F463086

General Info

Members Datasets Scaffolds Average Seq Length
555 244 1110 237

Family's Representative Sequence

Representative Sequence 3300005563|Ga0068855_100765441|Ga0068855_1007654412
Length 242
Sequence MISPMGIAENIAAIRQRIDAAASRVRRDPSEIALMAVCKTKPAEEIRAAYEAGQRLFGENRVQEFHEKSGALTDLLSGDDAAEFHLIGHLQSNKTNRAAEIFHAVDSVDSLAVLERLHTAALRLNKHLPILIEINIGGEDQKAGLAPDSDELEQILQAAPRLLAIGISGLMTVPPFTDDPEGARPYFRRLRELRDHIAARNLPGVSMEELSIGMSHDFEVAIEEGSTCVRVGTAIFGARNYT

Samples

Sample ID Description Type Environment
1 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
2 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
13 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
14 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
15 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
16 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
17 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
18 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
19 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
20 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
21 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
22 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
23 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
24 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
25 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
26 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
27 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
28 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
29 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
30 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
31 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
32 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
33 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
34 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
35 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
36 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
37 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
38 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
39 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
40 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
41 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
42 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
43 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
44 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
45 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
46 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
47 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
48 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
49 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
50 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
51 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
52 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
53 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
54 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
55 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
56 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
57 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
58 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
59 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
60 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
61 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
62 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
63 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
64 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
65 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
66 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
67 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
68 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
69 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
70 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
71 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
72 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
73 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
74 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
75 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
76 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
77 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
78 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
79 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
80 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
81 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
82 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
83 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
84 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
85 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
86 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
87 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
88 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
89 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
90 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
91 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
92 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
93 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
94 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
95 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
96 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
97 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
98 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
99 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
100 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
101 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
102 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
103 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
104 3300022730 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU2 Metagenome Rhizosphere
105 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
166 3300030879 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
167 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
168 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
169 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
170 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
171 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
172 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
173 3300033545 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE4 Metagenome Unclassified
174 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
175 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
176 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
177 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
178 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
179 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
180 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
181 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
182 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
183 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
184 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
185 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
186 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
187 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
188 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
189 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
190 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
191 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
192 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
193 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
194 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
195 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
196 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
197 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
198 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
199 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
200 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
201 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
202 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
203 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
204 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
205 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
206 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
207 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
208 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
209 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
210 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
211 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
212 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
213 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
214 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
215 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
216 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
217 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
218 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
219 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
220 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
221 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
222 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
223 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
224 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
225 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
226 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
227 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
228 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
229 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
230 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
231 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
232 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
233 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
234 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
235 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
236 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
237 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
238 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
239 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
240 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
241 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
242 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
243 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
244 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.74
Metatranscriptomes 1.26
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 5.05
Rhizosphere 94.77
Stem 0
Stem Tuber 0
Unclassified 25.59

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068855_100765441 3300005563 Unclassified 1028
2 MBSR1b_contig_1528414 2162886012 Bacteria 1064
3 MBSR1b_contig_1782974 2162886012 Bacteria 1064
4 Ga0070683_100012083 3300005329 Bacteria 7491
5 Ga0070683_100183174 3300005329 Bacteria 1988
6 Ga0070683_100184167 3300005329 Bacteria 1982
7 Ga0070690_100012194 3300005330 Bacteria 5052
8 Ga0070670_100003670 3300005331 Bacteria 12793
9 Ga0070670_100048417 3300005331 Bacteria 3658
10 Ga0070670_100144680 3300005331 Unclassified 2056
11 Ga0070677_10006410 3300005333 Unclassified 3909
12 Ga0068869_100032444 3300005334 Bacteria 3680
13 Ga0070666_10131503 3300005335 Unclassified 1739
14 Ga0070682_100023124 3300005337 Unclassified 3689
15 Ga0068868_100012287 3300005338 Bacteria 6257
16 Ga0068868_100012948 3300005338 Bacteria 6102
17 Ga0068868_100019511 3300005338 Bacteria 5080
18 Ga0070660_100015331 3300005339 Bacteria 5531
19 Ga0070689_100026875 3300005340 Unclassified 4336
20 Ga0070689_100088201 3300005340 Unclassified 2441
21 Ga0070689_100134408 3300005340 Bacteria 1985
22 Ga0070661_100090559 3300005344 Unclassified 2265
23 Ga0070668_100056334 3300005347 Unclassified 3036
24 Ga0070668_100127627 3300005347 Unclassified 2038
25 Ga0070669_100031734 3300005353 Bacteria 3816
26 Ga0070669_100317792 3300005353 Bacteria 1256
27 Ga0070675_100079695 3300005354 Bacteria 2729
28 Ga0070671_100164765 3300005355 Bacteria 1874
29 Ga0070674_100052947 3300005356 Unclassified 2801
30 Ga0070673_100018739 3300005364 Unclassified 4955
31 Ga0070673_100137793 3300005364 Bacteria 2056
32 Ga0070659_100002666 3300005366 Bacteria 12691
33 Ga0070667_100119940 3300005367 Unclassified 2287
34 Ga0070667_100699570 3300005367 Unclassified 938
35 Ga0070709_10065582 3300005434 Bacteria 2326
36 Ga0070714_100091694 3300005435 Bacteria 2662
37 Ga0070714_100173064 3300005435 Bacteria 1960
38 Ga0070714_100266166 3300005435 Bacteria 1588
39 Ga0070714_100339711 3300005435 Unclassified 1408
40 Ga0070713_100054518 3300005436 Unclassified 3318
41 Ga0070713_100058739 3300005436 Bacteria 3209
42 Ga0070713_100113612 3300005436 Bacteria 2364
43 Ga0070713_100279556 3300005436 Bacteria 1531
44 Ga0070710_10011795 3300005437 Bacteria 4328
45 Ga0070710_10020546 3300005437 Bacteria 3428
46 Ga0070711_100012311 3300005439 Bacteria 5337
47 Ga0070711_100012589 3300005439 Bacteria 5290
48 Ga0070711_100038547 3300005439 Bacteria 3214
49 Ga0070711_100078540 3300005439 Unclassified 2345
50 Ga0070711_100345000 3300005439 Bacteria 1196
51 Ga0070705_100200943 3300005440 Bacteria 1366
52 Ga0070708_101001314 3300005445 Unclassified 784
53 Ga0070663_100018203 3300005455 Unclassified 4599
54 Ga0070678_100033339 3300005456 Bacteria 3575
55 Ga0070678_100263519 3300005456 Unclassified 1450
56 Ga0070662_100005317 3300005457 Bacteria 8223
57 Ga0070681_10001100 3300005458 Bacteria 23120
58 Ga0070681_10003480 3300005458 Bacteria 14751
59 Ga0070681_10303423 3300005458 Bacteria 1506
60 Ga0068867_100073676 3300005459 Bacteria 2557
61 Ga0068867_100360599 3300005459 Unclassified 1216
62 Ga0070685_10093924 3300005466 Unclassified 1820
63 Ga0070706_100000278 3300005467 Bacteria 62365
64 Ga0070707_100022230 3300005468 Bacteria 5996
65 Ga0070707_100076687 3300005468 Unclassified 3224
66 Ga0070707_100216107 3300005468 Bacteria 1868
67 Ga0070698_100051792 3300005471 Unclassified 4179
68 Ga0070698_100110325 3300005471 Bacteria 2716
69 Ga0070699_100002709 3300005518 Bacteria 15794
70 Ga0070699_100020254 3300005518 Bacteria 5735
71 Ga0070679_100063805 3300005530 Bacteria 3672
72 Ga0070679_100091382 3300005530 Bacteria 3032
73 Ga0070684_100009298 3300005535 Bacteria 7736
74 Ga0070684_100057935 3300005535 Bacteria 3383
75 Ga0070684_100243220 3300005535 Bacteria 1644
76 Ga0070697_100000049 3300005536 Bacteria 90362
77 Ga0070697_100000158 3300005536 Bacteria 55228
78 Ga0070697_100005879 3300005536 Bacteria 9469
79 Ga0068853_100006343 3300005539 Bacteria 9387
80 Ga0068853_100024017 3300005539 Bacteria 5109
81 Ga0068853_100041531 3300005539 Bacteria 3930
82 Ga0068853_100132907 3300005539 Bacteria 2229
83 Ga0070672_100087257 3300005543 Unclassified 2510
84 Ga0070686_100087276 3300005544 Unclassified 2079
85 Ga0070695_100048381 3300005545 Bacteria 2719
86 Ga0070696_100008369 3300005546 Bacteria 6920
87 Ga0070704_100150447 3300005549 Bacteria 1829
88 Ga0068855_100003643 3300005563 Bacteria 18833
89 Ga0068855_100063779 3300005563 Bacteria 4299
90 Ga0068855_100137310 3300005563 Unclassified 2789
91 Ga0070664_100000538 3300005564 Bacteria 28884
92 Ga0070664_100022774 3300005564 Bacteria 5168
93 Ga0068857_100000081 3300005577 Bacteria 55561
94 Ga0068857_100021579 3300005577 Bacteria 5666
95 Ga0068857_100029113 3300005577 Bacteria 4873
96 Ga0068857_100031365 3300005577 Bacteria 4696
97 Ga0068854_100004626 3300005578 Bacteria 8679
98 Ga0068854_100094421 3300005578 Bacteria 2231
99 Ga0068854_100854600 3300005578 Unclassified 797
100 Ga0068856_100000394 3300005614 Bacteria 47803
101 Ga0068856_100001986 3300005614 Bacteria 21328
102 Ga0068856_100008311 3300005614 Bacteria 10113
103 Ga0068856_100020557 3300005614 Bacteria 6412
104 Ga0068856_100027370 3300005614 Bacteria 5562
105 Ga0070702_100036892 3300005615 Unclassified 2712
106 Ga0068852_100093344 3300005616 Unclassified 2697
107 Ga0068852_100161338 3300005616 Unclassified 2093
108 Ga0068852_100306019 3300005616 Unclassified 1540
109 Ga0068852_100621350 3300005616 Unclassified 1086
110 Ga0068852_100909533 3300005616 Unclassified 897
111 Ga0068859_100000290 3300005617 Bacteria 49956
112 Ga0068864_100001275 3300005618 Bacteria 20944
113 Ga0068864_100018702 3300005618 Bacteria 5790
114 Ga0068864_100089470 3300005618 Unclassified 2712
115 Ga0068866_10205089 3300005718 Bacteria 1180
116 Ga0068861_100277429 3300005719 Unclassified 1442
117 Ga0068851_10026488 3300005834 Unclassified 2849
118 Ga0068851_10107976 3300005834 Bacteria 1483
119 Ga0068851_10423839 3300005834 Unclassified 786
120 Ga0068863_100008272 3300005841 Bacteria 10164
121 Ga0068863_100134013 3300005841 Bacteria 2366
122 Ga0068858_100001619 3300005842 Bacteria 22968
123 Ga0068858_100002791 3300005842 Bacteria 17553
124 Ga0068858_100077679 3300005842 Unclassified 3084
125 Ga0068858_100126941 3300005842 Unclassified 2389
126 Ga0068858_100237633 3300005842 Bacteria 1728
127 Ga0068860_100005894 3300005843 Bacteria 12335
128 Ga0068860_100011500 3300005843 Bacteria 8721
129 Ga0068860_100065442 3300005843 Unclassified 3452
130 Ga0068860_100160110 3300005843 Bacteria 2170
131 Ga0068862_100036273 3300005844 Unclassified 4179
132 Ga0081540_1110156 3300005983 Bacteria 1166
133 Ga0081540_1147245 3300005983 Unclassified 935
134 Ga0070717_10004359 3300006028 Bacteria 10210
135 Ga0070717_10020604 3300006028 Bacteria 5189
136 Ga0070717_10226286 3300006028 Bacteria 1646
137 Ga0070717_10236080 3300006028 Bacteria 1611
138 Ga0070715_10050443 3300006163 Bacteria 1787
139 Ga0070715_10063341 3300006163 Unclassified 1630
140 Ga0070715_10122083 3300006163 Bacteria 1243
141 Ga0070716_100003540 3300006173 Bacteria 7367
142 Ga0070716_100080483 3300006173 Bacteria 1942
143 Ga0070712_100002390 3300006175 Bacteria 11557
144 Ga0070712_100012269 3300006175 Bacteria 5447
145 Ga0070712_100059128 3300006175 Bacteria 2698
146 Ga0070712_100552249 3300006175 Bacteria 970
147 Ga0070712_100890687 3300006175 Bacteria 767
148 Ga0097621_100002603 3300006237 Bacteria 12369
149 Ga0097621_100004265 3300006237 Bacteria 9933
150 Ga0097621_100159158 3300006237 Unclassified 1940
151 Ga0068871_100001192 3300006358 Bacteria 17360
152 Ga0068871_100007456 3300006358 Bacteria 7820
153 Ga0068871_100018971 3300006358 Bacteria 5242
154 Ga0068871_100185995 3300006358 Unclassified 1787
155 Ga0075433_10001098 3300006852 Bacteria 19537
156 Ga0075434_100000195 3300006871 Bacteria 40479
157 Ga0068865_100008484 3300006881 Bacteria 6353
158 Ga0068865_100186635 3300006881 Bacteria 1600
159 Ga0075436_100004841 3300006914 Bacteria 9252
160 Ga0075436_100042255 3300006914 Bacteria 3144
161 Ga0075436_100275532 3300006914 Bacteria 1202
162 Ga0075436_100561083 3300006914 Unclassified 839
163 Ga0097620_100000290 3300006931 Bacteria 49956
164 Ga0075435_100000065 3300007076 Bacteria 54666
165 Ga0105250_10028996 3300009092 Unclassified 2227
166 Ga0105240_10017855 3300009093 Bacteria 9546
167 Ga0105240_10029292 3300009093 Bacteria 7176
168 Ga0105240_10065441 3300009093 Bacteria 4512
169 Ga0105240_10078716 3300009093 Bacteria 4058
170 Ga0105240_10504761 3300009093 Unclassified 1344
171 Ga0105240_10624398 3300009093 Unclassified 1184
172 Ga0105245_10002858 3300009098 Bacteria 15509
173 Ga0105245_10008495 3300009098 Bacteria 8958
174 Ga0105245_10054629 3300009098 Unclassified 3587
175 Ga0105245_10065607 3300009098 Unclassified 3283
176 Ga0105245_10324423 3300009098 Bacteria 1518
177 Ga0105245_10550211 3300009098 Bacteria 1176
178 Ga0105247_10006341 3300009101 Bacteria 7329
179 Ga0105241_10023905 3300009174 Bacteria 4535
180 Ga0105241_10044572 3300009174 Bacteria 3361
181 Ga0105241_10087172 3300009174 Bacteria 2456
182 Ga0105241_10117430 3300009174 Bacteria 2138
183 Ga0105241_10153074 3300009174 Unclassified 1888
184 Ga0105241_10165548 3300009174 Unclassified 1822
185 Ga0105241_10184527 3300009174 Bacteria 1733
186 Ga0105241_10227097 3300009174 Unclassified 1572
187 Ga0105241_10330440 3300009174 Unclassified 1317
188 Ga0105242_10009165 3300009176 Bacteria 7598
189 Ga0105242_10499047 3300009176 Bacteria 1157
190 Ga0105248_10021967 3300009177 Bacteria 7071
191 Ga0105248_10258562 3300009177 Unclassified 1960
192 Ga0105248_10382344 3300009177 Unclassified 1585
193 Ga0105237_10063189 3300009545 Bacteria 3700
194 Ga0105237_10183979 3300009545 Bacteria 2089
195 Ga0105237_10236827 3300009545 Bacteria 1827
196 Ga0105237_10403751 3300009545 Unclassified 1371
197 Ga0105237_10501110 3300009545 Bacteria 1221
198 Ga0105237_10681760 3300009545 Bacteria 1034
199 Ga0105238_10000417 3300009551 Bacteria 44911
200 Ga0105238_10014582 3300009551 Bacteria 7945
201 Ga0105238_10227665 3300009551 Unclassified 1841
202 Ga0105238_10317607 3300009551 Bacteria 1543
203 Ga0105238_10346525 3300009551 Unclassified 1474
204 Ga0105249_10024924 3300009553 Bacteria 5382
205 Ga0105249_10107413 3300009553 Unclassified 2634
206 Ga0099796_10063845 3300010159 Bacteria 1312
207 Ga0105239_10014364 3300010375 Bacteria 8786
208 Ga0105239_10114979 3300010375 Bacteria 2985
209 Ga0105239_10150419 3300010375 Unclassified 2598
210 Ga0105239_10221559 3300010375 Bacteria 2121
211 Ga0105239_10384835 3300010375 Unclassified 1586
212 Ga0105246_10007122 3300011119 Bacteria 6846
213 Ga0105246_10011181 3300011119 Bacteria 5564
214 Ga0105246_10087410 3300011119 Bacteria 2237
215 Ga0157373_10180002 3300013100 Unclassified 1488
216 Ga0157373_10244058 3300013100 Bacteria 1270
217 Ga0157373_10360623 3300013100 Unclassified 1038
218 Ga0157373_10548369 3300013100 Unclassified 838
219 Ga0157371_10098202 3300013102 Unclassified 2076
220 Ga0157371_10528214 3300013102 Unclassified 873
221 Ga0157370_10166681 3300013104 Unclassified 2049
222 Ga0157370_10516345 3300013104 Unclassified 1097
223 Ga0157369_10000258 3300013105 Bacteria 72711
224 Ga0157369_10499701 3300013105 Bacteria 1258
225 Ga0157374_10001052 3300013296 Bacteria 23995
226 Ga0157374_10001435 3300013296 Bacteria 20148
227 Ga0157374_10005580 3300013296 Bacteria 10593
228 Ga0157374_10012766 3300013296 Bacteria 7319
229 Ga0157374_10048161 3300013296 Bacteria 3955
230 Ga0157374_10109111 3300013296 Bacteria 2660
231 Ga0157378_10000541 3300013297 Bacteria 35976
232 Ga0157378_10002142 3300013297 Bacteria 17530
233 Ga0157378_10024706 3300013297 Bacteria 5290
234 Ga0157378_10206842 3300013297 Bacteria 1859
235 Ga0163162_10002555 3300013306 Bacteria 17229
236 Ga0163162_10004210 3300013306 Bacteria 13826
237 Ga0157372_10000335 3300013307 Bacteria 51775
238 Ga0157372_10001168 3300013307 Bacteria 28395
239 Ga0157372_10004868 3300013307 Bacteria 14272
240 Ga0157372_10010989 3300013307 Bacteria 9635
241 Ga0157372_10043120 3300013307 Unclassified 4993
242 Ga0157372_10144870 3300013307 Bacteria 2739
243 Ga0157372_10220384 3300013307 Unclassified 2199
244 Ga0157372_10781105 3300013307 Unclassified 1110
245 Ga0157372_10802984 3300013307 Bacteria 1093
246 Ga0157375_10078465 3300013308 Bacteria 3335
247 Ga0157375_10084316 3300013308 Unclassified 3226
248 Ga0157375_11569969 3300013308 Bacteria 778
249 Ga0163163_10004099 3300014325 Bacteria 12433
250 Ga0163163_10027698 3300014325 Bacteria 5432
251 Ga0163163_10028700 3300014325 Bacteria 5347
252 Ga0163163_10030507 3300014325 Bacteria 5195
253 Ga0163163_10210862 3300014325 Bacteria 1992
254 Ga0157380_10027507 3300014326 Unclassified 4325
255 Ga0157377_10001555 3300014745 Bacteria 9979
256 Ga0157377_10120179 3300014745 Unclassified 1591
257 Ga0157379_10057448 3300014968 Unclassified 3478
258 Ga0157379_10062392 3300014968 Bacteria 3333
259 Ga0157376_10026684 3300014969 Bacteria 4567
260 Ga0163161_10008769 3300017792 Bacteria 6990
261 Ga0224570_101606 3300022730 Bacteria 1642
262 Ga0207697_10016188 3300025315 Unclassified 3075
263 Ga0207656_10014138 3300025321 Unclassified 3068
264 Ga0207656_10071485 3300025321 Bacteria 1543
265 Ga0207656_10195614 3300025321 Unclassified 975
266 Ga0207692_10002000 3300025898 Bacteria 7789
267 Ga0207692_10325845 3300025898 Bacteria 941
268 Ga0207642_10114315 3300025899 Unclassified 1380
269 Ga0207642_10148907 3300025899 Bacteria 1243
270 Ga0207710_10065474 3300025900 Bacteria 1657
271 Ga0207688_10007283 3300025901 Bacteria 6021
272 Ga0207680_10019827 3300025903 Unclassified 3605
273 Ga0207647_10002874 3300025904 Bacteria 12974
274 Ga0207647_10008899 3300025904 Bacteria 7160
275 Ga0207647_10032472 3300025904 Unclassified 3352
276 Ga0207685_10057151 3300025905 Bacteria 1529
277 Ga0207685_10061440 3300025905 Bacteria 1489
278 Ga0207685_10100452 3300025905 Unclassified 1236
279 Ga0207699_10041384 3300025906 Unclassified 2661
280 Ga0207645_10007489 3300025907 Bacteria 7704
281 Ga0207643_10000639 3300025908 Bacteria 21958
282 Ga0207684_10001907 3300025910 Bacteria 21656
283 Ga0207684_10232864 3300025910 Bacteria 1589
284 Ga0207654_10032167 3300025911 Unclassified 2896
285 Ga0207654_10098528 3300025911 Unclassified 1796
286 Ga0207654_10113626 3300025911 Unclassified 1689
287 Ga0207654_10123476 3300025911 Bacteria 1629
288 Ga0207707_10033457 3300025912 Bacteria 4499
289 Ga0207707_10034516 3300025912 Bacteria 4426
290 Ga0207707_10049869 3300025912 Bacteria 3647
291 Ga0207707_10150627 3300025912 Unclassified 2034
292 Ga0207707_10217226 3300025912 Bacteria 1665
293 Ga0207707_10222184 3300025912 Unclassified 1644
294 Ga0207695_10022649 3300025913 Bacteria 7122
295 Ga0207695_10206793 3300025913 Bacteria 1875
296 Ga0207695_10440806 3300025913 Bacteria 1186
297 Ga0207693_10000402 3300025915 Bacteria 39488
298 Ga0207693_10008118 3300025915 Bacteria 8605
299 Ga0207693_10051323 3300025915 Bacteria 3237
300 Ga0207693_10051802 3300025915 Bacteria 3220
301 Ga0207693_10159841 3300025915 Bacteria 1772
302 Ga0207663_10003860 3300025916 Bacteria 7397
303 Ga0207663_10004728 3300025916 Bacteria 6803
304 Ga0207663_10347560 3300025916 Bacteria 1122
305 Ga0207660_10019093 3300025917 Bacteria 4578
306 Ga0207657_10001261 3300025919 Bacteria 27065
307 Ga0207649_10001661 3300025920 Bacteria 12866
308 Ga0207649_10488438 3300025920 Unclassified 935
309 Ga0207652_10168593 3300025921 Bacteria 1964
310 Ga0207646_10282658 3300025922 Bacteria 1499
311 Ga0207646_10483205 3300025922 Bacteria 1117
312 Ga0207694_10000284 3300025924 Bacteria 47825
313 Ga0207694_10053209 3300025924 Bacteria 3138
314 Ga0207694_10171950 3300025924 Bacteria 1754
315 Ga0207650_10000177 3300025925 Bacteria 75244
316 Ga0207650_10017093 3300025925 Bacteria 5078
317 Ga0207659_10361037 3300025926 Unclassified 1207
318 Ga0207687_10003150 3300025927 Bacteria 11190
319 Ga0207687_10064410 3300025927 Bacteria 2599
320 Ga0207687_10067507 3300025927 Unclassified 2544
321 Ga0207700_10006979 3300025928 Bacteria 6872
322 Ga0207700_10025629 3300025928 Unclassified 4099
323 Ga0207700_10028535 3300025928 Unclassified 3925
324 Ga0207700_10037677 3300025928 Bacteria 3504
325 Ga0207700_10202489 3300025928 Bacteria 1674
326 Ga0207700_10222605 3300025928 Bacteria 1600
327 Ga0207700_10259523 3300025928 Bacteria 1487
328 Ga0207700_10308062 3300025928 Bacteria 1369
329 Ga0207664_10096008 3300025929 Bacteria 2439
330 Ga0207664_10294738 3300025929 Unclassified 1426
331 Ga0207644_10149614 3300025931 Bacteria 1805
332 Ga0207644_10202574 3300025931 Bacteria 1566
333 Ga0207706_10000941 3300025933 Bacteria 29750
334 Ga0207706_10019421 3300025933 Bacteria 6115
335 Ga0207686_10019667 3300025934 Unclassified 3845
336 Ga0207686_10133952 3300025934 Bacteria 1703
337 Ga0207670_10060919 3300025936 Bacteria 2573
338 Ga0207704_10003491 3300025938 Bacteria 7154
339 Ga0207704_10019678 3300025938 Bacteria 3552
340 Ga0207665_10000358 3300025939 Bacteria 31676
341 Ga0207665_10037700 3300025939 Bacteria 3218
342 Ga0207665_10184325 3300025939 Unclassified 1513
343 Ga0207665_10282537 3300025939 Bacteria 1235
344 Ga0207691_10001447 3300025940 Bacteria 23651
345 Ga0207711_10183843 3300025941 Bacteria 1902
346 Ga0207689_10000542 3300025942 Bacteria 35861
347 Ga0207689_10002307 3300025942 Bacteria 17863
348 Ga0207661_10016213 3300025944 Bacteria 5494
349 Ga0207661_10065537 3300025944 Bacteria 2949
350 Ga0207661_10100415 3300025944 Bacteria 2429
351 Ga0207679_10000143 3300025945 Bacteria 59141
352 Ga0207679_10021292 3300025945 Bacteria 4394
353 Ga0207667_10000487 3300025949 Bacteria 52501
354 Ga0207667_10008691 3300025949 Bacteria 12035
355 Ga0207667_10024560 3300025949 Bacteria 6613
356 Ga0207667_10130156 3300025949 Unclassified 2592
357 Ga0207667_10151125 3300025949 Bacteria 2390
358 Ga0207667_10172327 3300025949 Bacteria 2224
359 Ga0207667_10566164 3300025949 Unclassified 1148
360 Ga0207667_10813166 3300025949 Unclassified 931
361 Ga0207651_10030416 3300025960 Bacteria 3438
362 Ga0207651_10084353 3300025960 Bacteria 2301
363 Ga0207651_10551283 3300025960 Bacteria 1002
364 Ga0207712_10021844 3300025961 Unclassified 4206
365 Ga0207668_10013931 3300025972 Bacteria 4967
366 Ga0207640_10047553 3300025981 Unclassified 2768
367 Ga0207640_10078549 3300025981 Bacteria 2247
368 Ga0207658_10015504 3300025986 Bacteria 5228
369 Ga0207658_10632976 3300025986 Unclassified 963
370 Ga0207677_10000998 3300026023 Bacteria 15626
371 Ga0207677_10002399 3300026023 Bacteria 9824
372 Ga0207677_10109793 3300026023 Bacteria 2052
373 Ga0207677_10314679 3300026023 Bacteria 1299
374 Ga0207677_10628603 3300026023 Unclassified 945
375 Ga0207703_10006117 3300026035 Bacteria 9633
376 Ga0207703_10010977 3300026035 Bacteria 7058
377 Ga0207703_10017812 3300026035 Bacteria 5547
378 Ga0207703_10083353 3300026035 Bacteria 2671
379 Ga0207703_10176019 3300026035 Bacteria 1885
380 Ga0207639_10012639 3300026041 Bacteria 5885
381 Ga0207639_10518496 3300026041 Bacteria 1091
382 Ga0207678_10001668 3300026067 Bacteria 20376
383 Ga0207702_10000482 3300026078 Bacteria 44849
384 Ga0207702_10003272 3300026078 Bacteria 14951
385 Ga0207702_10028596 3300026078 Unclassified 4634
386 Ga0207702_10039405 3300026078 Unclassified 3958
387 Ga0207702_10077565 3300026078 Bacteria 2874
388 Ga0207702_10275050 3300026078 Bacteria 1590
389 Ga0207641_10003028 3300026088 Bacteria 15142
390 Ga0207641_10209389 3300026088 Unclassified 1802
391 Ga0207641_10307463 3300026088 Bacteria 1499
392 Ga0207648_10008810 3300026089 Bacteria 9719
393 Ga0207648_10019097 3300026089 Bacteria 6187
394 Ga0207648_10363612 3300026089 Bacteria 1306
395 Ga0207676_10001159 3300026095 Bacteria 19817
396 Ga0207676_10002377 3300026095 Bacteria 13429
397 Ga0207674_10000195 3300026116 Bacteria 75067
398 Ga0207674_10000229 3300026116 Bacteria 69982
399 Ga0207674_10009145 3300026116 Bacteria 11363
400 Ga0207674_10014217 3300026116 Bacteria 8795
401 Ga0207674_10034006 3300026116 Bacteria 5332
402 Ga0207675_100399215 3300026118 Unclassified 1355
403 Ga0207683_10003688 3300026121 Bacteria 13306
404 Ga0207698_10027346 3300026142 Bacteria 4048
405 Ga0207698_10062953 3300026142 Bacteria 2900
406 Ga0207698_10158217 3300026142 Unclassified 1977
407 Ga0207698_10271381 3300026142 Unclassified 1564
408 Ga0268265_10056860 3300028380 Bacteria 2979
409 Ga0268264_10080074 3300028381 Bacteria 2788
410 Ga0268264_10102638 3300028381 Bacteria 2489
411 Ga0268264_10192689 3300028381 Unclassified 1859
412 Ga0268264_10346169 3300028381 Unclassified 1413
413 Ga0265762_1000119 3300030760 Bacteria 11713
414 Ga0265762_1057041 3300030760 Bacteria 795
415 Ga0265765_1003676 3300030879 Unclassified 1548
416 Ga0265760_10003665 3300031090 Bacteria 4452
417 Ga0265760_10004688 3300031090 Bacteria 3914
418 Ga0265760_10008406 3300031090 Bacteria 2953
419 Ga0265760_10010644 3300031090 Bacteria 2628
420 Ga0265328_10045711 3300031239 Unclassified 1610
421 Ga0265325_10026032 3300031241 Bacteria 3172
422 Ga0265340_10041679 3300031247 Unclassified 2256
423 Ga0265339_10164856 3300031249 Unclassified 1113
424 Ga0265314_10109198 3300031711 Unclassified 1761
425 Ga0316214_1012801 3300033545 Bacteria 1147
426 Ga0373926_0015941 3300035083 Bacteria 2566
427 Ga0373934_0147038 3300035086 Bacteria 964
428 Ga0373923_0036252 3300035111 Bacteria 2012
429 Ga0373936_0004184 3300035113 Bacteria 5439
430 Ga0373945_0021506 3300035116 Bacteria 2217
431 Ga0373954_0301359 3300035118 Bacteria 791
432 Ga0373956_0012621 3300035119 Bacteria 3505
433 Ga0373956_0043386 3300035119 Bacteria 2002
434 Ga0373956_0104490 3300035119 Bacteria 1316
435 Ga0373943_0000047 3300035170 Bacteria 41181
436 Ga0373943_0001571 3300035170 Bacteria 10341
437 Ga0373946_0037452 3300035171 Bacteria 1971
438 Ga0373955_0012079 3300035172 Bacteria 4142
439 Ga0373955_0128684 3300035172 Bacteria 1477
440 Ga0373955_0164239 3300035172 Bacteria 1312
441 Ga0373924_0020440 3300035410 Unclassified 2574
442 Ga0373924_0036100 3300035410 Unclassified 2007
443 Ga0373924_0132583 3300035410 Bacteria 1084
444 Ga0373931_0025417 3300035691 Bacteria 3008
445 Ga0373935_0000841 3300035692 Bacteria 16552
446 Ga0373935_0001112 3300035692 Bacteria 14666
447 Ga0373935_0001333 3300035692 Bacteria 13657
448 Ga0373935_0149794 3300035692 Bacteria 1582
449 Ga0373935_0225206 3300035692 Unclassified 1304
450 Ga0373927_0000447 3300035695 Bacteria 31498
451 Ga0373927_0004796 3300035695 Bacteria 9410
452 Ga0373927_0082982 3300035695 Bacteria 2078
453 Ga0373927_0089947 3300035695 Bacteria 1993
454 Ga0373927_0107307 3300035695 Bacteria 1819
455 Ga0373933_0012118 3300035724 Bacteria 4761
456 Ga0373933_0072959 3300035724 Bacteria 2091
457 Ga0373947_0000112 3300035725 Bacteria 40758
458 Ga0373947_0027135 3300035725 Bacteria 3350
459 Ga0373947_0052737 3300035725 Bacteria 2450
460 Ga0373947_0100168 3300035725 Bacteria 1820
461 Ga0373937_0000204 3300036401 Bacteria 57131
462 Ga0373937_0121435 3300036401 Bacteria 2435
463 Ga0373937_0138477 3300036401 Bacteria 2276
464 Ga0373937_0147343 3300036401 Unclassified 2204
465 Ga0373937_0317780 3300036401 Bacteria 1473
466 Ga0373925_0000770 3300037068 Bacteria 29427
467 Ga0373925_0001810 3300037068 Bacteria 17840
468 Ga0373925_0008172 3300037068 Bacteria 7620
469 Ga0373925_0008202 3300037068 Bacteria 7604
470 Ga0373925_0042863 3300037068 Bacteria 3357
471 Ga0395901_0254013 3300038443 Unclassified 1831
472 Ga0466963_0001070 3300044694 Bacteria 14274
473 Ga0453684_0435579 3300044712 Unclassified 1462
474 Ga0451576_0358914 3300045051 Bacteria 1526
475 Ga0451576_0394431 3300045051 Bacteria 1451
476 Ga0451576_0462429 3300045051 Unclassified 1332
477 Ga0466958_0254892 3300045836 Unclassified 1123
478 Ga0466967_0005563 3300045976 Bacteria 8753
479 Ga0466967_0377625 3300045976 Bacteria 1376
480 Ga0495603_0057720 3300046455 Unclassified 2296
481 Ga0495603_0390896 3300046455 Unclassified 797
482 Ga0495651_0131872 3300046462 Bacteria 1823
483 Ga0495580_0001544 3300046472 Bacteria 20251
484 Ga0495580_0007898 3300046472 Bacteria 8510
485 Ga0495580_0008448 3300046472 Bacteria 8191
486 Ga0495580_0020794 3300046472 Unclassified 4851
487 Ga0495580_0124153 3300046472 Bacteria 1792
488 Ga0495580_0131868 3300046472 Bacteria 1733
489 Ga0495582_0048059 3300046473 Bacteria 2350
490 Ga0495582_0258575 3300046473 Bacteria 999
491 Ga0495639_0101969 3300046475 Bacteria 1356
492 Ga0495664_0200912 3300046477 Unclassified 1208
493 Ga0495628_0211608 3300046516 Bacteria 1458
494 Ga0495652_0352663 3300046529 Bacteria 1054
495 Ga0495665_0006637 3300046531 Bacteria 6245
496 Ga0495665_0020860 3300046531 Bacteria 3520
497 Ga0495667_0430715 3300046559 Bacteria 830
498 Ga0495635_0262559 3300046663 Bacteria 1163
499 Ga0495599_0412917 3300046678 Bacteria 803
500 Ga0495623_0001371 3300046679 Bacteria 16530
501 Ga0495658_0022720 3300046683 Bacteria 3321
502 Ga0495669_0105202 3300046684 Unclassified 1314
503 Ga0495581_0018527 3300047315 Bacteria 4043
504 Ga0495581_0041757 3300047315 Bacteria 2655
505 Ga0495604_0090018 3300047317 Bacteria 2280
506 Ga0495674_0034545 3300047319 Bacteria 4572
507 Ga0496100_0359218 3300048903 Bacteria 1102
508 Ga0496101_0209200 3300048904 Unclassified 1511
509 Ga0496102_0241091 3300048905 Bacteria 1705
510 Ga0496102_0275079 3300048905 Bacteria 1587
511 Ga0496102_0485209 3300048905 Unclassified 1157
512 Ga0496104_0101247 3300048907 Bacteria 2758
513 Ga0496104_0224142 3300048907 Bacteria 1792
514 Ga0496105_0020434 3300048908 Bacteria 5350
515 Ga0496107_0280146 3300048910 Bacteria 1241
516 Ga0496108_0000689 3300048911 Bacteria 26147
517 Ga0496108_0013237 3300048911 Bacteria 6724
518 Ga0496109_0001300 3300048912 Bacteria 20670
519 Ga0496109_0034301 3300048912 Bacteria 4570
520 Ga0496110_0008161 3300048913 Bacteria 8412
521 Ga0496110_0042861 3300048913 Bacteria 3950
522 Ga0496110_0251347 3300048913 Bacteria 1609
523 Ga0496111_0102159 3300048914 Bacteria 2107
524 Ga0496111_0197289 3300048914 Unclassified 1496
525 Ga0496112_0006571 3300048915 Bacteria 10232
526 Ga0496112_0027881 3300048915 Bacteria 5448
527 Ga0496112_0042724 3300048915 Unclassified 4435
528 Ga0496112_0043787 3300048915 Bacteria 4383
529 Ga0496112_0072910 3300048915 Bacteria 3394
530 Ga0496112_0083914 3300048915 Bacteria 3151
531 Ga0496112_0085247 3300048915 Bacteria 3126
532 Ga0496113_0003019 3300048916 Bacteria 9971
533 Ga0496113_0004283 3300048916 Bacteria 8742
534 Ga0496115_0065577 3300048918 Bacteria 2933
535 Ga0501031_0645590 3300049568 Unclassified 680
536 Ga0501040_0129757 3300049576 Unclassified 1772
537 Ga0501042_0307744 3300049578 Unclassified 1145
538 Ga0501071_0015344 3300049587 Bacteria 5258
539 Ga0501075_0030607 3300049591 Bacteria 3988
540 Ga0501076_0080135 3300049592 Unclassified 2620
541 Ga0501079_0134427 3300049741 Unclassified 1925
542 Ga0501080_0141223 3300049742 Unclassified 2226
543 Ga0501081_0291844 3300049743 Bacteria 1195
544 nmdc:mga0n895_133536_c1 3300050512 Bacteria 2508
545 nmdc:mga0n895_1564_c1 3300050512 Bacteria 17207
546 nmdc:mga0rr50_40678_c1 3300050513 Bacteria 3381
547 nmdc:mga0rr50_6304_c1 3300050513 Bacteria 7204
548 nmdc:mga0rr50_7316_c1 3300050513 Bacteria 6796
549 nmdc:mga08x19_2888_c1 3300050514 Bacteria 10345
550 nmdc:mga08x19_3182_c1 3300050514 Bacteria 9850
551 nmdc:mga08x19_35485_c1 3300050514 Bacteria 3155
552 nmdc:mga0a205_1800_c1 3300050515 Bacteria 18534
553 Ga0495619_0129171 3300053085 Bacteria 1736
554 Ga0501082_0029757 3300060353 Bacteria 4705
555 Ga0530510_0021704 3300061734 Bacteria 4568
556 Ga0068855_100765441
557 MBSR1b_contig_1528414
558 MBSR1b_contig_1782974
559 Ga0070683_100012083
560 Ga0070683_100183174
561 Ga0070683_100184167
562 Ga0070690_100012194
563 Ga0070670_100003670
564 Ga0070670_100048417
565 Ga0070670_100144680
566 Ga0070677_10006410
567 Ga0068869_100032444
568 Ga0070666_10131503
569 Ga0070682_100023124
570 Ga0068868_100012287
571 Ga0068868_100012948
572 Ga0068868_100019511
573 Ga0070660_100015331
574 Ga0070689_100026875
575 Ga0070689_100088201
576 Ga0070689_100134408
577 Ga0070661_100090559
578 Ga0070668_100056334
579 Ga0070668_100127627
580 Ga0070669_100031734
581 Ga0070669_100317792
582 Ga0070675_100079695
583 Ga0070671_100164765
584 Ga0070674_100052947
585 Ga0070673_100018739
586 Ga0070673_100137793
587 Ga0070659_100002666
588 Ga0070667_100119940
589 Ga0070667_100699570
590 Ga0070709_10065582
591 Ga0070714_100091694
592 Ga0070714_100173064
593 Ga0070714_100266166
594 Ga0070714_100339711
595 Ga0070713_100054518
596 Ga0070713_100058739
597 Ga0070713_100113612
598 Ga0070713_100279556
599 Ga0070710_10011795
600 Ga0070710_10020546
601 Ga0070711_100012311
602 Ga0070711_100012589
603 Ga0070711_100038547
604 Ga0070711_100078540
605 Ga0070711_100345000
606 Ga0070705_100200943
607 Ga0070708_101001314
608 Ga0070663_100018203
609 Ga0070678_100033339
610 Ga0070678_100263519
611 Ga0070662_100005317
612 Ga0070681_10001100
613 Ga0070681_10003480
614 Ga0070681_10303423
615 Ga0068867_100073676
616 Ga0068867_100360599
617 Ga0070685_10093924
618 Ga0070706_100000278
619 Ga0070707_100022230
620 Ga0070707_100076687
621 Ga0070707_100216107
622 Ga0070698_100051792
623 Ga0070698_100110325
624 Ga0070699_100002709
625 Ga0070699_100020254
626 Ga0070679_100063805
627 Ga0070679_100091382
628 Ga0070684_100009298
629 Ga0070684_100057935
630 Ga0070684_100243220
631 Ga0070697_100000049
632 Ga0070697_100000158
633 Ga0070697_100005879
634 Ga0068853_100006343
635 Ga0068853_100024017
636 Ga0068853_100041531
637 Ga0068853_100132907
638 Ga0070672_100087257
639 Ga0070686_100087276
640 Ga0070695_100048381
641 Ga0070696_100008369
642 Ga0070704_100150447
643 Ga0068855_100003643
644 Ga0068855_100063779
645 Ga0068855_100137310
646 Ga0070664_100000538
647 Ga0070664_100022774
648 Ga0068857_100000081
649 Ga0068857_100021579
650 Ga0068857_100029113
651 Ga0068857_100031365
652 Ga0068854_100004626
653 Ga0068854_100094421
654 Ga0068854_100854600
655 Ga0068856_100000394
656 Ga0068856_100001986
657 Ga0068856_100008311
658 Ga0068856_100020557
659 Ga0068856_100027370
660 Ga0070702_100036892
661 Ga0068852_100093344
662 Ga0068852_100161338
663 Ga0068852_100306019
664 Ga0068852_100621350
665 Ga0068852_100909533
666 Ga0068859_100000290
667 Ga0068864_100001275
668 Ga0068864_100018702
669 Ga0068864_100089470
670 Ga0068866_10205089
671 Ga0068861_100277429
672 Ga0068851_10026488
673 Ga0068851_10107976
674 Ga0068851_10423839
675 Ga0068863_100008272
676 Ga0068863_100134013
677 Ga0068858_100001619
678 Ga0068858_100002791
679 Ga0068858_100077679
680 Ga0068858_100126941
681 Ga0068858_100237633
682 Ga0068860_100005894
683 Ga0068860_100011500
684 Ga0068860_100065442
685 Ga0068860_100160110
686 Ga0068862_100036273
687 Ga0081540_1110156
688 Ga0081540_1147245
689 Ga0070717_10004359
690 Ga0070717_10020604
691 Ga0070717_10226286
692 Ga0070717_10236080
693 Ga0070715_10050443
694 Ga0070715_10063341
695 Ga0070715_10122083
696 Ga0070716_100003540
697 Ga0070716_100080483
698 Ga0070712_100002390
699 Ga0070712_100012269
700 Ga0070712_100059128
701 Ga0070712_100552249
702 Ga0070712_100890687
703 Ga0097621_100002603
704 Ga0097621_100004265
705 Ga0097621_100159158
706 Ga0068871_100001192
707 Ga0068871_100007456
708 Ga0068871_100018971
709 Ga0068871_100185995
710 Ga0075433_10001098
711 Ga0075434_100000195
712 Ga0068865_100008484
713 Ga0068865_100186635
714 Ga0075436_100004841
715 Ga0075436_100042255
716 Ga0075436_100275532
717 Ga0075436_100561083
718 Ga0097620_100000290
719 Ga0075435_100000065
720 Ga0105250_10028996
721 Ga0105240_10017855
722 Ga0105240_10029292
723 Ga0105240_10065441
724 Ga0105240_10078716
725 Ga0105240_10504761
726 Ga0105240_10624398
727 Ga0105245_10002858
728 Ga0105245_10008495
729 Ga0105245_10054629
730 Ga0105245_10065607
731 Ga0105245_10324423
732 Ga0105245_10550211
733 Ga0105247_10006341
734 Ga0105241_10023905
735 Ga0105241_10044572
736 Ga0105241_10087172
737 Ga0105241_10117430
738 Ga0105241_10153074
739 Ga0105241_10165548
740 Ga0105241_10184527
741 Ga0105241_10227097
742 Ga0105241_10330440
743 Ga0105242_10009165
744 Ga0105242_10499047
745 Ga0105248_10021967
746 Ga0105248_10258562
747 Ga0105248_10382344
748 Ga0105237_10063189
749 Ga0105237_10183979
750 Ga0105237_10236827
751 Ga0105237_10403751
752 Ga0105237_10501110
753 Ga0105237_10681760
754 Ga0105238_10000417
755 Ga0105238_10014582
756 Ga0105238_10227665
757 Ga0105238_10317607
758 Ga0105238_10346525
759 Ga0105249_10024924
760 Ga0105249_10107413
761 Ga0099796_10063845
762 Ga0105239_10014364
763 Ga0105239_10114979
764 Ga0105239_10150419
765 Ga0105239_10221559
766 Ga0105239_10384835
767 Ga0105246_10007122
768 Ga0105246_10011181
769 Ga0105246_10087410
770 Ga0157373_10180002
771 Ga0157373_10244058
772 Ga0157373_10360623
773 Ga0157373_10548369
774 Ga0157371_10098202
775 Ga0157371_10528214
776 Ga0157370_10166681
777 Ga0157370_10516345
778 Ga0157369_10000258
779 Ga0157369_10499701
780 Ga0157374_10001052
781 Ga0157374_10001435
782 Ga0157374_10005580
783 Ga0157374_10012766
784 Ga0157374_10048161
785 Ga0157374_10109111
786 Ga0157378_10000541
787 Ga0157378_10002142
788 Ga0157378_10024706
789 Ga0157378_10206842
790 Ga0163162_10002555
791 Ga0163162_10004210
792 Ga0157372_10000335
793 Ga0157372_10001168
794 Ga0157372_10004868
795 Ga0157372_10010989
796 Ga0157372_10043120
797 Ga0157372_10144870
798 Ga0157372_10220384
799 Ga0157372_10781105
800 Ga0157372_10802984
801 Ga0157375_10078465
802 Ga0157375_10084316
803 Ga0157375_11569969
804 Ga0163163_10004099
805 Ga0163163_10027698
806 Ga0163163_10028700
807 Ga0163163_10030507
808 Ga0163163_10210862
809 Ga0157380_10027507
810 Ga0157377_10001555
811 Ga0157377_10120179
812 Ga0157379_10057448
813 Ga0157379_10062392
814 Ga0157376_10026684
815 Ga0163161_10008769
816 Ga0224570_101606
817 Ga0207697_10016188
818 Ga0207656_10014138
819 Ga0207656_10071485
820 Ga0207656_10195614
821 Ga0207692_10002000
822 Ga0207692_10325845
823 Ga0207642_10114315
824 Ga0207642_10148907
825 Ga0207710_10065474
826 Ga0207688_10007283
827 Ga0207680_10019827
828 Ga0207647_10002874
829 Ga0207647_10008899
830 Ga0207647_10032472
831 Ga0207685_10057151
832 Ga0207685_10061440
833 Ga0207685_10100452
834 Ga0207699_10041384
835 Ga0207645_10007489
836 Ga0207643_10000639
837 Ga0207684_10001907
838 Ga0207684_10232864
839 Ga0207654_10032167
840 Ga0207654_10098528
841 Ga0207654_10113626
842 Ga0207654_10123476
843 Ga0207707_10033457
844 Ga0207707_10034516
845 Ga0207707_10049869
846 Ga0207707_10150627
847 Ga0207707_10217226
848 Ga0207707_10222184
849 Ga0207695_10022649
850 Ga0207695_10206793
851 Ga0207695_10440806
852 Ga0207693_10000402
853 Ga0207693_10008118
854 Ga0207693_10051323
855 Ga0207693_10051802
856 Ga0207693_10159841
857 Ga0207663_10003860
858 Ga0207663_10004728
859 Ga0207663_10347560
860 Ga0207660_10019093
861 Ga0207657_10001261
862 Ga0207649_10001661
863 Ga0207649_10488438
864 Ga0207652_10168593
865 Ga0207646_10282658
866 Ga0207646_10483205
867 Ga0207694_10000284
868 Ga0207694_10053209
869 Ga0207694_10171950
870 Ga0207650_10000177
871 Ga0207650_10017093
872 Ga0207659_10361037
873 Ga0207687_10003150
874 Ga0207687_10064410
875 Ga0207687_10067507
876 Ga0207700_10006979
877 Ga0207700_10025629
878 Ga0207700_10028535
879 Ga0207700_10037677
880 Ga0207700_10202489
881 Ga0207700_10222605
882 Ga0207700_10259523
883 Ga0207700_10308062
884 Ga0207664_10096008
885 Ga0207664_10294738
886 Ga0207644_10149614
887 Ga0207644_10202574
888 Ga0207706_10000941
889 Ga0207706_10019421
890 Ga0207686_10019667
891 Ga0207686_10133952
892 Ga0207670_10060919
893 Ga0207704_10003491
894 Ga0207704_10019678
895 Ga0207665_10000358
896 Ga0207665_10037700
897 Ga0207665_10184325
898 Ga0207665_10282537
899 Ga0207691_10001447
900 Ga0207711_10183843
901 Ga0207689_10000542
902 Ga0207689_10002307
903 Ga0207661_10016213
904 Ga0207661_10065537
905 Ga0207661_10100415
906 Ga0207679_10000143
907 Ga0207679_10021292
908 Ga0207667_10000487
909 Ga0207667_10008691
910 Ga0207667_10024560
911 Ga0207667_10130156
912 Ga0207667_10151125
913 Ga0207667_10172327
914 Ga0207667_10566164
915 Ga0207667_10813166
916 Ga0207651_10030416
917 Ga0207651_10084353
918 Ga0207651_10551283
919 Ga0207712_10021844
920 Ga0207668_10013931
921 Ga0207640_10047553
922 Ga0207640_10078549
923 Ga0207658_10015504
924 Ga0207658_10632976
925 Ga0207677_10000998
926 Ga0207677_10002399
927 Ga0207677_10109793
928 Ga0207677_10314679
929 Ga0207677_10628603
930 Ga0207703_10006117
931 Ga0207703_10010977
932 Ga0207703_10017812
933 Ga0207703_10083353
934 Ga0207703_10176019
935 Ga0207639_10012639
936 Ga0207639_10518496
937 Ga0207678_10001668
938 Ga0207702_10000482
939 Ga0207702_10003272
940 Ga0207702_10028596
941 Ga0207702_10039405
942 Ga0207702_10077565
943 Ga0207702_10275050
944 Ga0207641_10003028
945 Ga0207641_10209389
946 Ga0207641_10307463
947 Ga0207648_10008810
948 Ga0207648_10019097
949 Ga0207648_10363612
950 Ga0207676_10001159
951 Ga0207676_10002377
952 Ga0207674_10000195
953 Ga0207674_10000229
954 Ga0207674_10009145
955 Ga0207674_10014217
956 Ga0207674_10034006
957 Ga0207675_100399215
958 Ga0207683_10003688
959 Ga0207698_10027346
960 Ga0207698_10062953
961 Ga0207698_10158217
962 Ga0207698_10271381
963 Ga0268265_10056860
964 Ga0268264_10080074
965 Ga0268264_10102638
966 Ga0268264_10192689
967 Ga0268264_10346169
968 Ga0265762_1000119
969 Ga0265762_1057041
970 Ga0265765_1003676
971 Ga0265760_10003665
972 Ga0265760_10004688
973 Ga0265760_10008406
974 Ga0265760_10010644
975 Ga0265328_10045711
976 Ga0265325_10026032
977 Ga0265340_10041679
978 Ga0265339_10164856
979 Ga0265314_10109198
980 Ga0316214_1012801
981 Ga0373926_0015941
982 Ga0373934_0147038
983 Ga0373923_0036252
984 Ga0373936_0004184
985 Ga0373945_0021506
986 Ga0373954_0301359
987 Ga0373956_0012621
988 Ga0373956_0043386
989 Ga0373956_0104490
990 Ga0373943_0000047
991 Ga0373943_0001571
992 Ga0373946_0037452
993 Ga0373955_0012079
994 Ga0373955_0128684
995 Ga0373955_0164239
996 Ga0373924_0020440
997 Ga0373924_0036100
998 Ga0373924_0132583
999 Ga0373931_0025417
1000 Ga0373935_0000841
1001 Ga0373935_0001112
1002 Ga0373935_0001333
1003 Ga0373935_0149794
1004 Ga0373935_0225206
1005 Ga0373927_0000447
1006 Ga0373927_0004796
1007 Ga0373927_0082982
1008 Ga0373927_0089947
1009 Ga0373927_0107307
1010 Ga0373933_0012118
1011 Ga0373933_0072959
1012 Ga0373947_0000112
1013 Ga0373947_0027135
1014 Ga0373947_0052737
1015 Ga0373947_0100168
1016 Ga0373937_0000204
1017 Ga0373937_0121435
1018 Ga0373937_0138477
1019 Ga0373937_0147343
1020 Ga0373937_0317780
1021 Ga0373925_0000770
1022 Ga0373925_0001810
1023 Ga0373925_0008172
1024 Ga0373925_0008202
1025 Ga0373925_0042863
1026 Ga0395901_0254013
1027 Ga0466963_0001070
1028 Ga0453684_0435579
1029 Ga0451576_0358914
1030 Ga0451576_0394431
1031 Ga0451576_0462429
1032 Ga0466958_0254892
1033 Ga0466967_0005563
1034 Ga0466967_0377625
1035 Ga0495603_0057720
1036 Ga0495603_0390896
1037 Ga0495651_0131872
1038 Ga0495580_0001544
1039 Ga0495580_0007898
1040 Ga0495580_0008448
1041 Ga0495580_0020794
1042 Ga0495580_0124153
1043 Ga0495580_0131868
1044 Ga0495582_0048059
1045 Ga0495582_0258575
1046 Ga0495639_0101969
1047 Ga0495664_0200912
1048 Ga0495628_0211608
1049 Ga0495652_0352663
1050 Ga0495665_0006637
1051 Ga0495665_0020860
1052 Ga0495667_0430715
1053 Ga0495635_0262559
1054 Ga0495599_0412917
1055 Ga0495623_0001371
1056 Ga0495658_0022720
1057 Ga0495669_0105202
1058 Ga0495581_0018527
1059 Ga0495581_0041757
1060 Ga0495604_0090018
1061 Ga0495674_0034545
1062 Ga0496100_0359218
1063 Ga0496101_0209200
1064 Ga0496102_0241091
1065 Ga0496102_0275079
1066 Ga0496102_0485209
1067 Ga0496104_0101247
1068 Ga0496104_0224142
1069 Ga0496105_0020434
1070 Ga0496107_0280146
1071 Ga0496108_0000689
1072 Ga0496108_0013237
1073 Ga0496109_0001300
1074 Ga0496109_0034301
1075 Ga0496110_0008161
1076 Ga0496110_0042861
1077 Ga0496110_0251347
1078 Ga0496111_0102159
1079 Ga0496111_0197289
1080 Ga0496112_0006571
1081 Ga0496112_0027881
1082 Ga0496112_0042724
1083 Ga0496112_0043787
1084 Ga0496112_0072910
1085 Ga0496112_0083914
1086 Ga0496112_0085247
1087 Ga0496113_0003019
1088 Ga0496113_0004283
1089 Ga0496115_0065577
1090 Ga0501031_0645590
1091 Ga0501040_0129757
1092 Ga0501042_0307744
1093 Ga0501071_0015344
1094 Ga0501075_0030607
1095 Ga0501076_0080135
1096 Ga0501079_0134427
1097 Ga0501080_0141223
1098 Ga0501081_0291844
1099 nmdc:mga0n895_133536_c1
1100 nmdc:mga0n895_1564_c1
1101 nmdc:mga0rr50_40678_c1
1102 nmdc:mga0rr50_6304_c1
1103 nmdc:mga0rr50_7316_c1
1104 nmdc:mga08x19_2888_c1
1105 nmdc:mga08x19_3182_c1
1106 nmdc:mga08x19_35485_c1
1107 nmdc:mga0a205_1800_c1
1108 Ga0495619_0129171
1109 Ga0501082_0029757
1110 Ga0530510_0021704

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01168

Ala_racemase_N

Alanine racemase, N-terminal domain

10

240

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
3r79-assembly3.cif.gz_B crystal structure of an uncharactertized protein from agrobacterium tumefaciens 0.9482 2 231
5nm8-assembly2.cif.gz_B structure of pipy, the cog0325 family member of synechococcus elongatus pcc7942, with plp bound 0.939 2 229
6kzw-assembly2.cif.gz_B crystal structure of yggs family pyridoxal phosphate-dependent enzyme pipy from fusobacterium nucleatum 0.9364 1 228
5nm8-assembly2.cif.gz_B structure of pipy, the cog0325 family member of synechococcus elongatus pcc7942, with plp bound 0.9347 2 229
7uat-assembly1.cif.gz_A the crystal structure of the k36a mutant of e. coli yggs in complex with plp 0.9345 2 230
ID Description Score Start End Superfamily
5nm8B00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Alanine racemase 0.939 2 229 3.20.20.10
5nm8B00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Alanine racemase 0.9347 2 229 3.20.20.10
1w8gA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Alanine racemase 0.9339 2 230 3.20.20.10
1w8gA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Alanine racemase 0.93 2 230 3.20.20.10
3r79B00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Alanine racemase 0.9227 2 231 3.20.20.10
ID Description Score Start End GO Terms
AF-A0A2V9ZR95-F1-model_v4 YggS family pyridoxal phosphate-dependent enzyme 0.9911 1 229 GO:0030170
AF-A0A2V9T6E7-F1-model_v4 YggS family pyridoxal phosphate-dependent enzyme 0.9883 42 231 GO:0030170
AF-A0A2V9ZR95-F1-model_v4 YggS family pyridoxal phosphate-dependent enzyme 0.9869 1 229 GO:0030170
AF-A0A2V9YRX8-F1-model_v4 Alanine racemase N-terminal domain-containing protein 0.9833 106 231 GO:0030170
AF-A0A7C5MDQ5-F1-model_v4 Pyridoxal phosphate homeostasis protein (PLP homeostasis protein) 0.9778 3 232 GO:0030170

Map