F463052

General Info

Members Datasets Scaffolds Average Seq Length
554 465 240 209

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2775507266|2778180015
Length 237
Sequence NNAAAGEIVVSMARAIIDNRAYLSEIDGKIGDGDHGINMAKGFGLVADRIRGKELSLAKALETLGTVLMTEIGGSMGPLYGVMFTEFAQQIDQVDQIDNKTFSRMLHAGLTGIQQIGSAKVGDKTLLDTLVPAVEAFDNATSEGKSFDEALELLVAAAESGRDSTVNLIARIGRASRLGERSLGVLDAGATSCALILKVLSEGTRNRLPDRLGDVSVLRTTDRRGDPLFSRLLRPFR

Samples

Sample ID Description Type Environment
1 2510065057 Sinorhizobium meliloti WSM1022 Isolate Nodule
2 2510461076 Rhizobium leguminosarum bv. trifolii TA1 Isolate Nodule
3 2510917022 Rhizobium sp. AP16 Isolate Rhizosphere
4 2510917030 Rhizobium sp. CF142 Isolate Rhizosphere
5 2511231052 Sinorhizobium meliloti AK58 Isolate Nodule
6 2512875026 Sinorhizobium medicae WSM1115 Isolate Nodule
7 2513237086 Sinorhizobium meliloti MVII-I Isolate Nodule
8 2513237089 Sinorhizobium medicae DI28 Isolate Nodule
9 2513237091 Sinorhizobium meliloti RRI128 Isolate Nodule
10 2513237093 Rhizobium leguminosarum bv. phaseoli FA23 Isolate Nodule
11 2513237140 Sinorhizobium meliloti GVPV12 Isolate Nodule
12 2513237143 Sinorhizobium meliloti Mlalz-1 Isolate Nodule
13 2513237144 Rhizobium sullae WSM1592 Isolate Nodule
14 2513237156 Sinorhizobium medicae WSM1369 Isolate Nodule
15 2513237159 Rhizobium giardinii bv. giardinii H152 Isolate Nodule
16 2513237160 Sinorhizobium medicae WSM244 Isolate Nodule
17 2513237162 Rhizobium ruizarguesonis GB30 Isolate Nodule
18 2515154107 Sinorhizobium meliloti 4H41 Isolate Nodule
19 2515154113 Rhizobium ruizarguesonis Vc2 Isolate Nodule
20 2515154114 Rhizobium ruizarguesonis Vh3 Isolate Nodule
21 2515154116 Rhizobium ruizarguesonis Ps8 Isolate Nodule
22 2516653046 Sinorhizobium meliloti BO21CC Isolate Nodule
23 2517093000 Rhizobium leguminosarum bv. trifolii SRDI943 Isolate Nodule
24 2517487022 Sinorhizobium medicae WSM4191 Isolate Nodule
25 2524023207 Ensifer sp. USDA 6670 Isolate Nodule
26 2524023209 Rhizobium leucaenae USDA 9039 Isolate Nodule
27 2534681786 Brucella suis 92/29 Isolate Unclassified
28 2537561587 Agrobacterium tumefaciens Cherry 2E-2-2 Isolate Rhizosphere
29 2551306084 Sinorhizobium meliloti 5A14 Isolate Nodule
30 2551306085 Sinorhizobium meliloti AE608H Isolate Nodule
31 2582581283 Rhizobium sp. OK665 Isolate Rhizosphere
32 2582581298 Rhizobium alamii YR540 Isolate Rhizosphere
33 2582581306 Rhizobium sp. YR295 Isolate Rhizosphere
34 2582581307 Rhizobium sp. YR060 Isolate Rhizosphere
35 2582581308 Rhizobium sp. OK494 Isolate Rhizosphere
36 2582581315 Agrobacterium rhizogenes YR147 Isolate Rhizosphere
37 2582581316 Agrobacterium rhizogenes OK036 Isolate Rhizosphere
38 2582581865 Rhizobium sp. CF258 Isolate Rhizosphere
39 2585427527 Rhizobium lusitanum YR374 Isolate Rhizosphere
40 2585427529 Rhizobium alamii YR584 Isolate Rhizosphere
41 2585427530 Rhizobium tropici YR635 Isolate Rhizosphere
42 2585427531 Agrobacterium rhizogenes YR530 Isolate Rhizosphere
43 2585427594 Rhizobium sp. YR528 Isolate Rhizosphere
44 2585427608 Agrobacterium rhizogenes OV677 Isolate Rhizosphere
45 2585427609 Agrobacterium rhizogenes CF263 Isolate Rhizosphere
46 2585428125 Agrobacterium rhizogenes CF262 Isolate Rhizosphere
47 2599185236 Rhizobium sp. NFR07 Isolate Rhizoplane
48 2599185352 Sinorhizobium sp. NFACC03 Isolate Rhizoplane
49 2615840626 Rhizobium lusitanum P1-7 Isolate Nodule
50 2615840698 Rhizobium multihospitium HAMBI 2975 Isolate Nodule
51 2617270742 Rhizobium miluonense HAMBI 2971 Isolate Nodule
52 2643221610 Ensifer sp. Root74 Isolate Unclassified
53 2643221618 Ensifer sp. Root231 Isolate Unclassified
54 2643221626 Ensifer sp. Root31 Isolate Unclassified
55 2643221655 Ensifer sp. Root1252 Isolate Unclassified
56 2643221659 Ensifer sp. Root127 Isolate Unclassified
57 2643221675 Ensifer sp. Root1298 Isolate Unclassified
58 2643221680 Ensifer sp. Root1312 Isolate Unclassified
59 2643221689 Rhizobium sp. Root483D2 Isolate Unclassified
60 2643221698 Ensifer sp. Root142 Isolate Unclassified
61 2643221712 Ensifer sp. Root258 Isolate Unclassified
62 2643221726 Ensifer sp. Root954 Isolate Unclassified
63 2667528174 Rhizobium sp. NFR17 Isolate Rhizoplane
64 2718218233 Rhizobium phaseoli sv. phaseoli R744 Isolate Nodule
65 2738541293 Rhizobium sp. GV031 Isolate Unclassified
66 2751185800 Brucella pituitosa AA2 Isolate Unclassified
67 2758568016 [Ochrobactrum] quorumnocens A44 Isolate Rhizosphere
68 2765235942 Rhizobium sp. WYCCWR10014 Isolate Nodule
69 2775507266 Rhizobium tropici PRF 81 Isolate Nodule
70 2791355091 Sinorhizobium sp. FG01 Isolate Nodule
71 2791355092 Sinorhizobium sp. NG07B Isolate Nodule
72 2791355253 Rhizobium rhizosphaerae RD15 Isolate Rhizosphere
73 2791355256 Rhizobium sp. M10 Isolate Nodule
74 2791355266 Rhizobium sp. L43 Isolate Nodule
75 2802428858 Sinorhizobium medicae M14-1 Isolate Nodule
76 2802428859 Sinorhizobium medicae SF3.41 Isolate Nodule
77 2802428860 Sinorhizobium medicae M19-1 Isolate Nodule
78 2802428861 Sinorhizobium medicae USDA1037 Isolate Nodule
79 2802428862 Sinorhizobium medicae M7-4 Isolate Nodule
80 2802428863 Sinorhizobium medicae M26-2 Isolate Nodule
81 2802429606 Rhizobium sophoriradicis JJW1 Isolate Nodule
82 2818991448 Rhizobium miluonense 1234 Isolate Unclassified
83 2818991453 Rhizobium lusitanum 1158 Isolate Unclassified
84 2838029111 Rhizobium tropici SEMIA 4079 Isolate Nodule
85 2841734538 Mesorhizobium sp. M6A.T.Cr.TU.016.01.1.1 Isolate Nodule
86 2841851746 Rhizobium leguminosarum SEMIA 498 Isolate Nodule
87 2841864319 Rhizobium leguminosarum SEMIA 4052 Isolate Nodule
88 2842110456 Rhizobium esperanzae SEMIA 414 Isolate Nodule
89 2842217011 Rhizobium leguminosarum SEMIA 475 Isolate Nodule
90 2842402390 Rhizobium lentis SEMIA 4033 Isolate Nodule
91 2842409023 Rhizobium lentis SEMIA 4034 Isolate Nodule
92 2842415677 Rhizobium lentis SEMIA 4036 Isolate Nodule
93 2842475841 Rhizobium tropici SEMIA 4059 Isolate Nodule
94 2842482326 Rhizobium lusitanum SEMIA 4060 Isolate Nodule
95 2842502639 Rhizobium tropici SEMIA 4063 Isolate Nodule
96 2842521101 Rhizobium giardinii SEMIA 4084 Isolate Nodule
97 2844163670 Ensifer sp. 1H6 Isolate Unclassified
98 2850079185 Ensifer aridi JNVU TP6 Isolate Unclassified
99 2852387548 Rhizobium jaguaris CCGE525 Isolate Unclassified
100 2855825444 Sinorhizobium meliloti CXM1-105 Isolate Nodule
101 2855839649 Sinorhizobium meliloti AK555 Isolate Unclassified
102 2855872281 Sinorhizobium fredii PCH1 Isolate Nodule
103 2857516855 Rhizobium sp. R-72456 Isolate Unclassified
104 2858800743 Sinorhizobium meliloti AK170 Isolate Unclassified
105 2871435913 Mesorhizobium sp. M7A.F.Ca.MR.228.00.0.0 Isolate Nodule
106 2871474448 Mesorhizobium sp. M6A.T.Cr.TU.017.01.1.1 Isolate Nodule
107 2874168670 Mesorhizobium kowhaii Ach-343 Isolate Nodule
108 2878788777 Mesorhizobium sp. M6A.T.Ca.TU.002.02.2.1 Isolate Nodule
109 2891373044 Shinella sp. AETb1-6 Isolate Rhizosphere
110 2899792073 Agrobacterium deltaense CNPSo 3391 Isolate Nodule
111 2909042592 Labrys sp. LIt4 Isolate Nodule
112 2915980308 Sinorhizobium medicae USDA1149 Isolate Nodule
113 2915986958 Sinorhizobium meliloti USDA1659 Isolate Nodule
114 2915993759 Sinorhizobium meliloti USDA1336 Isolate Nodule
115 2916000859 Sinorhizobium meliloti USDA1562 Isolate Nodule
116 2916007675 Sinorhizobium meliloti USDA1289 Isolate Nodule
117 2916014648 Sinorhizobium meliloti USDA1583 Isolate Nodule
118 2916021584 Sinorhizobium meliloti USDA1550 Isolate Nodule
119 2916028427 Sinorhizobium meliloti USDA1613 Isolate Nodule
120 2916035215 Sinorhizobium meliloti 3011 Isolate Nodule
121 2916041962 Sinorhizobium meliloti USDA1795 Isolate Nodule
122 2916048683 Sinorhizobium meliloti USDA1796 Isolate Nodule
123 2916055098 Sinorhizobium meliloti USDA1770 Isolate Nodule
124 2916061851 Sinorhizobium medicae USDA1638 Isolate Nodule
125 2916068649 Sinorhizobium meliloti USDA1220 Isolate Nodule
126 2916076590 Sinorhizobium meliloti USDA1661 Isolate Nodule
127 2921201388 Sinorhizobium meliloti USDA1692 Isolate Nodule
128 2921208531 Sinorhizobium meliloti USDA1660 Isolate Nodule
129 2921237296 Sinorhizobium meliloti USDA1508 Isolate Nodule
130 2921244191 Sinorhizobium meliloti 2119 Isolate Nodule
131 2921250672 Sinorhizobium medicae USDA1169 Isolate Nodule
132 2921257292 Sinorhizobium meliloti USDA1320 Isolate Nodule
133 2921263974 Sinorhizobium meliloti USDA1107 Isolate Nodule
134 2921282425 Sinorhizobium meliloti USDA1203 Isolate Nodule
135 2921289301 Sinorhizobium meliloti USDA1730 Isolate Nodule
136 2921296804 Sinorhizobium meliloti USDA1200 Isolate Nodule
137 2924144063 Sinorhizobium meliloti USDA1022 Isolate Nodule
138 2924150972 Sinorhizobium meliloti USDA1700 Isolate Nodule
139 2924158325 Sinorhizobium meliloti USDA1146 Isolate Nodule
140 2924165586 Sinorhizobium meliloti USDA1264 Isolate Nodule
141 2924172951 Sinorhizobium meliloti USDA1626 Isolate Nodule
142 2924179722 Sinorhizobium meliloti USDA1280 Isolate Nodule
143 2924186466 Sinorhizobium meliloti USDA1389 Isolate Nodule
144 2924193448 Sinorhizobium meliloti USDA1158 Isolate Nodule
145 2924200457 Sinorhizobium meliloti USDA1007 Isolate Nodule
146 2924207177 Sinorhizobium meliloti USDA1589 Isolate Nodule
147 2924214083 Sinorhizobium meliloti USDA1702 Isolate Nodule
148 2924221636 Sinorhizobium meliloti USDA1416 Isolate Nodule
149 2924228884 Sinorhizobium meliloti USDA1581 Isolate Nodule
150 2924710171 Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.2 Isolate Nodule
151 2933586486 Rhizobium leguminosarum SEMIA 4039 Isolate Nodule
152 2936367885 Rhizobium changzhiense WYCCWR 11290 Isolate Nodule
153 2936996657 Sinorhizobium meliloti USDA1025 Isolate Nodule
154 2937002841 Sinorhizobium meliloti USDA1006 Isolate Nodule
155 2937009748 Sinorhizobium meliloti USDA1162 Isolate Nodule
156 2937016420 Sinorhizobium meliloti USDA1027 Isolate Nodule
157 2937023124 Sinorhizobium meliloti USDA1335 Isolate Nodule
158 2937029754 Sinorhizobium medicae USDA1624 Isolate Nodule
159 2937036028 Sinorhizobium medicae USDA1608 Isolate Nodule
160 2937042894 Sinorhizobium meliloti USDA1687 Isolate Nodule
161 2937049772 Sinorhizobium meliloti USDA1691 Isolate Nodule
162 2937056579 Sinorhizobium meliloti USDA1357 Isolate Nodule
163 2937063883 Sinorhizobium meliloti USDA1808 Isolate Nodule
164 2937071275 Sinorhizobium meliloti USDA1623 Isolate Nodule
165 2937078374 Sinorhizobium medicae USDA1004 Isolate Nodule
166 2937084907 Sinorhizobium medicae USDA1664 Isolate Nodule
167 2937091812 Sinorhizobium meliloti USDA1221 Isolate Nodule
168 2937098957 Sinorhizobium meliloti USDA1519 Isolate Nodule
169 2937106411 Sinorhizobium meliloti USDA1214 Isolate Nodule
170 2937113482 Sinorhizobium meliloti USDA1180 Isolate Nodule
171 2937119839 Sinorhizobium meliloti USDA1790 Isolate Nodule
172 2937126314 Sinorhizobium meliloti USDA1612 Isolate Nodule
173 2937836603 Mesorhizobium sp. M6A.T.Cr.TU.014.01.1.1 Isolate Nodule
174 2941499720 Ensifer sp. 4252 Isolate Rhizosphere
175 2957375807 Sinorhizobium medicae USDA1632 Isolate Nodule
176 2957382221 Sinorhizobium meliloti USDA1919 Isolate Nodule
177 2957388812 Sinorhizobium meliloti USDA1195 Isolate Nodule
178 2957395598 Sinorhizobium meliloti USDA1237 Isolate Nodule
179 2957402308 Sinorhizobium meliloti USDA1794 Isolate Nodule
180 2957408893 Sinorhizobium meliloti USDA1163 Isolate Nodule
181 2957415311 Sinorhizobium meliloti USDA1724 Isolate Nodule
182 2957422303 Sinorhizobium meliloti USDA1497 Isolate Nodule
183 2957430029 Sinorhizobium meliloti USDA1590 Isolate Nodule
184 2957437181 Sinorhizobium medicae USDA1694 Isolate Nodule
185 2957443900 Sinorhizobium meliloti USDA1734 Isolate Nodule
186 2957450854 Sinorhizobium meliloti USDA1655 Isolate Nodule
187 2957457609 Sinorhizobium meliloti USDA1751 Isolate Nodule
188 2957464669 Sinorhizobium meliloti USDA1520 Isolate Nodule
189 2957471148 Sinorhizobium meliloti USDA1204 Isolate Nodule
190 2957478035 Sinorhizobium meliloti USDA1171 Isolate Nodule
191 2957484790 Sinorhizobium meliloti USDA1464 Isolate Nodule
192 2957491536 Sinorhizobium meliloti USDA1804 Isolate Nodule
193 2957498199 Sinorhizobium meliloti USDA1561 Isolate Nodule
194 2957505466 Sinorhizobium meliloti USDA1696 Isolate Nodule
195 2958071322 Mesorhizobium sp. M6A.T.Ce.TU.016.01.1.1 Isolate Nodule
196 2960584000 Sinorhizobium meliloti USDA1530 Isolate Nodule
197 2960591022 Sinorhizobium medicae USDA1066 Isolate Nodule
198 2960597568 Sinorhizobium meliloti 3085 Isolate Nodule
199 2960603979 Sinorhizobium meliloti USDA1580 Isolate Nodule
200 2960610863 Sinorhizobium meliloti USDA1792 Isolate Nodule
201 2960617483 Sinorhizobium meliloti USDA1719 Isolate Nodule
202 2960624210 Sinorhizobium meliloti USDA1415 Isolate Nodule
203 2960631154 Sinorhizobium medicae USDA1629 Isolate Nodule
204 2960637947 Sinorhizobium meliloti USDA1202 Isolate Nodule
205 2960645483 Sinorhizobium meliloti USDA1703 Isolate Nodule
206 2960652885 Sinorhizobium meliloti USDA1199 Isolate Nodule
207 2960660292 Sinorhizobium meliloti USDA1883 Isolate Nodule
208 2960667422 Sinorhizobium meliloti USDA1170 Isolate Nodule
209 2960674078 Sinorhizobium meliloti USDA1666 Isolate Nodule
210 2960680706 Sinorhizobium medicae USDA1150 Isolate Nodule
211 2960687367 Sinorhizobium meliloti USDA1462 Isolate Nodule
212 2960693952 Sinorhizobium medicae USDA1630 Isolate Nodule
213 2964607997 Sinorhizobium meliloti USDA1212 Isolate Nodule
214 2964615318 Sinorhizobium meliloti USDA1248 Isolate Nodule
215 2964621998 Sinorhizobium meliloti USDA1235 Isolate Nodule
216 2964628898 Sinorhizobium meliloti USDA1191 Isolate Nodule
217 2964636051 Sinorhizobium meliloti USDA1594 Isolate Nodule
218 2964643177 Sinorhizobium meliloti USDA1760 Isolate Nodule
219 2964649959 Sinorhizobium meliloti USDA1591 Isolate Nodule
220 2964656573 Sinorhizobium meliloti USDA1308 Isolate Nodule
221 2964663802 Sinorhizobium meliloti USDA1688 Isolate Nodule
222 2964670856 Sinorhizobium meliloti USDA1211 Isolate Nodule
223 2964678106 Sinorhizobium meliloti USDA1210 Isolate Nodule
224 2964685014 Sinorhizobium meliloti USDA1232 Isolate Nodule
225 2964691889 Sinorhizobium meliloti USDA1379 Isolate Nodule
226 2964698721 Sinorhizobium meliloti USDA1656 Isolate Nodule
227 2964705432 Sinorhizobium meliloti USDA1614 Isolate Nodule
228 2964712639 Sinorhizobium meliloti USDA1616 Isolate Nodule
229 2964719344 Sinorhizobium meliloti USDA1456 Isolate Nodule
230 2967664464 Sinorhizobium meliloti USDA1208 Isolate Nodule
231 2967671571 Sinorhizobium meliloti USDA1496 Isolate Nodule
232 2967678726 Sinorhizobium meliloti USDA1467 Isolate Nodule
233 2967686174 Sinorhizobium medicae USDA1641 Isolate Nodule
234 2967693043 Sinorhizobium meliloti USDA1183 Isolate Nodule
235 2967699805 Sinorhizobium meliloti USDA1695 Isolate Nodule
236 2967706974 Sinorhizobium meliloti USDA1206 Isolate Nodule
237 2967714385 Sinorhizobium meliloti USDA1023 Isolate Nodule
238 2967721400 Sinorhizobium meliloti USDA1742 Isolate Nodule
239 2967728569 Sinorhizobium medicae USDA1607 Isolate Nodule
240 2967735183 Sinorhizobium meliloti USDA1710 Isolate Nodule
241 2967742019 Sinorhizobium meliloti USDA1676 Isolate Nodule
242 2967748971 Sinorhizobium meliloti USDA1024A Isolate Nodule
243 2967755722 Sinorhizobium meliloti USDA1302 Isolate Nodule
244 2967762386 Sinorhizobium meliloti USDA1397 Isolate Nodule
245 2967769361 Sinorhizobium meliloti USDA1005 Isolate Nodule
246 2967775926 Sinorhizobium meliloti USDA1678 Isolate Nodule
247 2970019648 Sinorhizobium meliloti USDA1603 Isolate Nodule
248 2970026789 Sinorhizobium medicae USDA1611 Isolate Nodule
249 2970033650 Sinorhizobium meliloti USDA1565 Isolate Nodule
250 2970040964 Sinorhizobium meliloti USDA1501 Isolate Nodule
251 2970054988 Sinorhizobium meliloti USDA1031 Isolate Nodule
252 2970061556 Sinorhizobium meliloti USDA1810 Isolate Nodule
253 2970068827 Sinorhizobium meliloti USDA1227 Isolate Nodule
254 2970076120 Sinorhizobium meliloti USDA1706 Isolate Nodule
255 2970082768 Sinorhizobium meliloti USDA1803 Isolate Nodule
256 2970088815 Sinorhizobium meliloti USDA1819 Isolate Nodule
257 2970095765 Sinorhizobium meliloti USDA1225 Isolate Nodule
258 2970102677 Sinorhizobium meliloti USDA1325 Isolate Nodule
259 2970109326 Sinorhizobium meliloti USDA1186 Isolate Nodule
260 2970116247 Sinorhizobium meliloti USDA1566 Isolate Nodule
261 2970122695 Sinorhizobium medicae 3082 Isolate Nodule
262 2970129317 Sinorhizobium meliloti USDA1008 Isolate Nodule
263 2970136068 Sinorhizobium meliloti USDA1699 Isolate Nodule
264 2970143518 Sinorhizobium medicae USDA1652 Isolate Nodule
265 2970149975 Sinorhizobium meliloti USDA1215 Isolate Nodule
266 2970156795 Sinorhizobium meliloti USDA1491 Isolate Nodule
267 2970164137 Sinorhizobium meliloti USDA1018 Isolate Nodule
268 2970170962 Sinorhizobium meliloti USDA1571 Isolate Nodule
269 2970177841 Sinorhizobium meliloti USDA1533 Isolate Nodule
270 2970184632 Sinorhizobium meliloti USDA1593 Isolate Nodule
271 2970191845 Sinorhizobium meliloti USDA1187 Isolate Nodule
272 2970510686 Mesorhizobium sp. M7A.F.Ca.MR.148.00.0.0 Isolate Nodule
273 2977516862 Sinorhizobium meliloti USDA1791 Isolate Nodule
274 2977523885 Sinorhizobium meliloti USDA1777 Isolate Nodule
275 2977530762 Sinorhizobium medicae USDA1606 Isolate Nodule
276 2977537788 Sinorhizobium meliloti USDA1184 Isolate Nodule
277 2977544691 Sinorhizobium medicae USDA1631 Isolate Nodule
278 2977551784 Sinorhizobium meliloti USDA1035 Isolate Nodule
279 2977558990 Sinorhizobium meliloti USDA1222 Isolate Nodule
280 2977565890 Sinorhizobium meliloti USDA1617 Isolate Nodule
281 2977572785 Sinorhizobium meliloti USDA1767 Isolate Nodule
282 2977579622 Sinorhizobium meliloti USDA1161 Isolate Nodule
283 2977898635 Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.1 Isolate Nodule
284 2989349275 Shinella kummerowiae CCBAU 25048 Isolate Unclassified
285 2989771324 Rhizobium rhizolycopersici DBTS2 Isolate Rhizosphere
286 2996386984 Mesorhizobium sp. M7A.F.Ca.MR.245.00.0.0 Isolate Nodule
287 2996887358 Rhizobium sp. R711 Isolate Nodule
288 3003930520 Sinorhizobium sp. BG8 Isolate Unclassified
289 3005409236 Rhizobium sp. P32RR-XVIII Isolate Rhizosphere
290 3005416602 Rhizobium sp. P40RR-XXII Isolate Rhizosphere
291 3005445848 Rhizobium sp. WYJ-E13 Isolate Unclassified
292 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
293 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
294 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
295 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
296 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
297 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
298 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
299 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
300 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
301 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
302 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
303 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
304 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
305 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
306 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
307 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
308 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
309 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
310 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
311 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
312 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
313 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
314 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
315 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
316 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
317 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
318 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
319 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
320 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
321 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
322 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
323 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
324 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
325 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
326 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
327 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
328 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
329 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
330 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
331 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
332 3300022739 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - brown nodules Metagenome Nodule
333 3300022740 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - pink nodules Metagenome Nodule
334 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
335 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
336 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
337 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
338 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
339 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
340 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
341 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
342 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
343 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
344 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
345 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
346 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
347 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
348 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
349 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
350 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
351 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
352 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
353 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
354 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
355 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
356 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
357 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
358 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
359 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
360 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
361 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
362 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
363 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
364 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
365 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
366 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
367 3300031967 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - elongated nodules Metagenome Nodule
368 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
369 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
370 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
371 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
372 3300033430 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - small nodules Metagenome Nodule
373 3300033464 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - branched nodules Metagenome Nodule
374 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
375 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
376 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
377 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
378 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
379 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
380 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
381 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
382 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
383 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
384 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
385 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
386 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
387 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
388 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
389 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
390 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
391 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
392 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
393 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
394 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
395 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
396 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
397 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
398 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
399 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
400 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
401 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
402 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
403 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
404 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
405 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
406 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
407 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
408 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
409 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
410 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
411 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
412 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
413 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
414 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
415 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
416 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
417 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
418 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
419 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
420 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
421 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
422 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
423 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
424 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
425 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
426 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
427 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
428 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
429 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
430 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
431 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
432 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
433 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
434 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
435 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
436 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
437 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
438 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
439 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
440 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
441 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
442 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
443 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
444 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
445 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
446 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
447 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
448 648276728 Sinorhizobium meliloti BL225C Isolate Nodule
449 8003992118 Sinorhizobium meliloti RRI128 Isolate Nodule
450 8003999396 Sinorhizobium medicae WSM1115 Isolate Nodule
451 8004633249 Mesorhizobium sp. M6A.T.Ce.TU.002.03.1.1 Isolate Nodule
452 8005301065 Rhizobium bangladeshense 1017 Isolate Nodule
453 8005314921 Rhizobium sp. P28RR-XV Isolate Rhizosphere
454 8005321885 Rhizobium sp. R72 Isolate Nodule
455 8005382845 Rhizobium sp. R634 Isolate Nodule
456 8005395548 Rhizobium sp. R339 Isolate Nodule
457 8005484373 Rhizobium tropici SARCC-755 Isolate Nodule
458 8005556819 Rhizobium sp. WYCCWR 11128 Isolate Nodule
459 8005563573 Rhizobium sp. WYCCWR 11152 Isolate Nodule
460 8005645114 Rhizobium tropici IGFRI Rhizo-19 Isolate Rhizosphere
461 8005682033 Rhizobium dioscoreae S-93 Isolate Unclassified
462 8018163183 Rhizobium sp. WYCCWR 11146 Isolate Nodule
463 8024486573 Rhizobium tubonense CCBAU 85046 Isolate Nodule
464 8045864390 Aurantimonas endophytica KCTC 52296 Isolate Unclassified
465 8057575449 Rhizobium mayense CCGE526 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 43.14
Metatranscriptomes 0.18
Isolates 56.68

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 11.01
Nodule 48.01
Rhizoplane 1.62
Rhizosphere 20.4
Stem 0
Stem Tuber 0
Unclassified 18.95

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10023092 3300001979 Bacteria 2130
2 JGI25155J39150_1000151 3300002704 Bacteria 31070
3 JGI25156J39149_1000331 3300002705 Bacteria 31070
4 JGI25154J39366_1000280 3300002738 Bacteria 31070
5 JGI25157J39369_1000365 3300002741 Bacteria 31070
6 JGI25152J39213_1000009 3300002773 Bacteria 138285
7 JGI25152J39213_1002635 3300002773 Bacteria 6665
8 JGI25150J39212_1000016 3300002774 Bacteria 153945
9 JGI25159J45721_1000301 3300002987 Bacteria 23207
10 JGI25159J45721_1010933 3300002987 Bacteria 2264
11 JGI25151J46595_10000073 3300003187 Bacteria 136684
12 JGI25151J46595_10009093 3300003187 Bacteria 4733
13 JGI25153J46596_10001135 3300003215 Bacteria 16110
14 JGI25153J46596_10005173 3300003215 Bacteria 6868
15 rootH1_10088617 3300003316 Bacteria 3653
16 rootH2_10025300 3300003320 Bacteria 7978
17 rootH2_10162403 3300003320 Bacteria 1407
18 rootL2_10002654 3300003322 Bacteria 33800
19 rootH1_10060016 3300003323 Bacteria 3479
20 rootH1_10060037 3300003323 Bacteria 3250
21 rootH1_10201955 3300003323 Bacteria 1578
22 rootH1_10281779 3300003323 Bacteria 2413
23 JGI25160J50197_1004699 3300003354 Bacteria 5847
24 JGI25161J50226_1000093 3300003374 Bacteria 72639
25 Ga0006562J51391_1023753 3300003578 Bacteria 3160
26 Ga0055524_1004232 3300003775 Bacteria 6678
27 Ga0055528_1003660 3300003790 Bacteria 7626
28 Ga0058692_1035824 3300003856 Bacteria 901
29 Ga0055543_1001914 3300004625 Bacteria 7466
30 Ga0065165_1004958 3300005262 Bacteria 7830
31 Ga0065165_1005507 3300005262 Bacteria 7079
32 Ga0065165_1005670 3300005262 Bacteria 6885
33 Ga0070669_100170340 3300005353 Bacteria 1697
34 Ga0070709_10293120 3300005434 Bacteria 1186
35 Ga0070713_100082818 3300005436 Bacteria 2741
36 Ga0070710_10050681 3300005437 Bacteria 2328
37 Ga0070706_100050230 3300005467 Unclassified 3848
38 Ga0070665_101290034 3300005548 Bacteria 740
39 Ga0070717_10479386 3300006028 Bacteria 1123
40 Ga0075363_100006680 3300006048 Bacteria 5262
41 Ga0075363_100377291 3300006048 Bacteria 831
42 Ga0075362_10003823 3300006177 Bacteria 5339
43 Ga0075366_10010958 3300006195 Bacteria 5103
44 Ga0075366_10020889 3300006195 Bacteria 3803
45 Ga0075370_10014388 3300006353 Bacteria 4220
46 Ga0075370_10034364 3300006353 Bacteria 2842
47 Ga0075370_10037117 3300006353 Bacteria 2739
48 Ga0105244_10284197 3300009036 Bacteria 767
49 Ga0105243_10311539 3300009148 Bacteria 1430
50 Ga0105239_10731167 3300010375 Bacteria 1132
51 Ga0213872_10003545 3300021361 Bacteria 8607
52 Ga0213872_10071954 3300021361 Unclassified 1558
53 Ga0213876_10001432 3300021384 Bacteria 14863
54 Ga0213876_10002018 3300021384 Bacteria 12133
55 Ga0213875_10027100 3300021388 Bacteria 2726
56 Ga0213871_10042599 3300021441 Bacteria 1223
57 Ga0228711_1000005 3300022739 Bacteria 215594
58 Ga0228710_1000018 3300022740 Bacteria 118600
59 Ga0228710_1023199 3300022740 Bacteria 4589
60 Ga0209435_100114 3300025206 Bacteria 31122
61 Ga0209436_100007 3300025208 Bacteria 149841
62 Ga0207425_1000054 3300025245 Bacteria 153997
63 Ga0207425_1018936 3300025245 Bacteria 1489
64 Ga0209646_1000362 3300025246 Bacteria 31122
65 Ga0209026_1000469 3300025250 Bacteria 31122
66 Ga0209148_1006670 3300025254 Bacteria 2478
67 Ga0209759_1000676 3300025256 Bacteria 31122
68 Ga0209129_1000108 3300025258 Bacteria 153997
69 Ga0209129_1005138 3300025258 Bacteria 4778
70 Ga0209673_1005563 3300025273 Bacteria 6304
71 Ga0209673_1068441 3300025273 Bacteria 855
72 Ga0209130_1000001 3300025284 Bacteria 831557
73 Ga0209025_1000044 3300025294 Bacteria 349480
74 Ga0209025_1000189 3300025294 Bacteria 153997
75 Ga0209564_1001493 3300025295 Bacteria 23554
76 Ga0209758_1000162 3300025297 Bacteria 153997
77 Ga0209758_1025708 3300025297 Bacteria 2572
78 Ga0209256_1008767 3300025299 Bacteria 4604
79 Ga0207426_1000045 3300025302 Bacteria 422847
80 Ga0209257_1025204 3300025304 Bacteria 2037
81 Ga0207699_10015994 3300025906 Bacteria 3913
82 Ga0207693_10705591 3300025915 Unclassified 781
83 Ga0207681_10236474 3300025923 Bacteria 1420
84 Ga0207700_10013124 3300025928 Bacteria 5376
85 Ga0207709_10869939 3300025935 Bacteria 731
86 Ga0209281_1000111 3300027111 Bacteria 215615
87 Ga0209281_1000185 3300027111 Bacteria 144489
88 Ga0209281_1003971 3300027111 Bacteria 4589
89 Ga0209371_1001822 3300027312 Bacteria 13262
90 Ga0209371_1004371 3300027312 Bacteria 6203
91 Ga0209282_1000012 3300027666 Bacteria 215614
92 Ga0268256_1001607 3300030500 Bacteria 13114
93 Ga0268256_1014966 3300030500 Bacteria 2281
94 Ga0316575_10000834 3300031665 Bacteria 9397
95 Ga0316579_10047704 3300031691 Bacteria 2000
96 Ga0265342_10250127 3300031712 Bacteria 946
97 Ga0316576_10004953 3300031727 Bacteria 8064
98 Ga0316578_10006191 3300031728 Bacteria 5881
99 Ga0307405_10268022 3300031731 Bacteria 1279
100 Ga0316577_10070264 3300031733 Bacteria 1955
101 Ga0307406_10055370 3300031901 Bacteria 2535
102 Ga0315914_1000007 3300031967 Bacteria 215597
103 Ga0307409_100219044 3300031995 Bacteria 1717
104 Ga0316583_10010680 3300032133 Bacteria 3310
105 Ga0316585_10010253 3300032137 Bacteria 2747
106 Ga0316580_10013686 3300032139 Bacteria 2472
107 Ga0315913_1000003 3300033430 Bacteria 215608
108 Ga0315915_1000011 3300033464 Bacteria 215597
109 Ga0316574_0002049 3300035398 Bacteria 9952
110 Ga0316582_0001473 3300036647 Bacteria 10369
111 Ga0316584_0046731 3300036712 Bacteria 3233
112 Ga0436365_0117548 3300039437 Bacteria 62327
113 Ga0436365_0591003 3300039437 Bacteria 3367
114 Ga0436365_0703374 3300039437 Bacteria 795
115 Ga0436365_1722082 3300039437 Bacteria 7038
116 Ga0436365_1889837 3300039437 Bacteria 134049
117 Ga0436360_0075261 3300039438 Bacteria 1581
118 Ga0436360_0386694 3300039438 Bacteria 1971
119 Ga0436360_0605812 3300039438 Bacteria 1318
120 Ga0436360_1297966 3300039438 Bacteria 3513
121 Ga0436361_0717001 3300039447 Bacteria 3883
122 Ga0436361_1069080 3300039447 Bacteria 6776
123 Ga0436361_1162858 3300039447 Bacteria 4497
124 Ga0436361_1213534 3300039447 Bacteria 14633
125 Ga0436363_0087163 3300039450 Bacteria 10472
126 Ga0436362_0502256 3300039453 Bacteria 1341
127 Ga0436362_0544059 3300039453 Bacteria 2079
128 Ga0436362_1182783 3300039453 Bacteria 2041
129 Ga0439436_0003895 3300041404 Bacteria 4574
130 Ga0439438_017034 3300041405 Bacteria 2101
131 Ga0439465_0000971 3300041413 Bacteria 9127
132 Ga0439465_0091272 3300041413 Bacteria 1042
133 Ga0451833_0631780 3300041491 Bacteria 1214
134 Ga0451835_0868731 3300041492 Bacteria 5411
135 Ga0451847_0268818 3300041503 Bacteria 1427
136 Ga0451851_0757822 3300041507 Bacteria 2320
137 Ga0451843_0209662 3300041509 Bacteria 1500
138 Ga0451853_1946174 3300041512 Bacteria 1771
139 Ga0439431_0003117 3300041997 Bacteria 3643
140 Ga0439433_0073188 3300041999 Bacteria 827
141 Ga0439445_0051446 3300042004 Bacteria 1113
142 Ga0439432_155402 3300042006 Bacteria 670
143 Ga0439449_0000282 3300042007 Bacteria 18421
144 Ga0439449_0000983 3300042007 Bacteria 11209
145 Ga0439462_0145484 3300042015 Bacteria 665
146 Ga0439434_0051921 3300042435 Bacteria 1272
147 Ga0450918_012783 3300042531 Bacteria 1462
148 Ga0495627_048412 3300046453 Bacteria 1286
149 Ga0495650_0129452 3300046471 Bacteria 922
150 Ga0495606_0294338 3300046507 Bacteria 882
151 Ga0495643_0022241 3300046522 Bacteria 3621
152 Ga0495643_0034596 3300046522 Bacteria 2787
153 Ga0495648_0014777 3300046524 Bacteria 5689
154 Ga0495633_0024991 3300046558 Bacteria 2946
155 Ga0495611_0078339 3300046648 Bacteria 1517
156 Ga0495625_0010398 3300046660 Bacteria 7706
157 Ga0495625_0021317 3300046660 Bacteria 4991
158 Ga0495625_0042289 3300046660 Bacteria 3313
159 Ga0495661_0047348 3300046665 Bacteria 2619
160 Ga0495588_0089826 3300046674 Bacteria 1609
161 Ga0495670_0014452 3300046691 Bacteria 3882
162 Ga0495649_0163553 3300046694 Bacteria 1166
163 Ga0495686_0000566 3300047472 Bacteria 52625
164 Ga0495686_0408288 3300047472 Bacteria 728
165 Ga0496101_0135912 3300048904 Bacteria 1871
166 Ga0496106_0000237 3300048909 Bacteria 38613
167 Ga0496106_0008856 3300048909 Bacteria 7439
168 Ga0496107_0040859 3300048910 Bacteria 3330
169 Ga0496108_0093657 3300048911 Bacteria 2556
170 Ga0496111_0003823 3300048914 Bacteria 9397
171 Ga0496116_0020899 3300048919 Bacteria 4954
172 Ga0496116_0026864 3300048919 Bacteria 4199
173 Ga0496116_0033137 3300048919 Bacteria 3669
174 Ga0496116_0081765 3300048919 Bacteria 2001
175 Ga0496117_0007771 3300048920 Bacteria 10354
176 Ga0496117_0009155 3300048920 Bacteria 9280
177 Ga0496117_0046219 3300048920 Bacteria 3133
178 Ga0496117_0366882 3300048920 Bacteria 738
179 Ga0496118_0005076 3300048921 Bacteria 15159
180 Ga0496118_0035847 3300048921 Bacteria 4019
181 Ga0496119_0001870 3300048922 Bacteria 24312
182 Ga0496119_0048578 3300048922 Bacteria 2630
183 Ga0496120_0059974 3300048923 Bacteria 2130
184 Ga0496120_0068949 3300048923 Bacteria 1949
185 Ga0496121_0015787 3300048924 Bacteria 7865
186 Ga0496121_0179980 3300048924 Bacteria 1527
187 Ga0496121_0196677 3300048924 Bacteria 1441
188 Ga0496121_0285204 3300048924 Bacteria 1127
189 Ga0496121_0294662 3300048924 Bacteria 1104
190 Ga0496122_0000266 3300048925 Bacteria 117021
191 Ga0496122_0001860 3300048925 Bacteria 32176
192 Ga0496122_0002921 3300048925 Bacteria 23318
193 Ga0496122_0009058 3300048925 Bacteria 10565
194 Ga0496122_0045007 3300048925 Bacteria 3435
195 Ga0496122_0045614 3300048925 Bacteria 3405
196 Ga0496122_0157988 3300048925 Bacteria 1387
197 Ga0496122_0233704 3300048925 Bacteria 1043
198 Ga0496123_0000018 3300048926 Bacteria 404553
199 Ga0496123_0014086 3300048926 Bacteria 6654
200 Ga0496123_0138909 3300048926 Bacteria 1332
201 Ga0496123_0238897 3300048926 Bacteria 903
202 Ga0496123_0239436 3300048926 Bacteria 902
203 Ga0496123_0304976 3300048926 Bacteria 758
204 Ga0496124_0000055 3300048927 Bacteria 251395
205 Ga0496124_0000072 3300048927 Bacteria 219914
206 Ga0496124_0024333 3300048927 Bacteria 5510
207 Ga0496124_0035360 3300048927 Bacteria 4371
208 Ga0496124_0122398 3300048927 Bacteria 2077
209 Ga0496124_0148691 3300048927 Bacteria 1840
210 Ga0496125_0000215 3300048928 Bacteria 118487
211 Ga0496125_0000772 3300048928 Bacteria 52321
212 Ga0496125_0034794 3300048928 Bacteria 4432
213 Ga0496125_0109261 3300048928 Bacteria 2008
214 Ga0496126_0000412 3300048929 Bacteria 86638
215 Ga0496126_0001991 3300048929 Bacteria 28960
216 Ga0496126_0260173 3300048929 Bacteria 1443
217 Ga0501033_0110348 3300049570 Bacteria 2002
218 Ga0501037_0058369 3300049573 Bacteria 2816
219 Ga0501068_0039838 3300049584 Bacteria 2819
220 Ga0501035_0011302 3300049822 Bacteria 8273
221 Ga0501044_0001843 3300049823 Bacteria 24646
222 nmdc:mga03683_89_c1 3300050489 Bacteria 33351
223 nmdc:mga03n38_4736_c1 3300050490 Bacteria 4544
224 nmdc:mga0k408_1820_c1 3300050493 Bacteria 11438
225 nmdc:mga0k408_3058_c1 3300050493 Bacteria 8875
226 nmdc:mga07m45_7012_c1 3300050496 Bacteria 4174
227 nmdc:mga07m45_87174_c1 3300050496 Bacteria 1786
228 nmdc:mga0sz30_101601_c1 3300050516 Bacteria 1256
229 Ga0500555_000368 3300053103 Bacteria 19077
230 Ga0500556_0001166 3300053104 Bacteria 12584
231 Ga0500618_001669 3300053125 Bacteria 9519
232 Ga0500642_0020861 3300053130 Bacteria 2584
233 Ga0500658_0024970 3300053134 Bacteria 2294
234 Ga0500658_0025140 3300053134 Bacteria 2287
235 Ga0500658_0092288 3300053134 Bacteria 1311
236 Ga0500568_0000739 3300053139 Bacteria 23352
237 Ga0500577_0163029 3300053142 Unclassified 950
238 Ga0500604_0109498 3300053151 Bacteria 916
239 Ga0500622_0000134 3300053156 Bacteria 78418
240 Ga0500636_0164752 3300053177 Bacteria 1205

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300022739 Ga0228711_1000005 Ga0228711_1000005109 173
2 3300022740 Ga0228710_1000018 Ga0228710_1000018109 173
3 3300022740 Ga0228710_1023199 Ga0228710_10231994 173
4 3300027111 Ga0209281_1000111 Ga0209281_1000111109 173
5 3300027111 Ga0209281_1003971 Ga0209281_10039714 173
6 3300027666 Ga0209282_1000012 Ga0209282_1000012109 173
7 3300031967 Ga0315914_1000007 Ga0315914_1000007105 173
8 3300033430 Ga0315913_1000003 Ga0315913_1000003109 173
9 3300033464 Ga0315915_1000011 Ga0315915_1000011105 173
10 3300042015 Ga0439462_0145484 Ga0439462_0145484_37_633 185
11 3300048922 Ga0496119_0001870 Ga0496119_0001870_8310_8963 186
12 3300048923 Ga0496120_0059974 Ga0496120_0059974_1373_2026 186
13 3300048925 Ga0496122_0002921 Ga0496122_0002921_2248_2901 186
14 3300048927 Ga0496124_0122398 Ga0496124_0122398_70_723 186
15 3300005353 Ga0070669_100170340 Ga0070669_1001703401 188
16 3300025923 Ga0207681_10236474 Ga0207681_102364741 188
17 3300048926 Ga0496123_0014086 Ga0496123_0014086_415_1062 188
18 3300050516 nmdc:mga0sz30_101601_c1 nmdc:mga0sz30_101601_c1_268_915 188
19 3300025915 Ga0207693_10705591 Ga0207693_107055911 194
20 iso_pu_bacteria 2842521101 2842524052 194
21 3300006353 Ga0075370_10037117 Ga0075370_100371172 195
22 3300021388 Ga0213875_10027100 Ga0213875_100271003 195
23 3300039437 Ga0436365_0703374 Ga0436365_0703374_126_761 195
24 3300003323 rootH1_10060016 rootH1_100600162 197
25 3300021384 Ga0213876_10001432 Ga0213876_100014325 197
26 3300039437 Ga0436365_0117548 Ga0436365_0117548_50511_51152 197
27 3300025273 Ga0209673_1068441 Ga0209673_10684412 198
28 3300048919 Ga0496116_0033137 Ga0496116_0033137_1910_2557 198
29 3300048920 Ga0496117_0046219 Ga0496117_0046219_1704_2351 198
30 3300048921 Ga0496118_0035847 Ga0496118_0035847_1662_2309 198
31 3300048922 Ga0496119_0048578 Ga0496119_0048578_555_1202 198
32 3300048924 Ga0496121_0285204 Ga0496121_0285204_51_698 198
33 3300048924 Ga0496121_0294662 Ga0496121_0294662_356_997 198
34 3300048925 Ga0496122_0157988 Ga0496122_0157988_224_871 198
35 3300048926 Ga0496123_0238897 Ga0496123_0238897_161_808 198
36 3300048927 Ga0496124_0148691 Ga0496124_0148691_633_1280 198
37 3300048928 Ga0496125_0034794 Ga0496125_0034794_2460_3107 198
38 3300048929 Ga0496126_0260173 Ga0496126_0260173_754_1401 198
39 3300002773 JGI25152J39213_1000009 JGI25152J39213_100000949 199
40 3300002774 JGI25150J39212_1000016 JGI25150J39212_100001685 199
41 3300003187 JGI25151J46595_10000073 JGI25151J46595_1000007348 199
42 3300003215 JGI25153J46596_10001135 JGI25153J46596_100011357 199
43 3300005548 Ga0070665_101290034 Ga0070665_1012900341 199
44 3300021361 Ga0213872_10071954 Ga0213872_100719542 199
45 3300025245 Ga0207425_1000054 Ga0207425_100005486 199
46 3300025258 Ga0209129_1000108 Ga0209129_100010886 199
47 3300025294 Ga0209025_1000189 Ga0209025_100018986 199
48 3300025297 Ga0209758_1000162 Ga0209758_100016268 199
49 3300027312 Ga0209371_1001822 Ga0209371_10018224 200
50 3300030500 Ga0268256_1001607 Ga0268256_100160711 200
51 3300041404 Ga0439436_0003895 Ga0439436_0003895_2018_2659 200
52 3300041405 Ga0439438_017034 Ga0439438_017034_1048_1689 200
53 3300041413 Ga0439465_0000971 Ga0439465_0000971_1376_2017 200
54 3300041997 Ga0439431_0003117 Ga0439431_0003117_15_656 200
55 3300041999 Ga0439433_0073188 Ga0439433_0073188_58_699 200
56 3300042004 Ga0439445_0051446 Ga0439445_0051446_144_785 200
57 3300042006 Ga0439432_155402 Ga0439432_155402_10_651 200
58 3300042007 Ga0439449_0000983 Ga0439449_0000983_6816_7457 200
59 3300042435 Ga0439434_0051921 Ga0439434_0051921_612_1253 200
60 3300042531 Ga0450918_012783 Ga0450918_012783_64_705 200
61 3300021361 Ga0213872_10003545 Ga0213872_100035459 201
62 3300048927 Ga0496124_0000055 Ga0496124_0000055_226907_227548 201
63 3300048929 Ga0496126_0000412 Ga0496126_0000412_48186_48827 202
64 3300048924 Ga0496121_0179980 Ga0496121_0179980_35_679 208
65 3300006048 Ga0075363_100006680 Ga0075363_1000066802 209
66 3300006177 Ga0075362_10003823 Ga0075362_100038237 209
67 3300006195 Ga0075366_10010958 Ga0075366_100109586 209
68 3300006195 Ga0075366_10020889 Ga0075366_100208893 209
69 3300006353 Ga0075370_10014388 Ga0075370_100143885 209
70 3300050489 nmdc:mga03683_89_c1 nmdc:mga03683_89_c1_19177_19806 209
71 3300050490 nmdc:mga03n38_4736_c1 nmdc:mga03n38_4736_c1_407_1036 209
72 3300050493 nmdc:mga0k408_1820_c1 nmdc:mga0k408_1820_c1_3884_4513 209
73 3300050493 nmdc:mga0k408_3058_c1 nmdc:mga0k408_3058_c1_5863_6492 209
74 3300050496 nmdc:mga07m45_7012_c1 nmdc:mga07m45_7012_c1_2087_2716 209
75 3300053103 Ga0500555_000368 Ga0500555_000368_3704_4333 209
76 3300053104 Ga0500556_0001166 Ga0500556_0001166_6614_7243 209
77 3300053130 Ga0500642_0020861 Ga0500642_0020861_1482_2111 209
78 3300053134 Ga0500658_0092288 Ga0500658_0092288_319_948 209
79 3300053142 Ga0500577_0163029 Ga0500577_0163029_55_684 209
80 iso_pu_bacteria 2510065057 2510303067 209
81 iso_pu_bacteria 2510461076 2510898845 209
82 iso_pu_bacteria 2510917022 2511131710 209
83 iso_pu_bacteria 2510917030 2511195628 209
84 iso_pu_bacteria 2511231052 2511497065 209
85 iso_pu_bacteria 2512875026 2512968906 209
86 iso_pu_bacteria 2513237086 2513582765 209
87 iso_pu_bacteria 2513237089 2513605924 209
88 iso_pu_bacteria 2513237091 2513614818 209
89 iso_pu_bacteria 2513237093 2513632551 209
90 iso_pu_bacteria 2513237140 2513881881 209
91 iso_pu_bacteria 2513237143 2513901729 209
92 iso_pu_bacteria 2513237144 2513909361 209
93 iso_pu_bacteria 2513237156 2513988146 209
94 iso_pu_bacteria 2513237159 2513998833 209
95 iso_pu_bacteria 2513237160 2514006043 209
96 iso_pu_bacteria 2513237162 2514020540 209
97 iso_pu_bacteria 2515154107 2515611654 209
98 iso_pu_bacteria 2515154113 2515639245 209
99 iso_pu_bacteria 2515154114 2515644197 209
100 iso_pu_bacteria 2515154116 2515660368 209
101 iso_pu_bacteria 2516653046 2516895705 209
102 iso_pu_bacteria 2517093000 2517094269 209
103 iso_pu_bacteria 2517487022 2517566342 209
104 iso_pu_bacteria 2524023207 2524449311 209
105 iso_pu_bacteria 2524023209 2524460768 209
106 iso_pu_bacteria 2534681786 2535485308 209
107 iso_pu_bacteria 2537561587 2537874664 209
108 iso_pu_bacteria 2551306084 2551678827 209
109 iso_pu_bacteria 2551306084 2551682065 209
110 iso_pu_bacteria 2551306085 2551683376 209
111 iso_pu_bacteria 2582581283 2585166937 209
112 iso_pu_bacteria 2582581298 2585222437 209
113 iso_pu_bacteria 2582581306 2585265351 209
114 iso_pu_bacteria 2582581307 2585275184 209
115 iso_pu_bacteria 2582581308 2585282420 209
116 iso_pu_bacteria 2582581315 2585327747 209
117 iso_pu_bacteria 2582581316 2585335711 209
118 iso_pu_bacteria 2582581865 2585388557 209
119 iso_pu_bacteria 2585427527 2585537045 209
120 iso_pu_bacteria 2585427529 2585544611 209
121 iso_pu_bacteria 2585427530 2585556421 209
122 iso_pu_bacteria 2585427531 2585561102 209
123 iso_pu_bacteria 2585427594 2585846542 209
124 iso_pu_bacteria 2585427608 2585899752 209
125 iso_pu_bacteria 2585427609 2585908306 209
126 iso_pu_bacteria 2585428125 2587983659 209
127 iso_pu_bacteria 2599185236 2599722748 209
128 iso_pu_bacteria 2599185352 2600195184 209
129 iso_pu_bacteria 2615840626 2616309917 209
130 iso_pu_bacteria 2615840626 2616310143 209
131 iso_pu_bacteria 2615840698 2616551310 209
132 iso_pu_bacteria 2617270742 2617384006 209
133 iso_pu_bacteria 2643221610 2644067185 209
134 iso_pu_bacteria 2643221618 2644104092 209
135 iso_pu_bacteria 2643221626 2644149460 209
136 iso_pu_bacteria 2643221655 2644306965 209
137 iso_pu_bacteria 2643221659 2644331450 209
138 iso_pu_bacteria 2643221675 2644418277 209
139 iso_pu_bacteria 2643221680 2644451699 209
140 iso_pu_bacteria 2643221689 2644498283 209
141 iso_pu_bacteria 2643221698 2644540382 209
142 iso_pu_bacteria 2643221712 2644619204 209
143 iso_pu_bacteria 2643221726 2644691242 209
144 iso_pu_bacteria 2667528174 2671116163 209
145 iso_pu_bacteria 2718218233 2720617062 209
146 iso_pu_bacteria 2738541293 2738804019 209
147 iso_pu_bacteria 2751185800 2753357783 209
148 iso_pu_bacteria 2758568016 2758640366 209
149 iso_pu_bacteria 2765235942 2766063755 209
150 iso_pu_bacteria 2775507266 2778178058 209
151 iso_pu_bacteria 2775507266 2778180015 209
152 iso_pu_bacteria 2775507266 2778180321 209
153 iso_pu_bacteria 2791355091 2792623712 209
154 iso_pu_bacteria 2791355092 2792630055 209
155 iso_pu_bacteria 2791355253 2793280838 209
156 iso_pu_bacteria 2791355256 2793298033 209
157 iso_pu_bacteria 2791355266 2793363097 209
158 iso_pu_bacteria 2802428858 2802719752 209
159 iso_pu_bacteria 2802428859 2802727756 209
160 iso_pu_bacteria 2802428860 2802733256 209
161 iso_pu_bacteria 2802428861 2802738812 209
162 iso_pu_bacteria 2802428862 2802745588 209
163 iso_pu_bacteria 2802428863 2802751353 209
164 iso_pu_bacteria 2802429606 2805937459 209
165 iso_pu_bacteria 2818991448 2819612080 209
166 iso_pu_bacteria 2818991453 2819643854 209
167 iso_pu_bacteria 2838029111 2838033450 209
168 iso_pu_bacteria 2841734538 2841738678 209
169 iso_pu_bacteria 2841851746 2841856420 209
170 iso_pu_bacteria 2841864319 2841870049 209
171 iso_pu_bacteria 2842110456 2842117554 209
172 iso_pu_bacteria 2842217011 2842221413 209
173 iso_pu_bacteria 2842402390 2842407836 209
174 iso_pu_bacteria 2842409023 2842414375 209
175 iso_pu_bacteria 2842415677 2842421264 209
176 iso_pu_bacteria 2842475841 2842480280 209
177 iso_pu_bacteria 2842482326 2842486407 209
178 iso_pu_bacteria 2842502639 2842507692 209
179 iso_pu_bacteria 2844163670 2844170868 209
180 iso_pu_bacteria 2850079185 2850080897 209
181 iso_pu_bacteria 2852387548 2852394947 209
182 iso_pu_bacteria 2855825444 2855829479 209
183 iso_pu_bacteria 2855839649 2855844578 209
184 iso_pu_bacteria 2855872281 2855872823 209
185 iso_pu_bacteria 2857516855 2857521616 209
186 iso_pu_bacteria 2858800743 2858805961 209
187 iso_pu_bacteria 2871435913 2871438252 209
188 iso_pu_bacteria 2871474448 2871477607 209
189 iso_pu_bacteria 2874168670 2874171172 209
190 iso_pu_bacteria 2878788777 2878794188 209
191 iso_pu_bacteria 2891373044 2891376763 209
192 iso_pu_bacteria 2899792073 2899795529 209
193 iso_pu_bacteria 2909042592 2909048144 209
194 iso_pu_bacteria 2915980308 2915982162 209
195 iso_pu_bacteria 2915986958 2915992018 209
196 iso_pu_bacteria 2915993759 2915993954 209
197 iso_pu_bacteria 2916000859 2916003369 209
198 iso_pu_bacteria 2916007675 2916007806 209
199 iso_pu_bacteria 2916014648 2916015944 209
200 iso_pu_bacteria 2916021584 2916021788 209
201 iso_pu_bacteria 2916028427 2916031994 209
202 iso_pu_bacteria 2916035215 2916037405 209
203 iso_pu_bacteria 2916041962 2916042138 209
204 iso_pu_bacteria 2916048683 2916048911 209
205 iso_pu_bacteria 2916055098 2916059581 209
206 iso_pu_bacteria 2916061851 2916063453 209
207 iso_pu_bacteria 2916068649 2916071528 209
208 iso_pu_bacteria 2916076590 2916081215 209
209 iso_pu_bacteria 2921201388 2921203231 209
210 iso_pu_bacteria 2921208531 2921212732 209
211 iso_pu_bacteria 2921237296 2921242190 209
212 iso_pu_bacteria 2921244191 2921250011 209
213 iso_pu_bacteria 2921250672 2921256678 209
214 iso_pu_bacteria 2921257292 2921259334 209
215 iso_pu_bacteria 2921263974 2921269734 209
216 iso_pu_bacteria 2921282425 2921282913 209
217 iso_pu_bacteria 2921289301 2921293656 209
218 iso_pu_bacteria 2921296804 2921300475 209
219 iso_pu_bacteria 2924144063 2924148022 209
220 iso_pu_bacteria 2924150972 2924155706 209
221 iso_pu_bacteria 2924158325 2924161828 209
222 iso_pu_bacteria 2924165586 2924165664 209
223 iso_pu_bacteria 2924172951 2924176255 209
224 iso_pu_bacteria 2924179722 2924184315 209
225 iso_pu_bacteria 2924186466 2924188248 209
226 iso_pu_bacteria 2924193448 2924196940 209
227 iso_pu_bacteria 2924200457 2924200657 209
228 iso_pu_bacteria 2924207177 2924207280 209
229 iso_pu_bacteria 2924214083 2924219114 209
230 iso_pu_bacteria 2924221636 2924224202 209
231 iso_pu_bacteria 2924228884 2924228997 209
232 iso_pu_bacteria 2924710171 2924713493 209
233 iso_pu_bacteria 2933586486 2933593651 209
234 iso_pu_bacteria 2936367885 2936371120 209
235 iso_pu_bacteria 2936996657 2936997193 209
236 iso_pu_bacteria 2937002841 2937003121 209
237 iso_pu_bacteria 2937009748 2937009969 209
238 iso_pu_bacteria 2937016420 2937020406 209
239 iso_pu_bacteria 2937023124 2937025288 209
240 iso_pu_bacteria 2937029754 2937034305 209
241 iso_pu_bacteria 2937036028 2937037605 209
242 iso_pu_bacteria 2937042894 2937048390 209
243 iso_pu_bacteria 2937049772 2937050632 209
244 iso_pu_bacteria 2937056579 2937060414 209
245 iso_pu_bacteria 2937063883 2937064047 209
246 iso_pu_bacteria 2937071275 2937071781 209
247 iso_pu_bacteria 2937078374 2937084555 209
248 iso_pu_bacteria 2937084907 2937091521 209
249 iso_pu_bacteria 2937091812 2937094295 209
250 iso_pu_bacteria 2937098957 2937101565 209
251 iso_pu_bacteria 2937106411 2937110088 209
252 iso_pu_bacteria 2937113482 2937115550 209
253 iso_pu_bacteria 2937119839 2937119969 209
254 iso_pu_bacteria 2937126314 2937132431 209
255 iso_pu_bacteria 2937836603 2937841958 209
256 iso_pu_bacteria 2941499720 2941502503 209
257 iso_pu_bacteria 2957375807 2957381197 209
258 iso_pu_bacteria 2957382221 2957382396 209
259 iso_pu_bacteria 2957388812 2957395397 209
260 iso_pu_bacteria 2957395598 2957400067 209
261 iso_pu_bacteria 2957402308 2957404158 209
262 iso_pu_bacteria 2957408893 2957414909 209
263 iso_pu_bacteria 2957415311 2957419452 209
264 iso_pu_bacteria 2957422303 2957429460 209
265 iso_pu_bacteria 2957430029 2957432154 209
266 iso_pu_bacteria 2957437181 2957439073 209
267 iso_pu_bacteria 2957443900 2957445885 209
268 iso_pu_bacteria 2957450854 2957450987 209
269 iso_pu_bacteria 2957457609 2957461627 209
270 iso_pu_bacteria 2957464669 2957468027 209
271 iso_pu_bacteria 2957471148 2957474902 209
272 iso_pu_bacteria 2957478035 2957478767 209
273 iso_pu_bacteria 2957484790 2957487288 209
274 iso_pu_bacteria 2957491536 2957496743 209
275 iso_pu_bacteria 2957498199 2957504862 209
276 iso_pu_bacteria 2957505466 2957505661 209
277 iso_pu_bacteria 2958071322 2958071718 209
278 iso_pu_bacteria 2960584000 2960584160 209
279 iso_pu_bacteria 2960591022 2960596967 209
280 iso_pu_bacteria 2960597568 2960602971 209
281 iso_pu_bacteria 2960603979 2960604038 209
282 iso_pu_bacteria 2960610863 2960611069 209
283 iso_pu_bacteria 2960617483 2960622430 209
284 iso_pu_bacteria 2960624210 2960625305 209
285 iso_pu_bacteria 2960631154 2960631532 209
286 iso_pu_bacteria 2960637947 2960640427 209
287 iso_pu_bacteria 2960645483 2960649190 209
288 iso_pu_bacteria 2960652885 2960657743 209
289 iso_pu_bacteria 2960660292 2960663815 209
290 iso_pu_bacteria 2960667422 2960667628 209
291 iso_pu_bacteria 2960674078 2960679265 209
292 iso_pu_bacteria 2960680706 2960682171 209
293 iso_pu_bacteria 2960687367 2960691922 209
294 iso_pu_bacteria 2960693952 2960699842 209
295 iso_pu_bacteria 2964607997 2964614984 209
296 iso_pu_bacteria 2964615318 2964620693 209
297 iso_pu_bacteria 2964621998 2964626051 209
298 iso_pu_bacteria 2964628898 2964629082 209
299 iso_pu_bacteria 2964636051 2964636191 209
300 iso_pu_bacteria 2964643177 2964643307 209
301 iso_pu_bacteria 2964649959 2964653849 209
302 iso_pu_bacteria 2964656573 2964656793 209
303 iso_pu_bacteria 2964663802 2964663933 209
304 iso_pu_bacteria 2964670856 2964673520 209
305 iso_pu_bacteria 2964678106 2964678160 209
306 iso_pu_bacteria 2964685014 2964691306 209
307 iso_pu_bacteria 2964691889 2964694138 209
308 iso_pu_bacteria 2964698721 2964698981 209
309 iso_pu_bacteria 2964705432 2964710790 209
310 iso_pu_bacteria 2964712639 2964716690 209
311 iso_pu_bacteria 2964719344 2964723413 209
312 iso_pu_bacteria 2967664464 2967664633 209
313 iso_pu_bacteria 2967671571 2967671702 209
314 iso_pu_bacteria 2967678726 2967681379 209
315 iso_pu_bacteria 2967686174 2967689477 209
316 iso_pu_bacteria 2967693043 2967698449 209
317 iso_pu_bacteria 2967699805 2967699872 209
318 iso_pu_bacteria 2967706974 2967714037 209
319 iso_pu_bacteria 2967714385 2967718521 209
320 iso_pu_bacteria 2967721400 2967721478 209
321 iso_pu_bacteria 2967728569 2967730247 209
322 iso_pu_bacteria 2967735183 2967737338 209
323 iso_pu_bacteria 2967742019 2967744363 209
324 iso_pu_bacteria 2967748971 2967749103 209
325 iso_pu_bacteria 2967755722 2967755854 209
326 iso_pu_bacteria 2967762386 2967762414 209
327 iso_pu_bacteria 2967769361 2967769521 209
328 iso_pu_bacteria 2967775926 2967776034 209
329 iso_pu_bacteria 2970019648 2970019817 209
330 iso_pu_bacteria 2970026789 2970029005 209
331 iso_pu_bacteria 2970033650 2970033781 209
332 iso_pu_bacteria 2970040964 2970043966 209
333 iso_pu_bacteria 2970054988 2970055681 209
334 iso_pu_bacteria 2970061556 2970063783 209
335 iso_pu_bacteria 2970068827 2970068957 209
336 iso_pu_bacteria 2970076120 2970078084 209
337 iso_pu_bacteria 2970082768 2970084390 209
338 iso_pu_bacteria 2970088815 2970091974 209
339 iso_pu_bacteria 2970095765 2970095897 209
340 iso_pu_bacteria 2970102677 2970102809 209
341 iso_pu_bacteria 2970109326 2970111270 209
342 iso_pu_bacteria 2970116247 2970119126 209
343 iso_pu_bacteria 2970122695 2970125641 209
344 iso_pu_bacteria 2970129317 2970135260 209
345 iso_pu_bacteria 2970136068 2970136127 209
346 iso_pu_bacteria 2970143518 2970149495 209
347 iso_pu_bacteria 2970149975 2970152056 209
348 iso_pu_bacteria 2970156795 2970162509 209
349 iso_pu_bacteria 2970164137 2970165554 209
350 iso_pu_bacteria 2970170962 2970171093 209
351 iso_pu_bacteria 2970177841 2970180092 209
352 iso_pu_bacteria 2970184632 2970188138 209
353 iso_pu_bacteria 2970191845 2970191928 209
354 iso_pu_bacteria 2970510686 2970511233 209
355 iso_pu_bacteria 2977516862 2977520592 209
356 iso_pu_bacteria 2977523885 2977525942 209
357 iso_pu_bacteria 2977530762 2977534556 209
358 iso_pu_bacteria 2977537788 2977539762 209
359 iso_pu_bacteria 2977544691 2977545390 209
360 iso_pu_bacteria 2977551784 2977556082 209
361 iso_pu_bacteria 2977558990 2977558996 209
362 iso_pu_bacteria 2977565890 2977566154 209
363 iso_pu_bacteria 2977572785 2977573618 209
364 iso_pu_bacteria 2977579622 2977585099 209
365 iso_pu_bacteria 2977898635 2977904306 209
366 iso_pu_bacteria 2989349275 2989353679 209
367 iso_pu_bacteria 2989771324 2989776645 209
368 iso_pu_bacteria 2996386984 2996390560 209
369 iso_pu_bacteria 2996887358 2996889841 209
370 iso_pu_bacteria 3003930520 3003935902 209
371 iso_pu_bacteria 3005409236 3005410146 209
372 iso_pu_bacteria 3005416602 3005419121 209
373 iso_pu_bacteria 3005445848 3005450929 209
374 iso_pu_bacteria 648276728 648735589 209
375 iso_pu_bacteria 8003992118 8003997103 209
376 iso_pu_bacteria 8003999396 8004004813 209
377 iso_pu_bacteria 8004633249 8004637751 209
378 iso_pu_bacteria 8005301065 8005301823 209
379 iso_pu_bacteria 8005314921 8005318114 209
380 iso_pu_bacteria 8005321885 8005324368 209
381 iso_pu_bacteria 8005382845 8005386602 209
382 iso_pu_bacteria 8005382845 8005386868 209
383 iso_pu_bacteria 8005395548 8005402134 209
384 iso_pu_bacteria 8005484373 8005486173 209
385 iso_pu_bacteria 8005556819 8005559748 209
386 iso_pu_bacteria 8005563573 8005570657 209
387 iso_pu_bacteria 8005645114 8005648442 209
388 iso_pu_bacteria 8005682033 8005688261 209
389 iso_pu_bacteria 8018163183 8018169287 209
390 iso_pu_bacteria 8024486573 8024490380 209
391 iso_pu_bacteria 8045864390 8045864812 209
392 iso_pu_bacteria 8057575449 8057578361 209
393 3300005467 Ga0070706_100050230 Ga0070706_1000502306 210
394 3300039450 Ga0436363_0087163 Ga0436363_0087163_7946_8578 210
395 3300048911 Ga0496108_0093657 Ga0496108_0093657_1869_2501 210
396 3300005434 Ga0070709_10293120 Ga0070709_102931201 211
397 3300005436 Ga0070713_100082818 Ga0070713_1000828183 211
398 3300005437 Ga0070710_10050681 Ga0070710_100506812 211
399 3300006028 Ga0070717_10479386 Ga0070717_104793862 211
400 3300021384 Ga0213876_10002018 Ga0213876_1000201812 211
401 3300021441 Ga0213871_10042599 Ga0213871_100425992 211
402 3300025906 Ga0207699_10015994 Ga0207699_100159944 211
403 3300025928 Ga0207700_10013124 Ga0207700_100131242 211
404 3300039437 Ga0436365_1889837 Ga0436365_1889837_38329_38970 211
405 3300039438 Ga0436360_0075261 Ga0436360_0075261_712_1353 211
406 3300039438 Ga0436360_0386694 Ga0436360_0386694_717_1358 211
407 3300039438 Ga0436360_1297966 Ga0436360_1297966_2061_2702 211
408 3300039447 Ga0436361_1069080 Ga0436361_1069080_84_725 211
409 3300039447 Ga0436361_1213534 Ga0436361_1213534_8284_8925 211
410 3300039453 Ga0436362_0502256 Ga0436362_0502256_338_979 211
411 3300039437 Ga0436365_1722082 Ga0436365_1722082_6024_6671 212
412 3300039438 Ga0436360_0605812 Ga0436360_0605812_599_1243 212
413 3300039447 Ga0436361_0717001 Ga0436361_0717001_663_1307 212
414 3300039447 Ga0436361_1162858 Ga0436361_1162858_1849_2493 212
415 3300039453 Ga0436362_1182783 Ga0436362_1182783_17_661 212
416 3300001979 JGI24740J21852_10023092 JGI24740J21852_100230922 213
417 3300002704 JGI25155J39150_1000151 JGI25155J39150_10001515 213
418 3300002705 JGI25156J39149_1000331 JGI25156J39149_100033123 213
419 3300002738 JGI25154J39366_1000280 JGI25154J39366_100028023 213
420 3300002741 JGI25157J39369_1000365 JGI25157J39369_10003655 213
421 3300002773 JGI25152J39213_1002635 JGI25152J39213_10026355 213
422 3300002987 JGI25159J45721_1000301 JGI25159J45721_100030110 213
423 3300002987 JGI25159J45721_1010933 JGI25159J45721_10109332 213
424 3300003187 JGI25151J46595_10009093 JGI25151J46595_100090934 213
425 3300003215 JGI25153J46596_10005173 JGI25153J46596_100051737 213
426 3300003316 rootH1_10088617 rootH1_100886172 213
427 3300003320 rootH2_10025300 rootH2_100253005 213
428 3300003320 rootH2_10162403 rootH2_101624031 213
429 3300003322 rootL2_10002654 rootL2_100026547 213
430 3300003323 rootH1_10060037 rootH1_100600373 213
431 3300003323 rootH1_10201955 rootH1_102019551 213
432 3300003323 rootH1_10281779 rootH1_102817792 213
433 3300003354 JGI25160J50197_1004699 JGI25160J50197_10046995 213
434 3300003374 JGI25161J50226_1000093 JGI25161J50226_100009324 213
435 3300003578 Ga0006562J51391_1023753 Ga0006562J51391_10237532 213
436 3300003775 Ga0055524_1004232 Ga0055524_10042322 213
437 3300003790 Ga0055528_1003660 Ga0055528_10036602 213
438 3300003856 Ga0058692_1035824 Ga0058692_10358241 213
439 3300004625 Ga0055543_1001914 Ga0055543_10019142 213
440 3300005262 Ga0065165_1004958 Ga0065165_10049586 213
441 3300005262 Ga0065165_1005507 Ga0065165_10055077 213
442 3300005262 Ga0065165_1005670 Ga0065165_10056703 213
443 3300006048 Ga0075363_100377291 Ga0075363_1003772911 213
444 3300006353 Ga0075370_10034364 Ga0075370_100343642 213
445 3300009036 Ga0105244_10284197 Ga0105244_102841971 213
446 3300009148 Ga0105243_10311539 Ga0105243_103115392 213
447 3300010375 Ga0105239_10731167 Ga0105239_107311672 213
448 3300025206 Ga0209435_100114 Ga0209435_10011420 213
449 3300025208 Ga0209436_100007 Ga0209436_10000756 213
450 3300025245 Ga0207425_1018936 Ga0207425_10189362 213
451 3300025246 Ga0209646_1000362 Ga0209646_100036220 213
452 3300025250 Ga0209026_1000469 Ga0209026_100046920 213
453 3300025254 Ga0209148_1006670 Ga0209148_10066702 213
454 3300025256 Ga0209759_1000676 Ga0209759_100067620 213
455 3300025258 Ga0209129_1005138 Ga0209129_10051383 213
456 3300025273 Ga0209673_1005563 Ga0209673_10055636 213
457 3300025284 Ga0209130_1000001 Ga0209130_1000001714 213
458 3300025294 Ga0209025_1000044 Ga0209025_100004431 213
459 3300025295 Ga0209564_1001493 Ga0209564_10014939 213
460 3300025297 Ga0209758_1025708 Ga0209758_10257083 213
461 3300025299 Ga0209256_1008767 Ga0209256_10087675 213
462 3300025302 Ga0207426_1000045 Ga0207426_1000045323 213
463 3300025304 Ga0209257_1025204 Ga0209257_10252042 213
464 3300025935 Ga0207709_10869939 Ga0207709_108699391 213
465 3300027111 Ga0209281_1000185 Ga0209281_100018520 213
466 3300027312 Ga0209371_1004371 Ga0209371_10043713 213
467 3300030500 Ga0268256_1014966 Ga0268256_10149662 213
468 3300031665 Ga0316575_10000834 Ga0316575_100008342 213
469 3300031691 Ga0316579_10047704 Ga0316579_100477042 213
470 3300031712 Ga0265342_10250127 Ga0265342_102501272 213
471 3300031727 Ga0316576_10004953 Ga0316576_1000495311 213
472 3300031728 Ga0316578_10006191 Ga0316578_100061913 213
473 3300031731 Ga0307405_10268022 Ga0307405_102680222 213
474 3300031733 Ga0316577_10070264 Ga0316577_100702643 213
475 3300031901 Ga0307406_10055370 Ga0307406_100553703 213
476 3300031995 Ga0307409_100219044 Ga0307409_1002190442 213
477 3300032133 Ga0316583_10010680 Ga0316583_100106804 213
478 3300032137 Ga0316585_10010253 Ga0316585_100102532 213
479 3300032139 Ga0316580_10013686 Ga0316580_100136862 213
480 3300035398 Ga0316574_0002049 Ga0316574_0002049_1266_1907 213
481 3300036647 Ga0316582_0001473 Ga0316582_0001473_3670_4311 213
482 3300036712 Ga0316584_0046731 Ga0316584_0046731_2104_2745 213
483 3300039437 Ga0436365_0591003 Ga0436365_0591003_953_1609 213
484 3300039453 Ga0436362_0544059 Ga0436362_0544059_468_1166 213
485 3300041413 Ga0439465_0091272 Ga0439465_0091272_114_761 213
486 3300041491 Ga0451833_0631780 Ga0451833_0631780_521_1171 213
487 3300041492 Ga0451835_0868731 Ga0451835_0868731_3925_4575 213
488 3300041503 Ga0451847_0268818 Ga0451847_0268818_599_1249 213
489 3300041507 Ga0451851_0757822 Ga0451851_0757822_1634_2284 213
490 3300041509 Ga0451843_0209662 Ga0451843_0209662_290_940 213
491 3300041512 Ga0451853_1946174 Ga0451853_1946174_116_766 213
492 3300042007 Ga0439449_0000282 Ga0439449_0000282_9500_10147 213
493 3300046453 Ga0495627_048412 Ga0495627_048412_520_1161 213
494 3300046471 Ga0495650_0129452 Ga0495650_0129452_30_680 213
495 3300046507 Ga0495606_0294338 Ga0495606_0294338_169_816 213
496 3300046522 Ga0495643_0022241 Ga0495643_0022241_1624_2271 213
497 3300046522 Ga0495643_0034596 Ga0495643_0034596_1128_1796 213
498 3300046524 Ga0495648_0014777 Ga0495648_0014777_2458_3108 213
499 3300046558 Ga0495633_0024991 Ga0495633_0024991_1890_2540 213
500 3300046648 Ga0495611_0078339 Ga0495611_0078339_806_1456 213
501 3300046660 Ga0495625_0010398 Ga0495625_0010398_3505_4167 213
502 3300046660 Ga0495625_0021317 Ga0495625_0021317_3822_4472 213
503 3300046660 Ga0495625_0042289 Ga0495625_0042289_2614_3255 213
504 3300046665 Ga0495661_0047348 Ga0495661_0047348_1482_2132 213
505 3300046674 Ga0495588_0089826 Ga0495588_0089826_515_1165 213
506 3300046691 Ga0495670_0014452 Ga0495670_0014452_1547_2197 213
507 3300046694 Ga0495649_0163553 Ga0495649_0163553_424_1071 213
508 3300047472 Ga0495686_0000566 Ga0495686_0000566_24486_25160 213
509 3300047472 Ga0495686_0408288 Ga0495686_0408288_28_675 213
510 3300048904 Ga0496101_0135912 Ga0496101_0135912_649_1296 213
511 3300048909 Ga0496106_0000237 Ga0496106_0000237_27666_28313 213
512 3300048909 Ga0496106_0008856 Ga0496106_0008856_5707_6354 213
513 3300048910 Ga0496107_0040859 Ga0496107_0040859_943_1590 213
514 3300048914 Ga0496111_0003823 Ga0496111_0003823_2119_2766 213
515 3300048919 Ga0496116_0020899 Ga0496116_0020899_4140_4787 213
516 3300048919 Ga0496116_0026864 Ga0496116_0026864_3343_3990 213
517 3300048919 Ga0496116_0081765 Ga0496116_0081765_301_948 213
518 3300048920 Ga0496117_0007771 Ga0496117_0007771_4692_5333 213
519 3300048920 Ga0496117_0009155 Ga0496117_0009155_5019_5666 213
520 3300048920 Ga0496117_0366882 Ga0496117_0366882_49_696 213
521 3300048921 Ga0496118_0005076 Ga0496118_0005076_7075_7722 213
522 3300048923 Ga0496120_0068949 Ga0496120_0068949_986_1627 213
523 3300048924 Ga0496121_0015787 Ga0496121_0015787_2365_3012 213
524 3300048924 Ga0496121_0196677 Ga0496121_0196677_145_786 213
525 3300048925 Ga0496122_0000266 Ga0496122_0000266_62438_63079 213
526 3300048925 Ga0496122_0001860 Ga0496122_0001860_6818_7459 213
527 3300048925 Ga0496122_0009058 Ga0496122_0009058_719_1360 213
528 3300048925 Ga0496122_0045007 Ga0496122_0045007_1829_2476 213
529 3300048925 Ga0496122_0045614 Ga0496122_0045614_2745_3392 213
530 3300048925 Ga0496122_0233704 Ga0496122_0233704_179_826 213
531 3300048926 Ga0496123_0000018 Ga0496123_0000018_240483_241124 213
532 3300048926 Ga0496123_0138909 Ga0496123_0138909_468_1115 213
533 3300048926 Ga0496123_0239436 Ga0496123_0239436_43_690 213
534 3300048926 Ga0496123_0304976 Ga0496123_0304976_58_699 213
535 3300048927 Ga0496124_0000072 Ga0496124_0000072_103657_104304 213
536 3300048927 Ga0496124_0024333 Ga0496124_0024333_2472_3119 213
537 3300048927 Ga0496124_0035360 Ga0496124_0035360_1925_2572 213
538 3300048928 Ga0496125_0000215 Ga0496125_0000215_34051_34692 213
539 3300048928 Ga0496125_0000772 Ga0496125_0000772_22997_23638 213
540 3300048928 Ga0496125_0109261 Ga0496125_0109261_372_1013 213
541 3300048929 Ga0496126_0001991 Ga0496126_0001991_10114_10761 213
542 3300049570 Ga0501033_0110348 Ga0501033_0110348_682_1332 213
543 3300049573 Ga0501037_0058369 Ga0501037_0058369_1226_1876 213
544 3300049584 Ga0501068_0039838 Ga0501068_0039838_771_1418 213
545 3300049822 Ga0501035_0011302 Ga0501035_0011302_2309_2959 213
546 3300049823 Ga0501044_0001843 Ga0501044_0001843_671_1321 213
547 3300050496 nmdc:mga07m45_87174_c1 nmdc:mga07m45_87174_c1_1101_1748 213
548 3300053125 Ga0500618_001669 Ga0500618_001669_6696_7337 213
549 3300053134 Ga0500658_0024970 Ga0500658_0024970_473_1120 213
550 3300053134 Ga0500658_0025140 Ga0500658_0025140_794_1444 213
551 3300053139 Ga0500568_0000739 Ga0500568_0000739_10916_11563 213
552 3300053151 Ga0500604_0109498 Ga0500604_0109498_48_695 213
553 3300053156 Ga0500622_0000134 Ga0500622_0000134_60440_61087 213
554 3300053177 Ga0500636_0164752 Ga0500636_0164752_303_944 213

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02734

Dak2

DAK2 domain

29

202

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
3pnl-assembly1.cif.gz_B crystal structure of e.coli dha kinase dhak-dhal complex 0.8866 1 208
3pnl-assembly1.cif.gz_B crystal structure of e.coli dha kinase dhak-dhal complex 0.8709 1 208
7w7h-assembly1.cif.gz_A s suis faka-fakb2 complex structure 0.8369 3 210
7w7h-assembly1.cif.gz_B s suis faka-fakb2 complex structure 0.8364 3 211
7rzk-assembly1.cif.gz_A co-soak crystal structure of the n-terminal domain of staphylococcus aureus fatty acid kinase a (faka, residues 1-208) in complex with adp to 1.9 angstrom resolution - sad data 0.8358 1 211
ID Description Score Start End Superfamily
4lrzB00 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;DhaL domain 0.8758 3 209 1.25.40.340
4lrzB00 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;DhaL domain 0.8564 3 209 1.25.40.340
af_I1L409_384_593_1.25.40.340 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;DhaL domain 0.8533 10 209 1.25.40.340
af_Q6ASW3_381_587_1.25.40.340 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;DhaL domain 0.8495 9 209 1.25.40.340
af_Q2FZ58_3_204_1.25.40.340 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;DhaL domain 0.8471 3 209 1.25.40.340
ID Description Score Start End GO Terms
AF-A0A1W9F014-F1-model_v4 deleted 0.9683 9 106
AF-A0A6L3MDU8-F1-model_v4 deleted 0.9612 1 123
AF-A0A248UAZ2-F1-model_v4 Dihydroxyacetone kinase, L subunit (EC 2.7.-.-) 0.9429 1 213 GO:0004371
GO:0005829
GO:0019563
AF-A0A2L0HDG6-F1-model_v4 Dihydroxyacetone kinase ADP-binding subunit L 2 0.9421 1 213 GO:0004371
GO:0005829
GO:0019563
AF-N6USE1-F1-model_v4 Dihydroxyacetone kinase, L subunit 0.9416 1 212 GO:0004371
GO:0005829
GO:0019563

Feature Viewer

pLDDT pTM Quality
94.29 0.92 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map