F462929

General Info

Members Datasets Scaffolds Average Seq Length
553 351 1106 360

Family's Representative Sequence

Representative Sequence 3300053096|Ga0500641_0010007|Ga0500641_0010007_508_1821
Length 437
Sequence MSKPVPAIRSVKARGVVVPLARPVKTAFGVIDVGPLVLIDVETDQGVTGHSYILAYARLTLKPLMHLVEEIGRELTGRPIAPYDLMAAMDAKFRLLGWQGLVGMAVSGLDMAYWDALGQIAGRPVAELLGGSAKPIRAYDSYGVVDPVSDEKALRRSLDQGFRGIKIKGGDGDAANDERVVKGVRALLGPDIALMIDFNQSLDPAEAARRIARLEPYDLHWIEEPVPQENLSGHAKVRETSPTPIQAGENWWFPRGFAEAIEAGASDFIMPDLMKCGGVTGWLQVAAQAEAANIPMSSHLFAEASAHMLAVTPTAHWLEFLDFASVILAHPADIVDGAVTARGPGLGLEWNEAAVAKYLVGSRVALRARPEIARVRFFLFIAGTVGFLDERKTPRFVKAPRSQIALKRPELEAIAHALWDLQQLAADAAPLHFRQHI

Samples

Sample ID Description Type Environment
1 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
2 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
3 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
4 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
5 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
12 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
13 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
14 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
15 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
16 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
17 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
18 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
19 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
20 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
21 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
22 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
23 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
24 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
25 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
26 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
27 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
28 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
29 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
30 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
31 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
32 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
33 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
34 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
35 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
36 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
37 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
38 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
39 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
40 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
41 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
42 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
43 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
44 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
45 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
46 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
47 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
48 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
49 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
50 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
51 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
52 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
53 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
54 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
55 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
56 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
57 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
58 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
59 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
60 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
61 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
62 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
63 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
64 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
65 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
66 3300006943 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW Metagenome Nodule
67 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
68 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
69 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
70 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
71 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
72 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
73 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
74 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
75 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
76 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
77 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
78 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
79 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
80 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
81 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
82 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
83 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
84 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
85 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
86 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
87 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
88 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
89 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
90 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
91 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
92 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
93 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
142 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
143 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
144 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
148 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
149 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
150 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
151 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
152 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
153 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
154 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
155 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
156 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
157 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
158 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
159 3300033442 Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 Metagenome Nodule
160 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
161 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
162 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
163 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
164 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
165 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
166 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
167 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
168 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
169 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
170 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
171 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
172 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
173 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
174 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
175 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
176 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
177 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
178 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
179 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
180 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
181 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
182 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
183 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
184 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
185 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
186 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
187 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
188 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
189 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
190 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
191 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
192 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
193 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
194 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
195 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
196 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
197 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
198 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
199 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
200 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
201 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
202 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
203 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
204 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
205 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
206 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
207 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
208 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
209 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
210 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
211 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
212 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
213 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
214 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
215 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
216 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
217 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
218 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
219 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
220 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
221 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
222 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
223 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
224 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
225 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
226 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
227 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
228 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
229 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
230 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
231 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
232 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
233 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
234 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
235 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
236 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
237 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
238 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
239 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
240 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
241 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
242 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
243 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
244 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
245 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
246 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
247 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
248 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
249 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
250 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
251 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
252 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
253 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
254 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
255 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
256 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
257 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
258 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
259 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
260 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
261 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
262 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
263 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
264 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
265 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
266 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
267 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
268 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
269 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
270 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
271 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
272 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
273 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
274 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
275 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
276 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
277 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
278 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
279 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
280 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
281 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
282 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
283 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
284 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
285 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
286 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
287 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
288 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
289 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
290 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
291 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
292 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
293 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
294 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
295 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
296 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
297 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
298 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
299 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
300 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
301 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
302 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
303 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
304 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
305 2508501128 Bradyrhizobium sp. ARR65 Isolate Nodule
306 2513237096 Bradyrhizobium pachyrhizi USDA 3259 Isolate Nodule
307 2513237098 Bradyrhizobium elkanii WSM2783 Isolate Nodule
308 2513237101 Bradyrhizobium murdochi WSM1741 Isolate Nodule
309 2513237137 Bradyrhizobium elkanii USDA 94 Isolate Nodule
310 2513237141 Bradyrhizobium sp. TV2a.2 Isolate Nodule
311 2513237145 Bradyrhizobium elkanii USDA 3254 Isolate Nodule
312 2517572143 Bradyrhizobium elkanii USDA 76 Isolate Nodule
313 2524023210 Bradyrhizobium sp. Ai1a-2 Isolate Nodule
314 2562617112 Burkholderia sp. BT03 Isolate Rhizosphere
315 2643221658 Variovorax sp. Root411 Isolate Unclassified
316 2667528175 Rhizobium tropici NFR14 Isolate Rhizoplane
317 2711768613 Burkholderia sp. BT03 Isolate Rhizosphere
318 2721755755 Bradyrhizobium icense LMTR 13 Isolate Nodule
319 2728368998 Bradyrhizobium macuxiense BR 10303 Isolate Nodule
320 2791355197 Bradyrhizobium sp. C9 Isolate Nodule
321 2791355199
322 2874604998 Bradyrhizobium sp. LMTR 3 Isolate Nodule
323 2876808645 Bradyrhizobium algeriense RST89 Isolate Unclassified
324 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
325 2883087390 Paraburkholderia guartelaensis CNPSo 3008 Isolate Unclassified
326 2885383462 Bradyrhizobium sp. Leo170 Isolate Unclassified
327 2889033259 Bradyrhizobium sp. CCBAU 051011 Isolate Unclassified
328 2903748898 Bradyrhizobium uaiense UFLA 03-164 Isolate Nodule
329 2903768456 Bradyrhizobium sp. Leo121 Isolate Unclassified
330 2904541872 Variovorax sp. 1615 Isolate Rhizosphere
331 2904690495 Bradyrhizobium ivorense CI-1B Isolate Nodule
332 2904699407
333 2906635258 Bradyrhizobium sp. USDA 3458 Isolate Unclassified
334 2906660503 Bradyrhizobium brasilense UFLA 03-321 Isolate Unclassified
335 2908739725 Bradyrhizobium sp. UFLA03-84 Isolate Nodule
336 2908756301 Bradyrhizobium ivorense CI-41S Isolate Nodule
337 2922361189 Bradyrhizobium australiense WSM 1791 Isolate Nodule
338 2922386360 Bradyrhizobium archetypum WSM 1744 Isolate Nodule
339 2929160207 Variovorax sp. R-72349 Hybrid assembly Isolate Unclassified
340 2935630451 Bradyrhizobium sp. I1.14.4 Isolate Nodule
341 2939631187 Ottowia thiooxydans 2709 Isolate Rhizosphere
342 2941507105 Bradyrhizobium sp. i1.12.3 Isolate Nodule
343 2941515067 Bradyrhizobium sp. i1.14.1 Isolate Nodule
344 2941523033 Bradyrhizobium sp. i1.8.4 Isolate Nodule
345 3005474847 Bradyrhizobium sp. CCBAU 53421 Isolate Nodule
346 8006933436 Bradyrhizobium septentrionale 7(2017) Isolate Unclassified
347 8006973647 Bradyrhizobium septentrionale 162S2 Isolate Nodule
348 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
349 8006994254 Bradyrhizobium sp. sGM-13 Isolate Nodule
350 8056673599 Bradyrhizobium hereditatis WSM 1738 Isolate Nodule
351 8056689827 Bradyrhizobium semiaridum WSM 1704 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 91.83
Metatranscriptomes 0
Isolates 8.17

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 10.13
Nodule 6.15
Rhizoplane 5.06
Rhizosphere 69.62
Stem 0
Stem Tuber 0
Unclassified 0.18

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0500641_0010007 3300053096 Bacteria 3418
2 JGI25151J46595_10001974 3300003187 Bacteria 12907
3 JGI25406J46586_10000094 3300003203 Bacteria 40843
4 JGI25406J46586_10003160 3300003203 Bacteria 7746
5 JGI25153J46596_10000149 3300003215 Bacteria 70796
6 JGI25153J46596_10007264 3300003215 Bacteria 5480
7 JGI25153J46596_10038385 3300003215 Bacteria 1510
8 JGI25404J52841_10004541 3300003659 Bacteria 2820
9 JGI25404J52841_10007823 3300003659 Bacteria 2268
10 Ga0070683_100007041 3300005329 Bacteria 9467
11 Ga0070683_100008603 3300005329 Bacteria 8674
12 Ga0068869_100048603 3300005334 Bacteria 3068
13 Ga0068869_100107060 3300005334 Bacteria 2122
14 Ga0068869_100195800 3300005334 Bacteria 1591
15 Ga0068869_100196491 3300005334 Bacteria 1589
16 Ga0070680_100029489 3300005336 Bacteria 4407
17 Ga0070680_100055643 3300005336 Bacteria 3233
18 Ga0070680_100198046 3300005336 Bacteria 1693
19 Ga0070682_100017196 3300005337 Bacteria 4213
20 Ga0068868_100088914 3300005338 Bacteria 2486
21 Ga0070687_100098603 3300005343 Bacteria 1631
22 Ga0070661_100079087 3300005344 Bacteria 2426
23 Ga0070668_100023548 3300005347 Bacteria 4658
24 Ga0070668_100032687 3300005347 Bacteria 3958
25 Ga0070669_100165144 3300005353 Bacteria 1723
26 Ga0070669_100173211 3300005353 Bacteria 1684
27 Ga0070675_100142451 3300005354 Bacteria 2050
28 Ga0070671_100105690 3300005355 Bacteria 2363
29 Ga0070674_100057177 3300005356 Bacteria 2707
30 Ga0070667_100081597 3300005367 Bacteria 2768
31 Ga0070709_10001264 3300005434 Bacteria 13842
32 Ga0070709_10004642 3300005434 Bacteria 7416
33 Ga0070714_100002981 3300005435 Bacteria 12546
34 Ga0070714_100053302 3300005435 Bacteria 3452
35 Ga0070714_100059779 3300005435 Bacteria 3269
36 Ga0070714_100089748 3300005435 Bacteria 2691
37 Ga0070713_100005695 3300005436 Bacteria 8553
38 Ga0070713_100010724 3300005436 Bacteria 6636
39 Ga0070713_100016387 3300005436 Bacteria 5572
40 Ga0070713_100037520 3300005436 Bacteria 3919
41 Ga0070713_100358267 3300005436 Bacteria 1355
42 Ga0070710_10007335 3300005437 Bacteria 5336
43 Ga0070711_100004753 3300005439 Bacteria 8045
44 Ga0070711_100007851 3300005439 Bacteria 6504
45 Ga0070711_100017321 3300005439 Bacteria 4585
46 Ga0070711_100177100 3300005439 Bacteria 1630
47 Ga0070663_100065957 3300005455 Bacteria 2622
48 Ga0070663_100086412 3300005455 Bacteria 2316
49 Ga0070663_100203386 3300005455 Bacteria 1546
50 Ga0070678_100050808 3300005456 Bacteria 3002
51 Ga0070678_100104077 3300005456 Bacteria 2207
52 Ga0070662_100163068 3300005457 Bacteria 1745
53 Ga0070681_10066471 3300005458 Bacteria 3574
54 Ga0070681_10410214 3300005458 Bacteria 1266
55 Ga0068867_100141540 3300005459 Bacteria 1881
56 Ga0070706_100135043 3300005467 Bacteria 2303
57 Ga0070679_100027886 3300005530 Bacteria 5563
58 Ga0070679_100041917 3300005530 Bacteria 4557
59 Ga0070679_100245808 3300005530 Bacteria 1746
60 Ga0070684_100009914 3300005535 Bacteria 7529
61 Ga0070684_100193719 3300005535 Bacteria 1850
62 Ga0070697_100083463 3300005536 Bacteria 2635
63 Ga0068853_100002706 3300005539 Bacteria 13372
64 Ga0070693_100133618 3300005547 Bacteria 1554
65 Ga0070665_100075383 3300005548 Bacteria 3380
66 Ga0070665_100236343 3300005548 Bacteria 1828
67 Ga0068855_100075938 3300005563 Bacteria 3900
68 Ga0068855_100107746 3300005563 Bacteria 3201
69 Ga0068857_100035560 3300005577 Bacteria 4411
70 Ga0068857_100048961 3300005577 Bacteria 3750
71 Ga0068856_100057701 3300005614 Bacteria 3833
72 Ga0068856_100235861 3300005614 Bacteria 1845
73 Ga0068856_100480108 3300005614 Bacteria 1264
74 Ga0070702_100091278 3300005615 Bacteria 1848
75 Ga0070702_100155465 3300005615 Bacteria 1473
76 Ga0068852_100211760 3300005616 Bacteria 1839
77 Ga0068852_100267801 3300005616 Bacteria 1643
78 Ga0068861_100315117 3300005719 Bacteria 1360
79 Ga0068851_10016664 3300005834 Bacteria 3520
80 Ga0068863_100098279 3300005841 Bacteria 2780
81 Ga0068863_100122754 3300005841 Bacteria 2478
82 Ga0068858_100079432 3300005842 Bacteria 3048
83 Ga0068858_100111317 3300005842 Bacteria 2557
84 Ga0068860_100001477 3300005843 Bacteria 25388
85 Ga0068860_100084034 3300005843 Bacteria 3028
86 Ga0068860_100103635 3300005843 Bacteria 2716
87 Ga0068862_100056605 3300005844 Bacteria 3360
88 Ga0068862_100102317 3300005844 Bacteria 2507
89 Ga0068862_100147743 3300005844 Bacteria 2090
90 Ga0068862_100221103 3300005844 Bacteria 1714
91 Ga0081455_10007096 3300005937 Bacteria 11872
92 Ga0081455_10031301 3300005937 Bacteria 4816
93 Ga0081540_1004669 3300005983 Bacteria 10365
94 Ga0081540_1010490 3300005983 Bacteria 6265
95 Ga0081540_1013940 3300005983 Bacteria 5190
96 Ga0081540_1016177 3300005983 Bacteria 4683
97 Ga0081540_1016835 3300005983 Bacteria 4554
98 Ga0081540_1027130 3300005983 Bacteria 3251
99 Ga0081539_10000250 3300005985 Bacteria 125352
100 Ga0081539_10000269 3300005985 Bacteria 119082
101 Ga0081539_10014715 3300005985 Bacteria 5755
102 Ga0070717_10009054 3300006028 Bacteria 7473
103 Ga0070717_10035629 3300006028 Bacteria 4030
104 Ga0075365_10038517 3300006038 Bacteria 3108
105 Ga0075368_10052921 3300006042 Bacteria 1615
106 Ga0075364_10048260 3300006051 Bacteria 2774
107 Ga0075364_10119230 3300006051 Bacteria 1765
108 Ga0070715_10001102 3300006163 Bacteria 7669
109 Ga0070716_100001236 3300006173 Bacteria 11263
110 Ga0070716_100184958 3300006173 Bacteria 1371
111 Ga0070712_100016683 3300006175 Bacteria 4746
112 Ga0070712_100018956 3300006175 Bacteria 4478
113 Ga0075362_10021993 3300006177 Bacteria 2683
114 Ga0075362_10106022 3300006177 Bacteria 1319
115 Ga0075367_10037947 3300006178 Bacteria 2802
116 Ga0075369_10009307 3300006186 Bacteria 3811
117 Ga0097621_100081902 3300006237 Bacteria 2687
118 Ga0075370_10012361 3300006353 Bacteria 4510
119 Ga0075370_10024305 3300006353 Bacteria 3346
120 Ga0068871_100145584 3300006358 Bacteria 2017
121 Ga0075428_100096612 3300006844 Bacteria 3220
122 Ga0075431_100031117 3300006847 Bacteria 5497
123 Ga0068865_100070716 3300006881 Bacteria 2473
124 Ga0068865_100161318 3300006881 Bacteria 1710
125 Ga0099822_1006648 3300006943 Bacteria 15036
126 Ga0075435_100215937 3300007076 Bacteria 1628
127 Ga0105250_10100738 3300009092 Bacteria 1178
128 Ga0105240_10001577 3300009093 Bacteria 38667
129 Ga0105240_10019439 3300009093 Bacteria 9075
130 Ga0105240_10038636 3300009093 Bacteria 6121
131 Ga0105240_10077635 3300009093 Bacteria 4091
132 Ga0105240_10083377 3300009093 Bacteria 3923
133 Ga0105240_10275483 3300009093 Bacteria 1936
134 Ga0111539_10124322 3300009094 Bacteria 3023
135 Ga0105245_10057612 3300009098 Bacteria 3495
136 Ga0105245_10303697 3300009098 Bacteria 1567
137 Ga0105245_10412134 3300009098 Bacteria 1353
138 Ga0105241_10027170 3300009174 Bacteria 4261
139 Ga0105241_10055509 3300009174 Bacteria 3035
140 Ga0105242_10083765 3300009176 Bacteria 2671
141 Ga0105248_10222326 3300009177 Bacteria 2126
142 Ga0105237_10004568 3300009545 Bacteria 15981
143 Ga0105237_10052370 3300009545 Bacteria 4097
144 Ga0105237_10078407 3300009545 Bacteria 3293
145 Ga0105237_10207078 3300009545 Bacteria 1962
146 Ga0105238_10005843 3300009551 Bacteria 12184
147 Ga0105238_10042779 3300009551 Bacteria 4585
148 Ga0105238_10158150 3300009551 Bacteria 2241
149 Ga0105238_10292870 3300009551 Bacteria 1610
150 Ga0105249_10074377 3300009553 Bacteria 3145
151 Ga0105239_10043422 3300010375 Bacteria 4927
152 Ga0157370_10055693 3300013104 Bacteria 3765
153 Ga0157369_10015838 3300013105 Bacteria 8493
154 Ga0157369_10023684 3300013105 Bacteria 6837
155 Ga0157378_10146201 3300013297 Bacteria 2199
156 Ga0163162_10065198 3300013306 Bacteria 3689
157 Ga0163162_10205737 3300013306 Bacteria 2097
158 Ga0163163_10165731 3300014325 Bacteria 2256
159 Ga0157380_10093575 3300014326 Bacteria 2485
160 Ga0157379_10072770 3300014968 Bacteria 3076
161 Ga0157376_10212548 3300014969 Bacteria 1787
162 Ga0163161_10117690 3300017792 Bacteria 1993
163 Ga0213871_10008001 3300021441 Bacteria 2312
164 Ga0209759_1015018 3300025256 Bacteria 2018
165 Ga0209675_1005427 3300025291 Bacteria 5341
166 Ga0209025_1000325 3300025294 Bacteria 106131
167 Ga0209758_1000060 3300025297 Bacteria 324326
168 Ga0209758_1036135 3300025297 Bacteria 1934
169 Ga0207692_10006316 3300025898 Bacteria 4803
170 Ga0207685_10005165 3300025905 Bacteria 3413
171 Ga0207699_10010444 3300025906 Bacteria 4661
172 Ga0207699_10019827 3300025906 Bacteria 3594
173 Ga0207643_10149714 3300025908 Bacteria 1398
174 Ga0207705_10070224 3300025909 Bacteria 2538
175 Ga0207684_10078276 3300025910 Bacteria 2812
176 Ga0207654_10038187 3300025911 Bacteria 2693
177 Ga0207654_10183683 3300025911 Bacteria 1366
178 Ga0207707_10000896 3300025912 Bacteria 29115
179 Ga0207707_10018267 3300025912 Bacteria 6113
180 Ga0207707_10035359 3300025912 Bacteria 4369
181 Ga0207695_10037684 3300025913 Bacteria 5215
182 Ga0207695_10048335 3300025913 Bacteria 4494
183 Ga0207695_10223334 3300025913 Bacteria 1790
184 Ga0207671_10023632 3300025914 Bacteria 4633
185 Ga0207671_10029052 3300025914 Bacteria 4131
186 Ga0207693_10007674 3300025915 Bacteria 8861
187 Ga0207693_10015377 3300025915 Bacteria 6141
188 Ga0207663_10000119 3300025916 Bacteria 38150
189 Ga0207663_10038439 3300025916 Bacteria 2893
190 Ga0207660_10055597 3300025917 Bacteria 2829
191 Ga0207662_10086981 3300025918 Bacteria 1916
192 Ga0207649_10035308 3300025920 Bacteria 3003
193 Ga0207652_10006082 3300025921 Bacteria 9767
194 Ga0207652_10013939 3300025921 Bacteria 6508
195 Ga0207652_10047431 3300025921 Bacteria 3669
196 Ga0207652_10051269 3300025921 Bacteria 3538
197 Ga0207681_10035228 3300025923 Bacteria 3297
198 Ga0207694_10002784 3300025924 Bacteria 14119
199 Ga0207694_10039037 3300025924 Bacteria 3652
200 Ga0207650_10329462 3300025925 Bacteria 1252
201 Ga0207659_10035019 3300025926 Bacteria 3467
202 Ga0207687_10077985 3300025927 Bacteria 2384
203 Ga0207700_10011329 3300025928 Bacteria 5680
204 Ga0207700_10016527 3300025928 Bacteria 4905
205 Ga0207700_10034662 3300025928 Bacteria 3626
206 Ga0207700_10125033 3300025928 Bacteria 2091
207 Ga0207700_10434293 3300025928 Bacteria 1155
208 Ga0207664_10051694 3300025929 Bacteria 3246
209 Ga0207664_10078812 3300025929 Bacteria 2673
210 Ga0207706_10075000 3300025933 Bacteria 2974
211 Ga0207686_10097031 3300025934 Bacteria 1960
212 Ga0207686_10302174 3300025934 Bacteria 1189
213 Ga0207709_10153309 3300025935 Bacteria 1598
214 Ga0207704_10133629 3300025938 Bacteria 1723
215 Ga0207665_10001615 3300025939 Bacteria 15213
216 Ga0207691_10083519 3300025940 Bacteria 2867
217 Ga0207711_10028910 3300025941 Bacteria 4670
218 Ga0207689_10026177 3300025942 Bacteria 4885
219 Ga0207689_10042287 3300025942 Bacteria 3770
220 Ga0207689_10107827 3300025942 Bacteria 2289
221 Ga0207661_10000890 3300025944 Bacteria 19612
222 Ga0207661_10113983 3300025944 Bacteria 2291
223 Ga0207679_10074549 3300025945 Bacteria 2572
224 Ga0207679_10265416 3300025945 Bacteria 1466
225 Ga0207667_10010705 3300025949 Bacteria 10701
226 Ga0207667_10094713 3300025949 Bacteria 3083
227 Ga0207712_10031219 3300025961 Bacteria 3586
228 Ga0207668_10025678 3300025972 Bacteria 3815
229 Ga0207668_10104149 3300025972 Bacteria 2114
230 Ga0207668_10290811 3300025972 Bacteria 1344
231 Ga0207668_10341797 3300025972 Bacteria 1248
232 Ga0207640_10079583 3300025981 Bacteria 2234
233 Ga0207658_10041738 3300025986 Bacteria 3324
234 Ga0207677_10011362 3300026023 Bacteria 5074
235 Ga0207677_10134518 3300026023 Bacteria 1883
236 Ga0207703_10073419 3300026035 Bacteria 2830
237 Ga0207639_10004965 3300026041 Bacteria 8962
238 Ga0207639_10062319 3300026041 Bacteria 2883
239 Ga0207678_10033152 3300026067 Bacteria 4500
240 Ga0207678_10043113 3300026067 Bacteria 3906
241 Ga0207678_10053913 3300026067 Bacteria 3464
242 Ga0207678_10058524 3300026067 Bacteria 3316
243 Ga0207678_10081953 3300026067 Bacteria 2761
244 Ga0207702_10240379 3300026078 Bacteria 1696
245 Ga0207641_10090731 3300026088 Bacteria 2673
246 Ga0207641_10285764 3300026088 Bacteria 1553
247 Ga0207641_10413999 3300026088 Bacteria 1297
248 Ga0207648_10018893 3300026089 Bacteria 6226
249 Ga0207674_10069521 3300026116 Bacteria 3541
250 Ga0207674_10207061 3300026116 Bacteria 1911
251 Ga0207675_100041173 3300026118 Bacteria 4314
252 Ga0207675_100160419 3300026118 Bacteria 2145
253 Ga0207683_10059656 3300026121 Bacteria 3351
254 Ga0207683_10077156 3300026121 Bacteria 2951
255 Ga0207683_10123805 3300026121 Bacteria 2322
256 Ga0207683_10201704 3300026121 Bacteria 1808
257 Ga0209589_1000023 3300027357 Bacteria 177856
258 Ga0209489_100032 3300027361 Bacteria 177856
259 Ga0209700_100040 3300027363 Bacteria 177856
260 Ga0268266_10017541 3300028379 Bacteria 6107
261 Ga0268266_10037391 3300028379 Bacteria 4136
262 Ga0268266_10083441 3300028379 Bacteria 2789
263 Ga0268265_10127116 3300028380 Bacteria 2111
264 Ga0268265_10177633 3300028380 Bacteria 1826
265 Ga0268264_10000022 3300028381 Bacteria 476624
266 Ga0268264_10164178 3300028381 Bacteria 2004
267 Ga0307517_10001054 3300028786 Bacteria 46731
268 Ga0307515_10000636 3300028794 Bacteria 81268
269 Ga0307515_10073774 3300028794 Bacteria 4578
270 Ga0307511_10030850 3300030521 Bacteria 4805
271 Ga0265320_10001870 3300031240 Bacteria 14890
272 Ga0265327_10007017 3300031251 Bacteria 8830
273 Ga0307513_10106065 3300031456 Bacteria 2817
274 Ga0307513_10321853 3300031456 Unclassified 1304
275 Ga0307509_10088835 3300031507 Bacteria 3171
276 Ga0307508_10076047 3300031616 Bacteria 2935
277 Ga0307508_10218956 3300031616 Bacteria 1504
278 Ga0265314_10011519 3300031711 Bacteria 7289
279 Ga0307516_10021897 3300031730 Bacteria 6567
280 Ga0307516_10023744 3300031730 Bacteria 6274
281 Ga0307516_10093568 3300031730 Bacteria 2831
282 Ga0307516_10094528 3300031730 Bacteria 2813
283 Ga0307411_10331360 3300032005 Bacteria 1233
284 Ga0307510_10031363 3300033180 Bacteria 6007
285 Ga0307510_10071226 3300033180 Bacteria 3464
286 Ga0315911_1000001 3300033442 Bacteria 1088602
287 Ga0373926_0078363 3300035083 Bacteria 1219
288 Ga0373954_0026894 3300035118 Bacteria 2639
289 Ga0373943_0004616 3300035170 Bacteria 6227
290 Ga0373943_0009069 3300035170 Bacteria 4460
291 Ga0373946_0010906 3300035171 Bacteria 3377
292 Ga0373955_0013494 3300035172 Bacteria 3953
293 Ga0373924_0008760 3300035410 Bacteria 3688
294 Ga0373924_0028357 3300035410 Bacteria 2231
295 Ga0373935_0001572 3300035692 Bacteria 12730
296 Ga0373935_0131583 3300035692 Bacteria 1681
297 Ga0373927_0000225 3300035695 Bacteria 44840
298 Ga0373927_0011961 3300035695 Bacteria 5774
299 Ga0373927_0058491 3300035695 Bacteria 2493
300 Ga0373927_0090907 3300035695 Bacteria 1982
301 Ga0373933_0099086 3300035724 Bacteria 1806
302 Ga0373947_0006620 3300035725 Bacteria 6726
303 Ga0373947_0058482 3300035725 Bacteria 2336
304 Ga0373947_0071092 3300035725 Bacteria 2134
305 Ga0373937_0031898 3300036401 Bacteria 4776
306 Ga0373937_0068786 3300036401 Bacteria 3264
307 Ga0373925_0021013 3300037068 Bacteria 4756
308 Ga0373925_0023528 3300037068 Bacteria 4495
309 Ga0373925_0187533 3300037068 Bacteria 1640
310 Ga0373925_0331030 3300037068 Bacteria 1234
311 Ga0395900_0021777 3300037418 Bacteria 6554
312 Ga0395898_0158318 3300037466 Bacteria 2166
313 Ga0395898_0494999 3300037466 Bacteria 1163
314 Ga0395905_0309058 3300037471 Bacteria 1469
315 Ga0436364_1479741 3300037853 Bacteria 1517
316 Ga0436360_1081800 3300039438 Bacteria 4526
317 Ga0466963_0073891 3300044694 Bacteria 2299
318 Ga0466957_0187227 3300044842 Bacteria 1354
319 Ga0466959_0017208 3300045049 Bacteria 5295
320 Ga0495617_012026 3300046452 Bacteria 2952
321 Ga0495592_0017565 3300046454 Bacteria 5437
322 Ga0495592_0144323 3300046454 Bacteria 1652
323 Ga0495603_0000979 3300046455 Bacteria 16459
324 Ga0495603_0007702 3300046455 Bacteria 6487
325 Ga0495603_0008232 3300046455 Bacteria 6301
326 Ga0495603_0013636 3300046455 Bacteria 4918
327 Ga0495603_0016041 3300046455 Bacteria 4528
328 Ga0495603_0018117 3300046455 Bacteria 4259
329 Ga0495603_0027555 3300046455 Bacteria 3428
330 Ga0495590_0040957 3300046457 Bacteria 1615
331 Ga0495629_0000179 3300046459 Bacteria 56885
332 Ga0495629_0003119 3300046459 Bacteria 12560
333 Ga0495638_0112414 3300046460 Bacteria 1616
334 Ga0495641_0003369 3300046461 Bacteria 11993
335 Ga0495650_0009048 3300046471 Bacteria 5714
336 Ga0495580_0000280 3300046472 Bacteria 41385
337 Ga0495580_0003054 3300046472 Bacteria 14336
338 Ga0495582_0000061 3300046473 Bacteria 55522
339 Ga0495605_0063923 3300046474 Bacteria 1754
340 Ga0495639_0000102 3300046475 Bacteria 42249
341 Ga0495639_0069681 3300046475 Bacteria 1622
342 Ga0495662_0000074 3300046476 Bacteria 35316
343 Ga0495664_0002543 3300046477 Bacteria 9805
344 Ga0495664_0015775 3300046477 Bacteria 4299
345 Ga0495584_0106303 3300046491 Bacteria 1419
346 Ga0495585_0083380 3300046492 Bacteria 1730
347 Ga0495594_0001268 3300046499 Bacteria 13196
348 Ga0495583_0010408 3300046506 Bacteria 5427
349 Ga0495606_0001785 3300046507 Bacteria 27439
350 Ga0495606_0070937 3300046507 Bacteria 2195
351 Ga0495606_0101957 3300046507 Bacteria 1746
352 Ga0495616_0012917 3300046513 Bacteria 4722
353 Ga0495618_0024078 3300046514 Bacteria 3768
354 Ga0495628_0098838 3300046516 Bacteria 2254
355 Ga0495630_0001199 3300046517 Bacteria 17892
356 Ga0495630_0047711 3300046517 Bacteria 3204
357 Ga0495630_0186201 3300046517 Bacteria 1584
358 Ga0495648_0052735 3300046524 Bacteria 2468
359 Ga0495666_0037846 3300046526 Bacteria 2346
360 Ga0495642_0097217 3300046528 Bacteria 1250
361 Ga0495652_0035071 3300046529 Bacteria 4367
362 Ga0495652_0126091 3300046529 Bacteria 2034
363 Ga0495665_0001933 3300046531 Bacteria 11181
364 Ga0495640_0010326 3300046533 Bacteria 7219
365 Ga0495640_0019162 3300046533 Bacteria 5054
366 Ga0495586_0021475 3300046535 Bacteria 3442
367 Ga0495586_0023410 3300046535 Bacteria 3299
368 Ga0495587_0201900 3300046536 Bacteria 1124
369 Ga0495609_0065341 3300046538 Bacteria 1604
370 Ga0495645_0002457 3300046543 Bacteria 12589
371 Ga0495645_0003310 3300046543 Bacteria 10916
372 Ga0495645_0161324 3300046543 Bacteria 1550
373 Ga0495622_0044015 3300046557 Bacteria 2075
374 Ga0495667_0011524 3300046559 Bacteria 5986
375 Ga0495667_0035341 3300046559 Bacteria 3340
376 Ga0495656_0018236 3300046615 Bacteria 2691
377 Ga0495656_0035019 3300046615 Bacteria 2060
378 Ga0495634_0000161 3300046642 Bacteria 60925
379 Ga0495635_0003296 3300046663 Bacteria 11153
380 Ga0495659_0073631 3300046664 Bacteria 1284
381 Ga0495588_0009563 3300046674 Bacteria 4486
382 Ga0495588_0034143 3300046674 Bacteria 2573
383 Ga0495588_0063424 3300046674 Bacteria 1916
384 Ga0495599_0030208 3300046678 Bacteria 3399
385 Ga0495646_0026646 3300046680 Bacteria 3629
386 Ga0495647_0001722 3300046681 Bacteria 6782
387 Ga0495647_0003514 3300046681 Bacteria 5017
388 Ga0495658_0000315 3300046683 Bacteria 27478
389 Ga0495613_0009584 3300046689 Bacteria 7195
390 Ga0495613_0068514 3300046689 Bacteria 2588
391 Ga0495649_0143650 3300046694 Bacteria 1255
392 Ga0495581_0000918 3300047315 Bacteria 15788
393 Ga0495581_0014764 3300047315 Bacteria 4531
394 Ga0495636_0026391 3300047318 Bacteria 2363
395 Ga0495674_0000117 3300047319 Bacteria 60130
396 Ga0495674_0007336 3300047319 Bacteria 10539
397 Ga0495676_0002643 3300047321 Bacteria 16024
398 Ga0495683_0002636 3300047323 Bacteria 10716
399 Ga0495675_0145584 3300047444 Bacteria 1466
400 Ga0495684_0013860 3300047471 Bacteria 6201
401 Ga0495593_0000086 3300047673 Bacteria 40986
402 Ga0495593_0069308 3300047673 Bacteria 1834
403 Ga0495614_0011012 3300048089 Bacteria 3980
404 Ga0496100_0126057 3300048903 Bacteria 1797
405 Ga0496101_0291517 3300048904 Bacteria 1277
406 Ga0496102_0219913 3300048905 Bacteria 1790
407 Ga0496102_0220772 3300048905 Bacteria 1787
408 Ga0496102_0248720 3300048905 Bacteria 1676
409 Ga0496103_0027533 3300048906 Bacteria 3445
410 Ga0496104_0061731 3300048907 Bacteria 3553
411 Ga0496105_0033780 3300048908 Bacteria 4203
412 Ga0496105_0080800 3300048908 Bacteria 2685
413 Ga0496106_0004564 3300048909 Bacteria 10267
414 Ga0496106_0019045 3300048909 Bacteria 5088
415 Ga0496106_0040371 3300048909 Bacteria 3495
416 Ga0496106_0118619 3300048909 Bacteria 2066
417 Ga0496106_0124671 3300048909 Bacteria 2016
418 Ga0496107_0134707 3300048910 Bacteria 1825
419 Ga0496108_0052161 3300048911 Bacteria 3427
420 Ga0496109_0058239 3300048912 Bacteria 3529
421 Ga0496110_0462144 3300048913 Bacteria 1157
422 Ga0496112_0000067 3300048915 Bacteria 68767
423 Ga0496112_0011424 3300048915 Bacteria 8108
424 Ga0496112_0028943 3300048915 Bacteria 5354
425 Ga0496113_0000967 3300048916 Bacteria 15283
426 Ga0496113_0044789 3300048916 Bacteria 3279
427 Ga0496114_0063218 3300048917 Bacteria 3099
428 Ga0496114_0204690 3300048917 Bacteria 1729
429 Ga0496115_0078244 3300048918 Bacteria 2690
430 Ga0496115_0180007 3300048918 Bacteria 1748
431 Ga0496116_0041215 3300048919 Bacteria 3170
432 Ga0496118_0006552 3300048921 Bacteria 12733
433 Ga0496121_0000576 3300048924 Bacteria 69005
434 Ga0496121_0007183 3300048924 Bacteria 13491
435 Ga0496121_0032853 3300048924 Bacteria 4708
436 Ga0496121_0039386 3300048924 Bacteria 4166
437 Ga0496121_0082857 3300048924 Bacteria 2534
438 Ga0496121_0098708 3300048924 Bacteria 2259
439 Ga0496121_0135527 3300048924 Bacteria 1835
440 Ga0496122_0117923 3300048925 Bacteria 1722
441 Ga0496123_0029826 3300048926 Bacteria 4005
442 Ga0496124_0003339 3300048927 Bacteria 19760
443 Ga0496124_0234304 3300048927 Bacteria 1370
444 Ga0496125_0136940 3300048928 Bacteria 1711
445 Ga0496126_0004944 3300048929 Bacteria 15539
446 Ga0496126_0013155 3300048929 Bacteria 8438
447 Ga0496126_0025255 3300048929 Bacteria 5720
448 Ga0496126_0039062 3300048929 Bacteria 4408
449 Ga0496126_0069708 3300048929 Bacteria 3135
450 Ga0496126_0071462 3300048929 Bacteria 3089
451 Ga0501039_0086894 3300049575 Bacteria 2436
452 Ga0501039_0283794 3300049575 Bacteria 1301
453 Ga0501042_0163704 3300049578 Bacteria 1605
454 Ga0501046_0144198 3300049580 Bacteria 1800
455 Ga0501047_0077975 3300049581 Bacteria 3186
456 Ga0501047_0343389 3300049581 Bacteria 1330
457 Ga0501071_0321204 3300049587 Bacteria 1176
458 Ga0501073_0026289 3300049589 Bacteria 4170
459 Ga0501074_0057717 3300049590 Bacteria 2796
460 Ga0501080_0037943 3300049742 Bacteria 4499
461 Ga0501083_0087869 3300049744 Bacteria 2055
462 Ga0501035_0125999 3300049822 Bacteria 2236
463 nmdc:mga03683_16312_c1 3300050489 Bacteria 2788
464 nmdc:mga00v17_139988_c1 3300050491 Bacteria 1551
465 nmdc:mga00v17_83781_c1 3300050491 Bacteria 1995
466 nmdc:mga0k408_115129_c1 3300050493 Bacteria 1591
467 nmdc:mga06z11_30933_c1 3300050494 Bacteria 2595
468 nmdc:mga04h51_50875_c1 3300050495 Bacteria 1390
469 nmdc:mga07m45_31978_c1 3300050496 Bacteria 2917
470 nmdc:mga07m45_36085_c1 3300050496 Bacteria 2752
471 nmdc:mga06r32_28100_c1 3300050510 Bacteria 5260
472 nmdc:mga0n895_194196_c1 3300050512 Bacteria 2061
473 nmdc:mga0n895_40378_c1 3300050512 Bacteria 4532
474 nmdc:mga0rr50_17104_c1 3300050513 Bacteria 4831
475 nmdc:mga0sz30_14479_c1 3300050516 Bacteria 3106
476 Ga0495612_0009682 3300053078 Bacteria 3903
477 Ga0495619_0055590 3300053085 Bacteria 2622
478 Ga0495619_0068850 3300053085 Bacteria 2365
479 Ga0500643_046831 3300053087 Bacteria 1248
480 Ga0500646_0022057 3300053090 Bacteria 1701
481 Ga0500583_0075511 3300053092 Bacteria 1619
482 Ga0500651_0000540 3300053093 Bacteria 19274
483 Ga0500641_0005982 3300053096 Bacteria 4306
484 Ga0500554_005539 3300053102 Bacteria 2763
485 Ga0500555_002691 3300053103 Bacteria 5122
486 Ga0500555_030649 3300053103 Bacteria 1526
487 Ga0500572_000582 3300053111 Bacteria 12422
488 Ga0500595_001090 3300053119 Bacteria 15074
489 Ga0500607_028559 3300053121 Bacteria 3088
490 Ga0500658_0108519 3300053134 Bacteria 1219
491 Ga0500559_0001841 3300053136 Bacteria 11563
492 Ga0500559_0005881 3300053136 Bacteria 5589
493 Ga0500573_0006528 3300053140 Bacteria 6323
494 Ga0500577_0051209 3300053142 Bacteria 1552
495 Ga0500589_050511 3300053147 Bacteria 1930
496 Ga0500590_019493 3300053148 Bacteria 3515
497 Ga0500603_000291 3300053150 Bacteria 13250
498 Ga0500622_0041694 3300053156 Bacteria 2388
499 Ga0500627_0068485 3300053158 Bacteria 1569
500 Ga0500634_0092964 3300053161 Bacteria 1526
501 Ga0500638_114909 3300053162 Bacteria 1239
502 Ga0500639_033713 3300053163 Bacteria 2706
503 Ga0500636_0057050 3300053177 Bacteria 2286
504 Ga0500637_0039640 3300053178 Bacteria 2657
505 Ga0500609_002798 3300053731 Bacteria 2485
506 Ga0500596_002419 3300053735 Bacteria 3681
507 2509147244 2508501128 Bacteria 8613869
508 2513656666 2513237096 Bacteria 8722461
509 2513672300 2513237098 Bacteria 9902361
510 2513691818 2513237101 Bacteria 7952346
511 2513858542 2513237137 Bacteria 9558895
512 2513889218 2513237141 Bacteria 8496279
513 2513917851 2513237145 Bacteria 8979722
514 2517893101 2517572143 Bacteria 9484767
515 2524466896 2524023210 Bacteria 9029266
516 2563056122 2562617112 Bacteria 10918404
517 2644325200 2643221658 Bacteria 6064537
518 2671117726 2667528175 Bacteria 7532676
519 2713481770 2711768613 Bacteria 11048459
520 2723845779 2721755755 Bacteria 8322773
521 2728753206 2728368998 Bacteria 8720350
522 2793070031 2791355197 Bacteria 8420563
523 2793077245
524 2874609580 2874604998 Bacteria 7834745
525 2876810919 2876808645 Bacteria 8824342
526 2879115646 2879110137 Bacteria 8907982
527 2883095913 2883087390 Bacteria 9532701
528 2885392688 2885383462 Bacteria 9473874
529 2889040604 2889033259 Bacteria 9099371
530 2903753033 2903748898 Bacteria 9972761
531 2903772748 2903768456 Bacteria 9749579
532 2904548937 2904541872 Bacteria 8915136
533 2904696556 2904690495 Bacteria 9412302
534 2904702534
535 2906640726 2906635258 Bacteria 8601019
536 2906661388 2906660503 Bacteria 8595048
537 2908743495 2908739725 Bacteria 8628932
538 2908760410 2908756301 Bacteria 8864324
539 2922367725 2922361189 Bacteria 7436256
540 2922392381 2922386360 Bacteria 7017218
541 2929160944 2929160207 Bacteria 9075316
542 2935633736 2935630451 Bacteria 8169952
543 2939634465 2939631187 Bacteria 6118131
544 2941510627 2941507105 Bacteria 8166816
545 2941517634 2941515067 Bacteria 8166720
546 2941525651 2941523033 Bacteria 8169134
547 3005479555 3005474847 Bacteria 9259049
548 8006941575 8006933436 Bacteria 10410654
549 8006981285 8006973647 Bacteria 10679141
550 8006988118 8006984368 Bacteria 9651211
551 8007001505 8006994254 Bacteria 8309700
552 8056674530 8056673599 Bacteria 7871253
553 8056690197 8056689827 Bacteria 6712655
554 Ga0500641_0010007
555 JGI25151J46595_10001974
556 JGI25406J46586_10000094
557 JGI25406J46586_10003160
558 JGI25153J46596_10000149
559 JGI25153J46596_10007264
560 JGI25153J46596_10038385
561 JGI25404J52841_10004541
562 JGI25404J52841_10007823
563 Ga0070683_100007041
564 Ga0070683_100008603
565 Ga0068869_100048603
566 Ga0068869_100107060
567 Ga0068869_100195800
568 Ga0068869_100196491
569 Ga0070680_100029489
570 Ga0070680_100055643
571 Ga0070680_100198046
572 Ga0070682_100017196
573 Ga0068868_100088914
574 Ga0070687_100098603
575 Ga0070661_100079087
576 Ga0070668_100023548
577 Ga0070668_100032687
578 Ga0070669_100165144
579 Ga0070669_100173211
580 Ga0070675_100142451
581 Ga0070671_100105690
582 Ga0070674_100057177
583 Ga0070667_100081597
584 Ga0070709_10001264
585 Ga0070709_10004642
586 Ga0070714_100002981
587 Ga0070714_100053302
588 Ga0070714_100059779
589 Ga0070714_100089748
590 Ga0070713_100005695
591 Ga0070713_100010724
592 Ga0070713_100016387
593 Ga0070713_100037520
594 Ga0070713_100358267
595 Ga0070710_10007335
596 Ga0070711_100004753
597 Ga0070711_100007851
598 Ga0070711_100017321
599 Ga0070711_100177100
600 Ga0070663_100065957
601 Ga0070663_100086412
602 Ga0070663_100203386
603 Ga0070678_100050808
604 Ga0070678_100104077
605 Ga0070662_100163068
606 Ga0070681_10066471
607 Ga0070681_10410214
608 Ga0068867_100141540
609 Ga0070706_100135043
610 Ga0070679_100027886
611 Ga0070679_100041917
612 Ga0070679_100245808
613 Ga0070684_100009914
614 Ga0070684_100193719
615 Ga0070697_100083463
616 Ga0068853_100002706
617 Ga0070693_100133618
618 Ga0070665_100075383
619 Ga0070665_100236343
620 Ga0068855_100075938
621 Ga0068855_100107746
622 Ga0068857_100035560
623 Ga0068857_100048961
624 Ga0068856_100057701
625 Ga0068856_100235861
626 Ga0068856_100480108
627 Ga0070702_100091278
628 Ga0070702_100155465
629 Ga0068852_100211760
630 Ga0068852_100267801
631 Ga0068861_100315117
632 Ga0068851_10016664
633 Ga0068863_100098279
634 Ga0068863_100122754
635 Ga0068858_100079432
636 Ga0068858_100111317
637 Ga0068860_100001477
638 Ga0068860_100084034
639 Ga0068860_100103635
640 Ga0068862_100056605
641 Ga0068862_100102317
642 Ga0068862_100147743
643 Ga0068862_100221103
644 Ga0081455_10007096
645 Ga0081455_10031301
646 Ga0081540_1004669
647 Ga0081540_1010490
648 Ga0081540_1013940
649 Ga0081540_1016177
650 Ga0081540_1016835
651 Ga0081540_1027130
652 Ga0081539_10000250
653 Ga0081539_10000269
654 Ga0081539_10014715
655 Ga0070717_10009054
656 Ga0070717_10035629
657 Ga0075365_10038517
658 Ga0075368_10052921
659 Ga0075364_10048260
660 Ga0075364_10119230
661 Ga0070715_10001102
662 Ga0070716_100001236
663 Ga0070716_100184958
664 Ga0070712_100016683
665 Ga0070712_100018956
666 Ga0075362_10021993
667 Ga0075362_10106022
668 Ga0075367_10037947
669 Ga0075369_10009307
670 Ga0097621_100081902
671 Ga0075370_10012361
672 Ga0075370_10024305
673 Ga0068871_100145584
674 Ga0075428_100096612
675 Ga0075431_100031117
676 Ga0068865_100070716
677 Ga0068865_100161318
678 Ga0099822_1006648
679 Ga0075435_100215937
680 Ga0105250_10100738
681 Ga0105240_10001577
682 Ga0105240_10019439
683 Ga0105240_10038636
684 Ga0105240_10077635
685 Ga0105240_10083377
686 Ga0105240_10275483
687 Ga0111539_10124322
688 Ga0105245_10057612
689 Ga0105245_10303697
690 Ga0105245_10412134
691 Ga0105241_10027170
692 Ga0105241_10055509
693 Ga0105242_10083765
694 Ga0105248_10222326
695 Ga0105237_10004568
696 Ga0105237_10052370
697 Ga0105237_10078407
698 Ga0105237_10207078
699 Ga0105238_10005843
700 Ga0105238_10042779
701 Ga0105238_10158150
702 Ga0105238_10292870
703 Ga0105249_10074377
704 Ga0105239_10043422
705 Ga0157370_10055693
706 Ga0157369_10015838
707 Ga0157369_10023684
708 Ga0157378_10146201
709 Ga0163162_10065198
710 Ga0163162_10205737
711 Ga0163163_10165731
712 Ga0157380_10093575
713 Ga0157379_10072770
714 Ga0157376_10212548
715 Ga0163161_10117690
716 Ga0213871_10008001
717 Ga0209759_1015018
718 Ga0209675_1005427
719 Ga0209025_1000325
720 Ga0209758_1000060
721 Ga0209758_1036135
722 Ga0207692_10006316
723 Ga0207685_10005165
724 Ga0207699_10010444
725 Ga0207699_10019827
726 Ga0207643_10149714
727 Ga0207705_10070224
728 Ga0207684_10078276
729 Ga0207654_10038187
730 Ga0207654_10183683
731 Ga0207707_10000896
732 Ga0207707_10018267
733 Ga0207707_10035359
734 Ga0207695_10037684
735 Ga0207695_10048335
736 Ga0207695_10223334
737 Ga0207671_10023632
738 Ga0207671_10029052
739 Ga0207693_10007674
740 Ga0207693_10015377
741 Ga0207663_10000119
742 Ga0207663_10038439
743 Ga0207660_10055597
744 Ga0207662_10086981
745 Ga0207649_10035308
746 Ga0207652_10006082
747 Ga0207652_10013939
748 Ga0207652_10047431
749 Ga0207652_10051269
750 Ga0207681_10035228
751 Ga0207694_10002784
752 Ga0207694_10039037
753 Ga0207650_10329462
754 Ga0207659_10035019
755 Ga0207687_10077985
756 Ga0207700_10011329
757 Ga0207700_10016527
758 Ga0207700_10034662
759 Ga0207700_10125033
760 Ga0207700_10434293
761 Ga0207664_10051694
762 Ga0207664_10078812
763 Ga0207706_10075000
764 Ga0207686_10097031
765 Ga0207686_10302174
766 Ga0207709_10153309
767 Ga0207704_10133629
768 Ga0207665_10001615
769 Ga0207691_10083519
770 Ga0207711_10028910
771 Ga0207689_10026177
772 Ga0207689_10042287
773 Ga0207689_10107827
774 Ga0207661_10000890
775 Ga0207661_10113983
776 Ga0207679_10074549
777 Ga0207679_10265416
778 Ga0207667_10010705
779 Ga0207667_10094713
780 Ga0207712_10031219
781 Ga0207668_10025678
782 Ga0207668_10104149
783 Ga0207668_10290811
784 Ga0207668_10341797
785 Ga0207640_10079583
786 Ga0207658_10041738
787 Ga0207677_10011362
788 Ga0207677_10134518
789 Ga0207703_10073419
790 Ga0207639_10004965
791 Ga0207639_10062319
792 Ga0207678_10033152
793 Ga0207678_10043113
794 Ga0207678_10053913
795 Ga0207678_10058524
796 Ga0207678_10081953
797 Ga0207702_10240379
798 Ga0207641_10090731
799 Ga0207641_10285764
800 Ga0207641_10413999
801 Ga0207648_10018893
802 Ga0207674_10069521
803 Ga0207674_10207061
804 Ga0207675_100041173
805 Ga0207675_100160419
806 Ga0207683_10059656
807 Ga0207683_10077156
808 Ga0207683_10123805
809 Ga0207683_10201704
810 Ga0209589_1000023
811 Ga0209489_100032
812 Ga0209700_100040
813 Ga0268266_10017541
814 Ga0268266_10037391
815 Ga0268266_10083441
816 Ga0268265_10127116
817 Ga0268265_10177633
818 Ga0268264_10000022
819 Ga0268264_10164178
820 Ga0307517_10001054
821 Ga0307515_10000636
822 Ga0307515_10073774
823 Ga0307511_10030850
824 Ga0265320_10001870
825 Ga0265327_10007017
826 Ga0307513_10106065
827 Ga0307513_10321853
828 Ga0307509_10088835
829 Ga0307508_10076047
830 Ga0307508_10218956
831 Ga0265314_10011519
832 Ga0307516_10021897
833 Ga0307516_10023744
834 Ga0307516_10093568
835 Ga0307516_10094528
836 Ga0307411_10331360
837 Ga0307510_10031363
838 Ga0307510_10071226
839 Ga0315911_1000001
840 Ga0373926_0078363
841 Ga0373954_0026894
842 Ga0373943_0004616
843 Ga0373943_0009069
844 Ga0373946_0010906
845 Ga0373955_0013494
846 Ga0373924_0008760
847 Ga0373924_0028357
848 Ga0373935_0001572
849 Ga0373935_0131583
850 Ga0373927_0000225
851 Ga0373927_0011961
852 Ga0373927_0058491
853 Ga0373927_0090907
854 Ga0373933_0099086
855 Ga0373947_0006620
856 Ga0373947_0058482
857 Ga0373947_0071092
858 Ga0373937_0031898
859 Ga0373937_0068786
860 Ga0373925_0021013
861 Ga0373925_0023528
862 Ga0373925_0187533
863 Ga0373925_0331030
864 Ga0395900_0021777
865 Ga0395898_0158318
866 Ga0395898_0494999
867 Ga0395905_0309058
868 Ga0436364_1479741
869 Ga0436360_1081800
870 Ga0466963_0073891
871 Ga0466957_0187227
872 Ga0466959_0017208
873 Ga0495617_012026
874 Ga0495592_0017565
875 Ga0495592_0144323
876 Ga0495603_0000979
877 Ga0495603_0007702
878 Ga0495603_0008232
879 Ga0495603_0013636
880 Ga0495603_0016041
881 Ga0495603_0018117
882 Ga0495603_0027555
883 Ga0495590_0040957
884 Ga0495629_0000179
885 Ga0495629_0003119
886 Ga0495638_0112414
887 Ga0495641_0003369
888 Ga0495650_0009048
889 Ga0495580_0000280
890 Ga0495580_0003054
891 Ga0495582_0000061
892 Ga0495605_0063923
893 Ga0495639_0000102
894 Ga0495639_0069681
895 Ga0495662_0000074
896 Ga0495664_0002543
897 Ga0495664_0015775
898 Ga0495584_0106303
899 Ga0495585_0083380
900 Ga0495594_0001268
901 Ga0495583_0010408
902 Ga0495606_0001785
903 Ga0495606_0070937
904 Ga0495606_0101957
905 Ga0495616_0012917
906 Ga0495618_0024078
907 Ga0495628_0098838
908 Ga0495630_0001199
909 Ga0495630_0047711
910 Ga0495630_0186201
911 Ga0495648_0052735
912 Ga0495666_0037846
913 Ga0495642_0097217
914 Ga0495652_0035071
915 Ga0495652_0126091
916 Ga0495665_0001933
917 Ga0495640_0010326
918 Ga0495640_0019162
919 Ga0495586_0021475
920 Ga0495586_0023410
921 Ga0495587_0201900
922 Ga0495609_0065341
923 Ga0495645_0002457
924 Ga0495645_0003310
925 Ga0495645_0161324
926 Ga0495622_0044015
927 Ga0495667_0011524
928 Ga0495667_0035341
929 Ga0495656_0018236
930 Ga0495656_0035019
931 Ga0495634_0000161
932 Ga0495635_0003296
933 Ga0495659_0073631
934 Ga0495588_0009563
935 Ga0495588_0034143
936 Ga0495588_0063424
937 Ga0495599_0030208
938 Ga0495646_0026646
939 Ga0495647_0001722
940 Ga0495647_0003514
941 Ga0495658_0000315
942 Ga0495613_0009584
943 Ga0495613_0068514
944 Ga0495649_0143650
945 Ga0495581_0000918
946 Ga0495581_0014764
947 Ga0495636_0026391
948 Ga0495674_0000117
949 Ga0495674_0007336
950 Ga0495676_0002643
951 Ga0495683_0002636
952 Ga0495675_0145584
953 Ga0495684_0013860
954 Ga0495593_0000086
955 Ga0495593_0069308
956 Ga0495614_0011012
957 Ga0496100_0126057
958 Ga0496101_0291517
959 Ga0496102_0219913
960 Ga0496102_0220772
961 Ga0496102_0248720
962 Ga0496103_0027533
963 Ga0496104_0061731
964 Ga0496105_0033780
965 Ga0496105_0080800
966 Ga0496106_0004564
967 Ga0496106_0019045
968 Ga0496106_0040371
969 Ga0496106_0118619
970 Ga0496106_0124671
971 Ga0496107_0134707
972 Ga0496108_0052161
973 Ga0496109_0058239
974 Ga0496110_0462144
975 Ga0496112_0000067
976 Ga0496112_0011424
977 Ga0496112_0028943
978 Ga0496113_0000967
979 Ga0496113_0044789
980 Ga0496114_0063218
981 Ga0496114_0204690
982 Ga0496115_0078244
983 Ga0496115_0180007
984 Ga0496116_0041215
985 Ga0496118_0006552
986 Ga0496121_0000576
987 Ga0496121_0007183
988 Ga0496121_0032853
989 Ga0496121_0039386
990 Ga0496121_0082857
991 Ga0496121_0098708
992 Ga0496121_0135527
993 Ga0496122_0117923
994 Ga0496123_0029826
995 Ga0496124_0003339
996 Ga0496124_0234304
997 Ga0496125_0136940
998 Ga0496126_0004944
999 Ga0496126_0013155
1000 Ga0496126_0025255
1001 Ga0496126_0039062
1002 Ga0496126_0069708
1003 Ga0496126_0071462
1004 Ga0501039_0086894
1005 Ga0501039_0283794
1006 Ga0501042_0163704
1007 Ga0501046_0144198
1008 Ga0501047_0077975
1009 Ga0501047_0343389
1010 Ga0501071_0321204
1011 Ga0501073_0026289
1012 Ga0501074_0057717
1013 Ga0501080_0037943
1014 Ga0501083_0087869
1015 Ga0501035_0125999
1016 nmdc:mga03683_16312_c1
1017 nmdc:mga00v17_139988_c1
1018 nmdc:mga00v17_83781_c1
1019 nmdc:mga0k408_115129_c1
1020 nmdc:mga06z11_30933_c1
1021 nmdc:mga04h51_50875_c1
1022 nmdc:mga07m45_31978_c1
1023 nmdc:mga07m45_36085_c1
1024 nmdc:mga06r32_28100_c1
1025 nmdc:mga0n895_194196_c1
1026 nmdc:mga0n895_40378_c1
1027 nmdc:mga0rr50_17104_c1
1028 nmdc:mga0sz30_14479_c1
1029 Ga0495612_0009682
1030 Ga0495619_0055590
1031 Ga0495619_0068850
1032 Ga0500643_046831
1033 Ga0500646_0022057
1034 Ga0500583_0075511
1035 Ga0500651_0000540
1036 Ga0500641_0005982
1037 Ga0500554_005539
1038 Ga0500555_002691
1039 Ga0500555_030649
1040 Ga0500572_000582
1041 Ga0500595_001090
1042 Ga0500607_028559
1043 Ga0500658_0108519
1044 Ga0500559_0001841
1045 Ga0500559_0005881
1046 Ga0500573_0006528
1047 Ga0500577_0051209
1048 Ga0500589_050511
1049 Ga0500590_019493
1050 Ga0500603_000291
1051 Ga0500622_0041694
1052 Ga0500627_0068485
1053 Ga0500634_0092964
1054 Ga0500638_114909
1055 Ga0500639_033713
1056 Ga0500636_0057050
1057 Ga0500637_0039640
1058 Ga0500609_002798
1059 Ga0500596_002419
1060 2509147244
1061 2513656666
1062 2513672300
1063 2513691818
1064 2513858542
1065 2513889218
1066 2513917851
1067 2517893101
1068 2524466896
1069 2563056122
1070 2644325200
1071 2671117726
1072 2713481770
1073 2723845779
1074 2728753206
1075 2793070031
1076 2793077245
1077 2874609580
1078 2876810919
1079 2879115646
1080 2883095913
1081 2885392688
1082 2889040604
1083 2903753033
1084 2903772748
1085 2904548937
1086 2904696556
1087 2904702534
1088 2906640726
1089 2906661388
1090 2908743495
1091 2908760410
1092 2922367725
1093 2922392381
1094 2929160944
1095 2935633736
1096 2939634465
1097 2941510627
1098 2941517634
1099 2941525651
1100 3005479555
1101 8006941575
1102 8006981285
1103 8006988118
1104 8007001505
1105 8056674530
1106 8056690197

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13378

MR_MLE_C

Enolase C-terminal domain-like

150

354

0.96

PF02746

MR_MLE_N

Mandelate racemase / muconate lactonizing enzyme, N-terminal domain

8

130

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
1dtn-assembly1.cif.gz_A mandelate racemase mutant d270n co-crystallized with (s)-atrolactate 0.9915 9 364
1mra-assembly1.cif.gz_A mandelate racemase mutant d270n co-crystallized with (s)-atrolactate 0.9909 9 364
4fp1-assembly1.cif.gz_A p. putida mandelate racemase co-crystallized with 3,3,3-trifluoro-2-hydroxy-2-(trifluoromethyl) propionic acid 0.9898 9 364
4hnc-assembly1.cif.gz_B p. putida c92s/k166c/c264s mandelate racemase co-crystallized with benzilic acid 0.9884 9 364
1dtn-assembly1.cif.gz_A mandelate racemase mutant d270n co-crystallized with (s)-atrolactate 0.986 9 364
ID Description Score Start End Superfamily
3uxlA02 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Enolase-like C-terminal domain 0.9897 127 354 3.20.20.120
3toyD01 Alpha Beta;2-Layer Sandwich;Enolase-like; domain 1;Enolase-like, N-terminal domain 0.985 9 122 3.30.390.10
4fp1B01 Alpha Beta;2-Layer Sandwich;Enolase-like; domain 1;Enolase-like, N-terminal domain 0.9831 9 124 3.30.390.10
3uxlA02 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Enolase-like C-terminal domain 0.9769 127 354 3.20.20.120
3toyC02 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Enolase-like C-terminal domain 0.9586 127 355 3.20.20.120
ID Description Score Start End GO Terms
AF-A0A1F4H331-F1-model_v4 deleted 0.9979 9 364
AF-A0A1F4H331-F1-model_v4 deleted 0.9896 9 364
AF-A0A849EB74-F1-model_v4 Mandelate racemase 0.988 10 364 GO:0000287
GO:0016052
GO:0016836
AF-A0A5C8P5A4-F1-model_v4 Mandelate racemase 0.9877 10 364 GO:0000287
GO:0009063
GO:0016052
GO:0016836
AF-A0A2E1TIT6-F1-model_v4 Mandelate racemase 0.9858 7 364 GO:0000287
GO:0009063
GO:0016052
GO:0016836

Map