186721
626 Ga0070662_100634008
627 Ga0070681_10045075
628 Ga0070681_10075909
629 Ga0068867_100017478
630 Ga0068867_100034985
631 Ga0068867_100121195
632 Ga0068867_100150479
633 Ga0070685_10003199
634 Ga0070685_10157404
635 Ga0070698_100271368
636 Ga0070699_100808775
637 Ga0070679_100162793
638 Ga0070684_100000063
639 Ga0070684_100016001
640 Ga0070684_100286084
641 Ga0068853_100014479
642 Ga0068853_100053419
643 Ga0068853_100174870
644 Ga0070672_100144555
645 Ga0070672_100255499
646 Ga0070686_100020928
647 Ga0070695_100009249
648 Ga0070695_100056808
649 Ga0070695_100270606
650 Ga0070695_100437245
651 Ga0070696_100021596
652 Ga0070693_100034061
653 Ga0070693_100108367
654 Ga0070665_100001433
655 Ga0070665_100119975
656 Ga0070704_100060239
657 Ga0070704_100627981
658 Ga0068855_100042525
659 Ga0068855_100055718
660 Ga0070664_100006019
661 Ga0070664_100032459
662 Ga0070664_100473045
663 Ga0068857_100007720
664 Ga0068857_100057866
665 Ga0068857_100269489
666 Ga0068854_100022882
667 Ga0068854_100024537
668 Ga0068854_100061115
669 Ga0068854_100246579
670 Ga0068856_100068174
671 Ga0068856_100115332
672 Ga0068856_100213204
673 Ga0070702_100011936
674 Ga0070702_100015051
675 Ga0068852_100003988
676 Ga0068859_100004045
677 Ga0068859_100022783
678 Ga0068864_100003539
679 Ga0068864_100084832
680 Ga0068864_100098020
681 Ga0068866_10001206
682 Ga0068866_10012055
683 Ga0068861_100023095
684 Ga0068861_100075906
685 Ga0068861_100478499
686 Ga0068851_10010732
687 Ga0068851_10017477
688 Ga0068863_100000820
689 Ga0068863_100023332
690 Ga0068863_100026410
691 Ga0068863_100032841
692 Ga0068863_100036815
693 Ga0068863_100774308
694 Ga0068858_100004207
695 Ga0068858_100023024
696 Ga0068858_100029102
697 Ga0068858_100047054
698 Ga0068858_100316205
699 Ga0068858_100496873
700 Ga0068860_100040877
701 Ga0068860_100058227
702 Ga0068862_100003733
703 Ga0068862_100072868
704 Ga0068862_100131100
705 Ga0081455_10044776
706 Ga0081539_10003416
707 Ga0070717_10160371
708 Ga0070715_10013614
709 Ga0070715_10174580
710 Ga0070716_100000160
711 Ga0070716_100010632
712 Ga0070716_100070384
713 Ga0070716_100110339
714 Ga0070716_100139197
715 Ga0070716_100184082
716 Ga0070716_100376665
717 Ga0070716_100437300
718 Ga0070712_100000670
719 Ga0070712_100011279
720 Ga0070712_100084872
721 Ga0070712_100777192
722 Ga0097621_100019366
723 Ga0097621_100019475
724 Ga0097621_100277030
725 Ga0097621_100461267
726 Ga0097621_100631698
727 Ga0068871_100086332
728 Ga0068871_100139351
729 Ga0075433_10000583
730 Ga0075433_10129702
731 Ga0075434_100000328
732 Ga0075434_100000432
733 Ga0075434_100044878
734 Ga0075434_100481232
735 Ga0068865_100004881
736 Ga0068865_100032417
737 Ga0068865_100057894
738 Ga0068865_100082937
739 Ga0075436_100021817
740 Ga0075436_100074784
741 Ga0075436_100131134
742 Ga0097620_100004044
743 Ga0097620_100022783
744 Ga0075435_100001913
745 Ga0105240_10005582
746 Ga0105240_10040322
747 Ga0105240_10230093
748 Ga0111539_10009991
749 Ga0111539_10019517
750 Ga0111539_10186751
751 Ga0111539_10279779
752 Ga0105245_10002817
753 Ga0105245_10022576
754 Ga0105245_10064791
755 Ga0105245_10100088
756 Ga0105245_10368492
757 Ga0105247_10002806
758 Ga0105247_10004911
759 Ga0105247_10056139
760 Ga0105247_10576022
761 Ga0114129_10734888
762 Ga0105243_10032718
763 Ga0105243_10147124
764 Ga0105241_10015266
765 Ga0105241_10018643
766 Ga0105241_10247643
767 Ga0105242_10028262
768 Ga0105242_10034435
769 Ga0105242_10809977
770 Ga0105248_10003636
771 Ga0105248_10060390
772 Ga0105248_10062993
773 Ga0105248_10130572
774 Ga0105248_10137723
775 Ga0105248_10209290
776 Ga0105248_10217449
777 Ga0105248_10290661
778 Ga0105248_10563676
779 Ga0105237_10036469
780 Ga0105237_10103764
781 Ga0105237_10164679
782 Ga0105238_10019064
783 Ga0105238_10544607
784 Ga0105249_10024152
785 Ga0105249_10139864
786 Ga0105249_10314555
787 Ga0105239_10012076
788 Ga0105239_10022360
789 Ga0105239_10042345
790 Ga0105239_10643872
791 Ga0105246_10085488
792 Ga0105246_10644996
793 Ga0157373_10006607
794 Ga0157373_10240443
795 Ga0157371_10009204
796 Ga0157371_10023726
797 Ga0157371_10045512
798 Ga0157370_10284657
799 Ga0157369_10021924
800 Ga0157369_10080957
801 Ga0157369_10116171
802 Ga0157369_10235623
803 Ga0157369_10742373
804 Ga0157374_10005438
805 Ga0157374_10036933
806 Ga0157374_10065522
807 Ga0157374_10234102
808 Ga0157378_10001462
809 Ga0157378_10002948
810 Ga0157378_10080636
811 Ga0157378_10141574
812 Ga0157378_10147608
813 Ga0157378_10576094
814 Ga0163162_10003513
815 Ga0163162_10032418
816 Ga0163162_10148426
817 Ga0163162_10232099
818 Ga0163162_10464317
819 Ga0163162_10648520
820 Ga0157372_10001742
821 Ga0157372_10008239
822 Ga0157372_10699284
823 Ga0157375_10043142
824 Ga0157375_10103764
825 Ga0157375_10211962
826 Ga0157375_11204609
827 Ga0163163_10000056
828 Ga0163163_10002625
829 Ga0163163_10057374
830 Ga0163163_10096342
831 Ga0163163_10117884
832 Ga0163163_10368417
833 Ga0157380_10182141
834 Ga0157380_10516175
835 Ga0157380_11135567
836 Ga0182008_10028508
837 Ga0157377_10002978
838 Ga0157377_10133457
839 Ga0157377_10323459
840 Ga0157377_10544629
841 Ga0157379_10033920
842 Ga0157379_10034452
843 Ga0157376_10028316
844 Ga0157376_10076673
845 Ga0157376_10096554
846 Ga0157376_10157760
847 Ga0157376_10201296
848 Ga0182006_1124183
849 Ga0182007_10012156
850 Ga0163161_10001538
851 Ga0224572_1009145
852 Ga0207697_10028778
853 Ga0207656_10002592
854 Ga0207682_10002913
855 Ga0207692_10005988
856 Ga0207692_10025058
857 Ga0207692_10076834
858 Ga0207642_10009425
859 Ga0207642_10164613
860 Ga0207710_10005265
861 Ga0207710_10035585
862 Ga0207688_10001584
863 Ga0207688_10119939
864 Ga0207680_10060722
865 Ga0207647_10006939
866 Ga0207647_10007118
867 Ga0207647_10007119
868 Ga0207647_10017303
869 Ga0207685_10009825
870 Ga0207699_10014211
871 Ga0207645_10000451
872 Ga0207645_10001098
873 Ga0207705_10271809
874 Ga0207654_10027788
875 Ga0207654_10132956
876 Ga0207707_10246298
877 Ga0207695_10007671
878 Ga0207695_10145055
879 Ga0207671_10033816
880 Ga0207671_10217852
881 Ga0207671_10252677
882 Ga0207693_10000384
883 Ga0207693_10003415
884 Ga0207693_10028014
885 Ga0207693_10050840
886 Ga0207693_10071880
887 Ga0207693_10074949
888 Ga0207663_10007761
889 Ga0207663_10043392
890 Ga0207663_10374108
891 Ga0207663_10450921
892 Ga0207662_10012658
893 Ga0207657_10000565
894 Ga0207657_10010535
895 Ga0207649_10004664
896 Ga0207649_10214887
897 Ga0207652_10558728
898 Ga0207646_10422937
899 Ga0207681_10011697
900 Ga0207681_10011832
901 Ga0207681_10097139
902 Ga0207694_10185281
903 Ga0207650_10000024
904 Ga0207650_10057212
905 Ga0207650_10223334
906 Ga0207659_10026339
907 Ga0207687_10001517
908 Ga0207687_10101390
909 Ga0207687_10228063
910 Ga0207700_10132945
911 Ga0207700_10205555
912 Ga0207664_10363508
913 Ga0207664_10698546
914 Ga0207644_10006410
915 Ga0207690_10703074
916 Ga0207706_10000258
917 Ga0207706_10026833
918 Ga0207686_10023616
919 Ga0207686_10183801
920 Ga0207686_10227248
921 Ga0207670_10023597
922 Ga0207670_10096563
923 Ga0207669_10021312
924 Ga0207704_10007989
925 Ga0207704_10023046
926 Ga0207704_10422957
927 Ga0207665_10000546
928 Ga0207665_10050389
929 Ga0207665_10262711
930 Ga0207665_10284988
931 Ga0207665_10389372
932 Ga0207665_10491067
933 Ga0207691_10000683
934 Ga0207691_10021933
935 Ga0207691_10133373
936 Ga0207711_10015746
937 Ga0207711_10254417
938 Ga0207711_10358605
939 Ga0207711_10390382
940 Ga0207711_10399819
941 Ga0207711_10528084
942 Ga0207689_10000570
943 Ga0207689_10000941
944 Ga0207689_10040179
945 Ga0207689_10123798
946 Ga0207661_10000011
947 Ga0207661_10022264
948 Ga0207679_10000327
949 Ga0207679_10021878
950 Ga0207667_10045917
951 Ga0207667_10124345
952 Ga0207667_10181191
953 Ga0207667_10247681
954 Ga0207651_10003901
955 Ga0207651_10126631
956 Ga0207712_10141353
957 Ga0207640_10016026
958 Ga0207658_10024328
959 Ga0207658_10165298
960 Ga0207677_10009107
961 Ga0207677_10046515
962 Ga0207677_10069021
963 Ga0207703_10014812
964 Ga0207703_10026945
965 Ga0207703_10142673
966 Ga0207639_10220214
967 Ga0207678_10001815
968 Ga0207708_10005202
969 Ga0207702_10037290
970 Ga0207641_10000317
971 Ga0207641_10000948
972 Ga0207641_10005838
973 Ga0207641_10013527
974 Ga0207641_10022449
975 Ga0207641_10316361
976 Ga0207641_10361441
977 Ga0207648_10000031
978 Ga0207648_10006228
979 Ga0207648_10036790
980 Ga0207648_10067307
981 Ga0207648_10147321
982 Ga0207648_10394967
983 Ga0207676_10000334
984 Ga0207676_10003385
985 Ga0207676_10250980
986 Ga0207674_10000150
987 Ga0207674_10062584
988 Ga0207675_100063556
989 Ga0207675_100079646
990 Ga0207675_100624115
991 Ga0207683_10001859
992 Ga0209588_1029516
993 Ga0268266_10007967
994 Ga0268266_10294011
995 Ga0268265_10010333
996 Ga0268265_10022682
997 Ga0268265_10073192
998 Ga0268265_10207781
999 Ga0268265_10524294
1000 Ga0268265_10567888
1001 Ga0268264_10009831
1002 Ga0268264_10039539
1003 Ga0268264_10110179
1004 Ga0268264_10127160
1005 Ga0265773_1002644
1006 Ga0265339_10147177
1007 Ga0265331_10072269
1008 Ga0307408_100637678
1009 Ga0265314_10001398
1010 Ga0373941_0068755
1011 Ga0373953_0003424
1012 Ga0373960_0137473
1013 Ga0373943_0190974
1014 Ga0373955_0008033
1015 Ga0373955_0023597
1016 Ga0373961_0041610
1017 Ga0373935_0339100
1018 Ga0373933_0011511
1019 Ga0373947_0144401
1020 Ga0373937_0533463
1021 Ga0373925_0098717
1022 Ga0436365_1067624
1023 Ga0436362_0755166
1024 Ga0436362_0842885
1025 Ga0451577_0171734
1026 Ga0453684_0009588
1027 Ga0451576_0009910
1028 Ga0451576_0148620
1029 Ga0466967_0586950
1030 Ga0495603_0090710
1031 Ga0495650_0000006
1032 Ga0495580_0209228
1033 Ga0495608_0057718
1034 Ga0495628_0135946
1035 Ga0495630_0268411
1036 Ga0495587_0021771
1037 Ga0495645_0004810
1038 Ga0495645_0238873
1039 Ga0495667_0059869
1040 Ga0495656_0137178
1041 Ga0495635_0366575
1042 Ga0495623_0100072
1043 Ga0495647_0010728
1044 Ga0495669_0076102
1045 Ga0495600_0079286
1046 Ga0495581_0172787
1047 Ga0495604_0022610
1048 Ga0495604_0226941
1049 Ga0495680_0077799
1050 Ga0495687_044763
1051 Ga0495684_0027305
1052 Ga0495602_0020548
1053 Ga0496102_0068709
1054 Ga0496102_0100619
1055 Ga0496102_0554066
1056 Ga0496103_0033667
1057 Ga0496104_0128137
1058 Ga0496104_0324459
1059 Ga0496104_0350706
1060 Ga0496104_0489434
1061 Ga0496105_0141563
1062 Ga0496105_0413448
1063 Ga0496106_0101879
1064 Ga0496106_0377177
1065 Ga0496107_0341593
1066 Ga0496108_0002773
1067 Ga0496108_0044443
1068 Ga0496109_0000825
1069 Ga0496109_0410455
1070 Ga0496110_0013434
1071 Ga0496110_0024737
1072 Ga0496110_0120133
1073 Ga0496111_0006500
1074 Ga0496111_0132132
1075 Ga0496111_0261178
1076 Ga0496112_0000097
1077 Ga0496112_0016354
1078 Ga0496112_0066343
1079 Ga0496112_0165335
1080 Ga0496112_0320017
1081 Ga0496113_0041846
1082 Ga0496113_0051492
1083 Ga0496113_0376994
1084 Ga0496113_0578189
1085 Ga0496114_0140775
1086 Ga0496114_0411556
1087 Ga0496115_0059525
1088 Ga0496115_0115289
1089 Ga0496115_0516276
1090 Ga0496119_0176288
1091 Ga0501041_0252665
1092 Ga0501071_0213904
1093 Ga0501072_0434556
1094 Ga0501076_0223961
1095 nmdc:mga05p37_584440_c1
1096 nmdc:mga08y16_60937_c1
1097 nmdc:mga08y16_78940_c1
1098 nmdc:mga0n895_584618_c1
1099 nmdc:mga0n895_63245_c1
1100 nmdc:mga0n895_729_c1
1101 nmdc:mga0rr50_882_c1
1102 nmdc:mga08x19_136341_c1
1103 nmdc:mga08x19_373672_c1
1104 nmdc:mga08x19_53910_c1
1105 nmdc:mga08x19_65149_c1
1106 nmdc:mga08x19_927_c1
1107 nmdc:mga0a205_635411_c1
1108 nmdc:mga0a205_74618_c1
1109 nmdc:mga0a205_992_c1
1110 Ga0495619_0059228

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00174

Oxidored_molyb

Oxidoreductase molybdopterin binding domain

90

234

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
2ca3-assembly1.cif.gz_A sulfite dehydrogenase from starkeya novella r55m mutant 0.9369 99 229
2xts-assembly1.cif.gz_C crystal structure of the sulfane dehydrogenase soxcd from paracoccus pantotrophus 0.9269 97 229
2bpb-assembly1.cif.gz_A sulfite dehydrogenase from starkeya novella 0.9233 97 229
2c9x-assembly1.cif.gz_A sulfite dehydrogenase from starkeya novella y236f mutant 0.923 97 229
1ogp-assembly3.cif.gz_E the crystal structure of plant sulfite oxidase provides insight into sulfite oxidation in plants and animals 0.9122 97 229
ID Description Score Start End Superfamily
2ca4A01 Alpha Beta;Alpha-Beta Complex;Sulfite Oxidase; Chain A, domain 2;Oxidoreductase, molybdopterin-binding domain 0.9275 99 229 3.90.420.10
2xtsA01 Alpha Beta;Alpha-Beta Complex;Sulfite Oxidase; Chain A, domain 2;Oxidoreductase, molybdopterin-binding domain 0.9275 97 229 3.90.420.10
af_Q54XJ8_10_262_3.90.420.10 Alpha Beta;Alpha-Beta Complex;Sulfite Oxidase; Chain A, domain 2;Oxidoreductase, molybdopterin-binding domain 0.9241 97 229 3.90.420.10
af_P96400_291_442_3.90.420.10 Alpha Beta;Alpha-Beta Complex;Sulfite Oxidase; Chain A, domain 2;Oxidoreductase, molybdopterin-binding domain 0.8972 97 229 3.90.420.10
af_I1N786_1_262_3.90.420.10 Alpha Beta;Alpha-Beta Complex;Sulfite Oxidase; Chain A, domain 2;Oxidoreductase, molybdopterin-binding domain 0.807 97 251 3.90.420.10
ID Description Score Start End GO Terms
AF-A0A1Q7CMW5-F1-model_v4 Oxidoreductase molybdopterin-binding domain-containing protein 0.9852 106 216
AF-A0A1Q7CMW5-F1-model_v4 Oxidoreductase molybdopterin-binding domain-containing protein 0.9679 106 216
AF-A0A6I4SVQ0-F1-model_v4 Molybdopterin-dependent oxidoreductase 0.9592 85 209
AF-A0A6J7TS42-F1-model_v4 Unannotated protein 0.9576 97 229
AF-A0A6J7GKJ2-F1-model_v4 Unannotated protein 0.9515 97 229 GO:0016020

Map