F462929
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 553 | 351 | 1106 | 360 |
Family's Representative Sequence
| Representative Sequence | 3300053096|Ga0500641_0010007|Ga0500641_0010007_508_1821 |
| Length | 437 |
| Sequence | MSKPVPAIRSVKARGVVVPLARPVKTAFGVIDVGPLVLIDVETDQGVTGHSYILAYARLTLKPLMHLVEEIGRELTGRPIAPYDLMAAMDAKFRLLGWQGLVGMAVSGLDMAYWDALGQIAGRPVAELLGGSAKPIRAYDSYGVVDPVSDEKALRRSLDQGFRGIKIKGGDGDAANDERVVKGVRALLGPDIALMIDFNQSLDPAEAARRIARLEPYDLHWIEEPVPQENLSGHAKVRETSPTPIQAGENWWFPRGFAEAIEAGASDFIMPDLMKCGGVTGWLQVAAQAEAANIPMSSHLFAEASAHMLAVTPTAHWLEFLDFASVILAHPADIVDGAVTARGPGLGLEWNEAAVAKYLVGSRVALRARPEIARVRFFLFIAGTVGFLDERKTPRFVKAPRSQIALKRPELEAIAHALWDLQQLAADAAPLHFRQHI |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 2 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 3 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 4 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 5 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 6 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 7 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 8 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 9 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 10 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 11 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 12 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 20 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 22 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 23 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 28 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 29 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 30 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 31 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 32 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 33 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 34 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 37 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 38 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 39 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 41 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 42 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 43 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 44 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 45 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 46 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 47 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 48 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 49 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 50 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 52 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 53 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 54 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 55 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 56 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 57 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 58 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 59 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 60 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 61 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 62 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 63 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 64 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 65 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 66 | 3300006943 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW | Metagenome | Nodule |
| 67 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 68 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 69 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 70 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 80 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 81 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Metagenome | Rhizosphere |
| 89 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 90 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 91 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 92 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 93 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300027357 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 142 | 3300027361 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 143 | 3300027363 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 144 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 148 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 149 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 150 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 151 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 152 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 153 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 154 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 155 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 156 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 157 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 158 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 159 | 3300033442 | Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 | Metagenome | Nodule |
| 160 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 161 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 162 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 163 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 164 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 165 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 166 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 167 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 168 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 169 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 170 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 171 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 172 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 173 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 174 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 175 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 176 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 177 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 178 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 179 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 180 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 236 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 237 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 238 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 239 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 240 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 241 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 242 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 243 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 244 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 245 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 246 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 247 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 248 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 249 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 250 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 251 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 252 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 253 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 254 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 255 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 256 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 257 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 258 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 259 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 260 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 261 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 262 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 263 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 264 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 265 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 266 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 267 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 268 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 269 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 270 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 271 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 272 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 273 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 274 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 275 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 276 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 277 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 278 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 281 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 282 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 283 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 284 | 3300053102 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere | Metagenome | Endosphere |
| 285 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 286 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 287 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 288 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 289 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 290 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 291 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 292 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 293 | 3300053147 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere | Metagenome | Endosphere |
| 294 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 295 | 3300053150 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere | Metagenome | Endosphere |
| 296 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 297 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 298 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 299 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 300 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 301 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 302 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 303 | 3300053731 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere | Metagenome | Endosphere |
| 304 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
| 305 | 2508501128 | Bradyrhizobium sp. ARR65 | Isolate | Nodule |
| 306 | 2513237096 | Bradyrhizobium pachyrhizi USDA 3259 | Isolate | Nodule |
| 307 | 2513237098 | Bradyrhizobium elkanii WSM2783 | Isolate | Nodule |
| 308 | 2513237101 | Bradyrhizobium murdochi WSM1741 | Isolate | Nodule |
| 309 | 2513237137 | Bradyrhizobium elkanii USDA 94 | Isolate | Nodule |
| 310 | 2513237141 | Bradyrhizobium sp. TV2a.2 | Isolate | Nodule |
| 311 | 2513237145 | Bradyrhizobium elkanii USDA 3254 | Isolate | Nodule |
| 312 | 2517572143 | Bradyrhizobium elkanii USDA 76 | Isolate | Nodule |
| 313 | 2524023210 | Bradyrhizobium sp. Ai1a-2 | Isolate | Nodule |
| 314 | 2562617112 | Burkholderia sp. BT03 | Isolate | Rhizosphere |
| 315 | 2643221658 | Variovorax sp. Root411 | Isolate | Unclassified |
| 316 | 2667528175 | Rhizobium tropici NFR14 | Isolate | Rhizoplane |
| 317 | 2711768613 | Burkholderia sp. BT03 | Isolate | Rhizosphere |
| 318 | 2721755755 | Bradyrhizobium icense LMTR 13 | Isolate | Nodule |
| 319 | 2728368998 | Bradyrhizobium macuxiense BR 10303 | Isolate | Nodule |
| 320 | 2791355197 | Bradyrhizobium sp. C9 | Isolate | Nodule |
| 321 | 2791355199 | |||
| 322 | 2874604998 | Bradyrhizobium sp. LMTR 3 | Isolate | Nodule |
| 323 | 2876808645 | Bradyrhizobium algeriense RST89 | Isolate | Unclassified |
| 324 | 2879110137 | Bradyrhizobium algeriense RST91 | Isolate | Nodule |
| 325 | 2883087390 | Paraburkholderia guartelaensis CNPSo 3008 | Isolate | Unclassified |
| 326 | 2885383462 | Bradyrhizobium sp. Leo170 | Isolate | Unclassified |
| 327 | 2889033259 | Bradyrhizobium sp. CCBAU 051011 | Isolate | Unclassified |
| 328 | 2903748898 | Bradyrhizobium uaiense UFLA 03-164 | Isolate | Nodule |
| 329 | 2903768456 | Bradyrhizobium sp. Leo121 | Isolate | Unclassified |
| 330 | 2904541872 | Variovorax sp. 1615 | Isolate | Rhizosphere |
| 331 | 2904690495 | Bradyrhizobium ivorense CI-1B | Isolate | Nodule |
| 332 | 2904699407 | |||
| 333 | 2906635258 | Bradyrhizobium sp. USDA 3458 | Isolate | Unclassified |
| 334 | 2906660503 | Bradyrhizobium brasilense UFLA 03-321 | Isolate | Unclassified |
| 335 | 2908739725 | Bradyrhizobium sp. UFLA03-84 | Isolate | Nodule |
| 336 | 2908756301 | Bradyrhizobium ivorense CI-41S | Isolate | Nodule |
| 337 | 2922361189 | Bradyrhizobium australiense WSM 1791 | Isolate | Nodule |
| 338 | 2922386360 | Bradyrhizobium archetypum WSM 1744 | Isolate | Nodule |
| 339 | 2929160207 | Variovorax sp. R-72349 Hybrid assembly | Isolate | Unclassified |
| 340 | 2935630451 | Bradyrhizobium sp. I1.14.4 | Isolate | Nodule |
| 341 | 2939631187 | Ottowia thiooxydans 2709 | Isolate | Rhizosphere |
| 342 | 2941507105 | Bradyrhizobium sp. i1.12.3 | Isolate | Nodule |
| 343 | 2941515067 | Bradyrhizobium sp. i1.14.1 | Isolate | Nodule |
| 344 | 2941523033 | Bradyrhizobium sp. i1.8.4 | Isolate | Nodule |
| 345 | 3005474847 | Bradyrhizobium sp. CCBAU 53421 | Isolate | Nodule |
| 346 | 8006933436 | Bradyrhizobium septentrionale 7(2017) | Isolate | Unclassified |
| 347 | 8006973647 | Bradyrhizobium septentrionale 162S2 | Isolate | Nodule |
| 348 | 8006984368 | Bradyrhizobium sp. SRL28 | Isolate | Unclassified |
| 349 | 8006994254 | Bradyrhizobium sp. sGM-13 | Isolate | Nodule |
| 350 | 8056673599 | Bradyrhizobium hereditatis WSM 1738 | Isolate | Nodule |
| 351 | 8056689827 | Bradyrhizobium semiaridum WSM 1704 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 91.83 |
| Metatranscriptomes | 0 |
| Isolates | 8.17 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 10.13 |
| Nodule | 6.15 |
| Rhizoplane | 5.06 |
| Rhizosphere | 69.62 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.18 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0500641_0010007 | 3300053096 | Bacteria | 3418 |
| 2 | JGI25151J46595_10001974 | 3300003187 | Bacteria | 12907 |
| 3 | JGI25406J46586_10000094 | 3300003203 | Bacteria | 40843 |
| 4 | JGI25406J46586_10003160 | 3300003203 | Bacteria | 7746 |
| 5 | JGI25153J46596_10000149 | 3300003215 | Bacteria | 70796 |
| 6 | JGI25153J46596_10007264 | 3300003215 | Bacteria | 5480 |
| 7 | JGI25153J46596_10038385 | 3300003215 | Bacteria | 1510 |
| 8 | JGI25404J52841_10004541 | 3300003659 | Bacteria | 2820 |
| 9 | JGI25404J52841_10007823 | 3300003659 | Bacteria | 2268 |
| 10 | Ga0070683_100007041 | 3300005329 | Bacteria | 9467 |
| 11 | Ga0070683_100008603 | 3300005329 | Bacteria | 8674 |
| 12 | Ga0068869_100048603 | 3300005334 | Bacteria | 3068 |
| 13 | Ga0068869_100107060 | 3300005334 | Bacteria | 2122 |
| 14 | Ga0068869_100195800 | 3300005334 | Bacteria | 1591 |
| 15 | Ga0068869_100196491 | 3300005334 | Bacteria | 1589 |
| 16 | Ga0070680_100029489 | 3300005336 | Bacteria | 4407 |
| 17 | Ga0070680_100055643 | 3300005336 | Bacteria | 3233 |
| 18 | Ga0070680_100198046 | 3300005336 | Bacteria | 1693 |
| 19 | Ga0070682_100017196 | 3300005337 | Bacteria | 4213 |
| 20 | Ga0068868_100088914 | 3300005338 | Bacteria | 2486 |
| 21 | Ga0070687_100098603 | 3300005343 | Bacteria | 1631 |
| 22 | Ga0070661_100079087 | 3300005344 | Bacteria | 2426 |
| 23 | Ga0070668_100023548 | 3300005347 | Bacteria | 4658 |
| 24 | Ga0070668_100032687 | 3300005347 | Bacteria | 3958 |
| 25 | Ga0070669_100165144 | 3300005353 | Bacteria | 1723 |
| 26 | Ga0070669_100173211 | 3300005353 | Bacteria | 1684 |
| 27 | Ga0070675_100142451 | 3300005354 | Bacteria | 2050 |
| 28 | Ga0070671_100105690 | 3300005355 | Bacteria | 2363 |
| 29 | Ga0070674_100057177 | 3300005356 | Bacteria | 2707 |
| 30 | Ga0070667_100081597 | 3300005367 | Bacteria | 2768 |
| 31 | Ga0070709_10001264 | 3300005434 | Bacteria | 13842 |
| 32 | Ga0070709_10004642 | 3300005434 | Bacteria | 7416 |
| 33 | Ga0070714_100002981 | 3300005435 | Bacteria | 12546 |
| 34 | Ga0070714_100053302 | 3300005435 | Bacteria | 3452 |
| 35 | Ga0070714_100059779 | 3300005435 | Bacteria | 3269 |
| 36 | Ga0070714_100089748 | 3300005435 | Bacteria | 2691 |
| 37 | Ga0070713_100005695 | 3300005436 | Bacteria | 8553 |
| 38 | Ga0070713_100010724 | 3300005436 | Bacteria | 6636 |
| 39 | Ga0070713_100016387 | 3300005436 | Bacteria | 5572 |
| 40 | Ga0070713_100037520 | 3300005436 | Bacteria | 3919 |
| 41 | Ga0070713_100358267 | 3300005436 | Bacteria | 1355 |
| 42 | Ga0070710_10007335 | 3300005437 | Bacteria | 5336 |
| 43 | Ga0070711_100004753 | 3300005439 | Bacteria | 8045 |
| 44 | Ga0070711_100007851 | 3300005439 | Bacteria | 6504 |
| 45 | Ga0070711_100017321 | 3300005439 | Bacteria | 4585 |
| 46 | Ga0070711_100177100 | 3300005439 | Bacteria | 1630 |
| 47 | Ga0070663_100065957 | 3300005455 | Bacteria | 2622 |
| 48 | Ga0070663_100086412 | 3300005455 | Bacteria | 2316 |
| 49 | Ga0070663_100203386 | 3300005455 | Bacteria | 1546 |
| 50 | Ga0070678_100050808 | 3300005456 | Bacteria | 3002 |
| 51 | Ga0070678_100104077 | 3300005456 | Bacteria | 2207 |
| 52 | Ga0070662_100163068 | 3300005457 | Bacteria | 1745 |
| 53 | Ga0070681_10066471 | 3300005458 | Bacteria | 3574 |
| 54 | Ga0070681_10410214 | 3300005458 | Bacteria | 1266 |
| 55 | Ga0068867_100141540 | 3300005459 | Bacteria | 1881 |
| 56 | Ga0070706_100135043 | 3300005467 | Bacteria | 2303 |
| 57 | Ga0070679_100027886 | 3300005530 | Bacteria | 5563 |
| 58 | Ga0070679_100041917 | 3300005530 | Bacteria | 4557 |
| 59 | Ga0070679_100245808 | 3300005530 | Bacteria | 1746 |
| 60 | Ga0070684_100009914 | 3300005535 | Bacteria | 7529 |
| 61 | Ga0070684_100193719 | 3300005535 | Bacteria | 1850 |
| 62 | Ga0070697_100083463 | 3300005536 | Bacteria | 2635 |
| 63 | Ga0068853_100002706 | 3300005539 | Bacteria | 13372 |
| 64 | Ga0070693_100133618 | 3300005547 | Bacteria | 1554 |
| 65 | Ga0070665_100075383 | 3300005548 | Bacteria | 3380 |
| 66 | Ga0070665_100236343 | 3300005548 | Bacteria | 1828 |
| 67 | Ga0068855_100075938 | 3300005563 | Bacteria | 3900 |
| 68 | Ga0068855_100107746 | 3300005563 | Bacteria | 3201 |
| 69 | Ga0068857_100035560 | 3300005577 | Bacteria | 4411 |
| 70 | Ga0068857_100048961 | 3300005577 | Bacteria | 3750 |
| 71 | Ga0068856_100057701 | 3300005614 | Bacteria | 3833 |
| 72 | Ga0068856_100235861 | 3300005614 | Bacteria | 1845 |
| 73 | Ga0068856_100480108 | 3300005614 | Bacteria | 1264 |
| 74 | Ga0070702_100091278 | 3300005615 | Bacteria | 1848 |
| 75 | Ga0070702_100155465 | 3300005615 | Bacteria | 1473 |
| 76 | Ga0068852_100211760 | 3300005616 | Bacteria | 1839 |
| 77 | Ga0068852_100267801 | 3300005616 | Bacteria | 1643 |
| 78 | Ga0068861_100315117 | 3300005719 | Bacteria | 1360 |
| 79 | Ga0068851_10016664 | 3300005834 | Bacteria | 3520 |
| 80 | Ga0068863_100098279 | 3300005841 | Bacteria | 2780 |
| 81 | Ga0068863_100122754 | 3300005841 | Bacteria | 2478 |
| 82 | Ga0068858_100079432 | 3300005842 | Bacteria | 3048 |
| 83 | Ga0068858_100111317 | 3300005842 | Bacteria | 2557 |
| 84 | Ga0068860_100001477 | 3300005843 | Bacteria | 25388 |
| 85 | Ga0068860_100084034 | 3300005843 | Bacteria | 3028 |
| 86 | Ga0068860_100103635 | 3300005843 | Bacteria | 2716 |
| 87 | Ga0068862_100056605 | 3300005844 | Bacteria | 3360 |
| 88 | Ga0068862_100102317 | 3300005844 | Bacteria | 2507 |
| 89 | Ga0068862_100147743 | 3300005844 | Bacteria | 2090 |
| 90 | Ga0068862_100221103 | 3300005844 | Bacteria | 1714 |
| 91 | Ga0081455_10007096 | 3300005937 | Bacteria | 11872 |
| 92 | Ga0081455_10031301 | 3300005937 | Bacteria | 4816 |
| 93 | Ga0081540_1004669 | 3300005983 | Bacteria | 10365 |
| 94 | Ga0081540_1010490 | 3300005983 | Bacteria | 6265 |
| 95 | Ga0081540_1013940 | 3300005983 | Bacteria | 5190 |
| 96 | Ga0081540_1016177 | 3300005983 | Bacteria | 4683 |
| 97 | Ga0081540_1016835 | 3300005983 | Bacteria | 4554 |
| 98 | Ga0081540_1027130 | 3300005983 | Bacteria | 3251 |
| 99 | Ga0081539_10000250 | 3300005985 | Bacteria | 125352 |
| 100 | Ga0081539_10000269 | 3300005985 | Bacteria | 119082 |
| 101 | Ga0081539_10014715 | 3300005985 | Bacteria | 5755 |
| 102 | Ga0070717_10009054 | 3300006028 | Bacteria | 7473 |
| 103 | Ga0070717_10035629 | 3300006028 | Bacteria | 4030 |
| 104 | Ga0075365_10038517 | 3300006038 | Bacteria | 3108 |
| 105 | Ga0075368_10052921 | 3300006042 | Bacteria | 1615 |
| 106 | Ga0075364_10048260 | 3300006051 | Bacteria | 2774 |
| 107 | Ga0075364_10119230 | 3300006051 | Bacteria | 1765 |
| 108 | Ga0070715_10001102 | 3300006163 | Bacteria | 7669 |
| 109 | Ga0070716_100001236 | 3300006173 | Bacteria | 11263 |
| 110 | Ga0070716_100184958 | 3300006173 | Bacteria | 1371 |
| 111 | Ga0070712_100016683 | 3300006175 | Bacteria | 4746 |
| 112 | Ga0070712_100018956 | 3300006175 | Bacteria | 4478 |
| 113 | Ga0075362_10021993 | 3300006177 | Bacteria | 2683 |
| 114 | Ga0075362_10106022 | 3300006177 | Bacteria | 1319 |
| 115 | Ga0075367_10037947 | 3300006178 | Bacteria | 2802 |
| 116 | Ga0075369_10009307 | 3300006186 | Bacteria | 3811 |
| 117 | Ga0097621_100081902 | 3300006237 | Bacteria | 2687 |
| 118 | Ga0075370_10012361 | 3300006353 | Bacteria | 4510 |
| 119 | Ga0075370_10024305 | 3300006353 | Bacteria | 3346 |
| 120 | Ga0068871_100145584 | 3300006358 | Bacteria | 2017 |
| 121 | Ga0075428_100096612 | 3300006844 | Bacteria | 3220 |
| 122 | Ga0075431_100031117 | 3300006847 | Bacteria | 5497 |
| 123 | Ga0068865_100070716 | 3300006881 | Bacteria | 2473 |
| 124 | Ga0068865_100161318 | 3300006881 | Bacteria | 1710 |
| 125 | Ga0099822_1006648 | 3300006943 | Bacteria | 15036 |
| 126 | Ga0075435_100215937 | 3300007076 | Bacteria | 1628 |
| 127 | Ga0105250_10100738 | 3300009092 | Bacteria | 1178 |
| 128 | Ga0105240_10001577 | 3300009093 | Bacteria | 38667 |
| 129 | Ga0105240_10019439 | 3300009093 | Bacteria | 9075 |
| 130 | Ga0105240_10038636 | 3300009093 | Bacteria | 6121 |
| 131 | Ga0105240_10077635 | 3300009093 | Bacteria | 4091 |
| 132 | Ga0105240_10083377 | 3300009093 | Bacteria | 3923 |
| 133 | Ga0105240_10275483 | 3300009093 | Bacteria | 1936 |
| 134 | Ga0111539_10124322 | 3300009094 | Bacteria | 3023 |
| 135 | Ga0105245_10057612 | 3300009098 | Bacteria | 3495 |
| 136 | Ga0105245_10303697 | 3300009098 | Bacteria | 1567 |
| 137 | Ga0105245_10412134 | 3300009098 | Bacteria | 1353 |
| 138 | Ga0105241_10027170 | 3300009174 | Bacteria | 4261 |
| 139 | Ga0105241_10055509 | 3300009174 | Bacteria | 3035 |
| 140 | Ga0105242_10083765 | 3300009176 | Bacteria | 2671 |
| 141 | Ga0105248_10222326 | 3300009177 | Bacteria | 2126 |
| 142 | Ga0105237_10004568 | 3300009545 | Bacteria | 15981 |
| 143 | Ga0105237_10052370 | 3300009545 | Bacteria | 4097 |
| 144 | Ga0105237_10078407 | 3300009545 | Bacteria | 3293 |
| 145 | Ga0105237_10207078 | 3300009545 | Bacteria | 1962 |
| 146 | Ga0105238_10005843 | 3300009551 | Bacteria | 12184 |
| 147 | Ga0105238_10042779 | 3300009551 | Bacteria | 4585 |
| 148 | Ga0105238_10158150 | 3300009551 | Bacteria | 2241 |
| 149 | Ga0105238_10292870 | 3300009551 | Bacteria | 1610 |
| 150 | Ga0105249_10074377 | 3300009553 | Bacteria | 3145 |
| 151 | Ga0105239_10043422 | 3300010375 | Bacteria | 4927 |
| 152 | Ga0157370_10055693 | 3300013104 | Bacteria | 3765 |
| 153 | Ga0157369_10015838 | 3300013105 | Bacteria | 8493 |
| 154 | Ga0157369_10023684 | 3300013105 | Bacteria | 6837 |
| 155 | Ga0157378_10146201 | 3300013297 | Bacteria | 2199 |
| 156 | Ga0163162_10065198 | 3300013306 | Bacteria | 3689 |
| 157 | Ga0163162_10205737 | 3300013306 | Bacteria | 2097 |
| 158 | Ga0163163_10165731 | 3300014325 | Bacteria | 2256 |
| 159 | Ga0157380_10093575 | 3300014326 | Bacteria | 2485 |
| 160 | Ga0157379_10072770 | 3300014968 | Bacteria | 3076 |
| 161 | Ga0157376_10212548 | 3300014969 | Bacteria | 1787 |
| 162 | Ga0163161_10117690 | 3300017792 | Bacteria | 1993 |
| 163 | Ga0213871_10008001 | 3300021441 | Bacteria | 2312 |
| 164 | Ga0209759_1015018 | 3300025256 | Bacteria | 2018 |
| 165 | Ga0209675_1005427 | 3300025291 | Bacteria | 5341 |
| 166 | Ga0209025_1000325 | 3300025294 | Bacteria | 106131 |
| 167 | Ga0209758_1000060 | 3300025297 | Bacteria | 324326 |
| 168 | Ga0209758_1036135 | 3300025297 | Bacteria | 1934 |
| 169 | Ga0207692_10006316 | 3300025898 | Bacteria | 4803 |
| 170 | Ga0207685_10005165 | 3300025905 | Bacteria | 3413 |
| 171 | Ga0207699_10010444 | 3300025906 | Bacteria | 4661 |
| 172 | Ga0207699_10019827 | 3300025906 | Bacteria | 3594 |
| 173 | Ga0207643_10149714 | 3300025908 | Bacteria | 1398 |
| 174 | Ga0207705_10070224 | 3300025909 | Bacteria | 2538 |
| 175 | Ga0207684_10078276 | 3300025910 | Bacteria | 2812 |
| 176 | Ga0207654_10038187 | 3300025911 | Bacteria | 2693 |
| 177 | Ga0207654_10183683 | 3300025911 | Bacteria | 1366 |
| 178 | Ga0207707_10000896 | 3300025912 | Bacteria | 29115 |
| 179 | Ga0207707_10018267 | 3300025912 | Bacteria | 6113 |
| 180 | Ga0207707_10035359 | 3300025912 | Bacteria | 4369 |
| 181 | Ga0207695_10037684 | 3300025913 | Bacteria | 5215 |
| 182 | Ga0207695_10048335 | 3300025913 | Bacteria | 4494 |
| 183 | Ga0207695_10223334 | 3300025913 | Bacteria | 1790 |
| 184 | Ga0207671_10023632 | 3300025914 | Bacteria | 4633 |
| 185 | Ga0207671_10029052 | 3300025914 | Bacteria | 4131 |
| 186 | Ga0207693_10007674 | 3300025915 | Bacteria | 8861 |
| 187 | Ga0207693_10015377 | 3300025915 | Bacteria | 6141 |
| 188 | Ga0207663_10000119 | 3300025916 | Bacteria | 38150 |
| 189 | Ga0207663_10038439 | 3300025916 | Bacteria | 2893 |
| 190 | Ga0207660_10055597 | 3300025917 | Bacteria | 2829 |
| 191 | Ga0207662_10086981 | 3300025918 | Bacteria | 1916 |
| 192 | Ga0207649_10035308 | 3300025920 | Bacteria | 3003 |
| 193 | Ga0207652_10006082 | 3300025921 | Bacteria | 9767 |
| 194 | Ga0207652_10013939 | 3300025921 | Bacteria | 6508 |
| 195 | Ga0207652_10047431 | 3300025921 | Bacteria | 3669 |
| 196 | Ga0207652_10051269 | 3300025921 | Bacteria | 3538 |
| 197 | Ga0207681_10035228 | 3300025923 | Bacteria | 3297 |
| 198 | Ga0207694_10002784 | 3300025924 | Bacteria | 14119 |
| 199 | Ga0207694_10039037 | 3300025924 | Bacteria | 3652 |
| 200 | Ga0207650_10329462 | 3300025925 | Bacteria | 1252 |
| 201 | Ga0207659_10035019 | 3300025926 | Bacteria | 3467 |
| 202 | Ga0207687_10077985 | 3300025927 | Bacteria | 2384 |
| 203 | Ga0207700_10011329 | 3300025928 | Bacteria | 5680 |
| 204 | Ga0207700_10016527 | 3300025928 | Bacteria | 4905 |
| 205 | Ga0207700_10034662 | 3300025928 | Bacteria | 3626 |
| 206 | Ga0207700_10125033 | 3300025928 | Bacteria | 2091 |
| 207 | Ga0207700_10434293 | 3300025928 | Bacteria | 1155 |
| 208 | Ga0207664_10051694 | 3300025929 | Bacteria | 3246 |
| 209 | Ga0207664_10078812 | 3300025929 | Bacteria | 2673 |
| 210 | Ga0207706_10075000 | 3300025933 | Bacteria | 2974 |
| 211 | Ga0207686_10097031 | 3300025934 | Bacteria | 1960 |
| 212 | Ga0207686_10302174 | 3300025934 | Bacteria | 1189 |
| 213 | Ga0207709_10153309 | 3300025935 | Bacteria | 1598 |
| 214 | Ga0207704_10133629 | 3300025938 | Bacteria | 1723 |
| 215 | Ga0207665_10001615 | 3300025939 | Bacteria | 15213 |
| 216 | Ga0207691_10083519 | 3300025940 | Bacteria | 2867 |
| 217 | Ga0207711_10028910 | 3300025941 | Bacteria | 4670 |
| 218 | Ga0207689_10026177 | 3300025942 | Bacteria | 4885 |
| 219 | Ga0207689_10042287 | 3300025942 | Bacteria | 3770 |
| 220 | Ga0207689_10107827 | 3300025942 | Bacteria | 2289 |
| 221 | Ga0207661_10000890 | 3300025944 | Bacteria | 19612 |
| 222 | Ga0207661_10113983 | 3300025944 | Bacteria | 2291 |
| 223 | Ga0207679_10074549 | 3300025945 | Bacteria | 2572 |
| 224 | Ga0207679_10265416 | 3300025945 | Bacteria | 1466 |
| 225 | Ga0207667_10010705 | 3300025949 | Bacteria | 10701 |
| 226 | Ga0207667_10094713 | 3300025949 | Bacteria | 3083 |
| 227 | Ga0207712_10031219 | 3300025961 | Bacteria | 3586 |
| 228 | Ga0207668_10025678 | 3300025972 | Bacteria | 3815 |
| 229 | Ga0207668_10104149 | 3300025972 | Bacteria | 2114 |
| 230 | Ga0207668_10290811 | 3300025972 | Bacteria | 1344 |
| 231 | Ga0207668_10341797 | 3300025972 | Bacteria | 1248 |
| 232 | Ga0207640_10079583 | 3300025981 | Bacteria | 2234 |
| 233 | Ga0207658_10041738 | 3300025986 | Bacteria | 3324 |
| 234 | Ga0207677_10011362 | 3300026023 | Bacteria | 5074 |
| 235 | Ga0207677_10134518 | 3300026023 | Bacteria | 1883 |
| 236 | Ga0207703_10073419 | 3300026035 | Bacteria | 2830 |
| 237 | Ga0207639_10004965 | 3300026041 | Bacteria | 8962 |
| 238 | Ga0207639_10062319 | 3300026041 | Bacteria | 2883 |
| 239 | Ga0207678_10033152 | 3300026067 | Bacteria | 4500 |
| 240 | Ga0207678_10043113 | 3300026067 | Bacteria | 3906 |
| 241 | Ga0207678_10053913 | 3300026067 | Bacteria | 3464 |
| 242 | Ga0207678_10058524 | 3300026067 | Bacteria | 3316 |
| 243 | Ga0207678_10081953 | 3300026067 | Bacteria | 2761 |
| 244 | Ga0207702_10240379 | 3300026078 | Bacteria | 1696 |
| 245 | Ga0207641_10090731 | 3300026088 | Bacteria | 2673 |
| 246 | Ga0207641_10285764 | 3300026088 | Bacteria | 1553 |
| 247 | Ga0207641_10413999 | 3300026088 | Bacteria | 1297 |
| 248 | Ga0207648_10018893 | 3300026089 | Bacteria | 6226 |
| 249 | Ga0207674_10069521 | 3300026116 | Bacteria | 3541 |
| 250 | Ga0207674_10207061 | 3300026116 | Bacteria | 1911 |
| 251 | Ga0207675_100041173 | 3300026118 | Bacteria | 4314 |
| 252 | Ga0207675_100160419 | 3300026118 | Bacteria | 2145 |
| 253 | Ga0207683_10059656 | 3300026121 | Bacteria | 3351 |
| 254 | Ga0207683_10077156 | 3300026121 | Bacteria | 2951 |
| 255 | Ga0207683_10123805 | 3300026121 | Bacteria | 2322 |
| 256 | Ga0207683_10201704 | 3300026121 | Bacteria | 1808 |
| 257 | Ga0209589_1000023 | 3300027357 | Bacteria | 177856 |
| 258 | Ga0209489_100032 | 3300027361 | Bacteria | 177856 |
| 259 | Ga0209700_100040 | 3300027363 | Bacteria | 177856 |
| 260 | Ga0268266_10017541 | 3300028379 | Bacteria | 6107 |
| 261 | Ga0268266_10037391 | 3300028379 | Bacteria | 4136 |
| 262 | Ga0268266_10083441 | 3300028379 | Bacteria | 2789 |
| 263 | Ga0268265_10127116 | 3300028380 | Bacteria | 2111 |
| 264 | Ga0268265_10177633 | 3300028380 | Bacteria | 1826 |
| 265 | Ga0268264_10000022 | 3300028381 | Bacteria | 476624 |
| 266 | Ga0268264_10164178 | 3300028381 | Bacteria | 2004 |
| 267 | Ga0307517_10001054 | 3300028786 | Bacteria | 46731 |
| 268 | Ga0307515_10000636 | 3300028794 | Bacteria | 81268 |
| 269 | Ga0307515_10073774 | 3300028794 | Bacteria | 4578 |
| 270 | Ga0307511_10030850 | 3300030521 | Bacteria | 4805 |
| 271 | Ga0265320_10001870 | 3300031240 | Bacteria | 14890 |
| 272 | Ga0265327_10007017 | 3300031251 | Bacteria | 8830 |
| 273 | Ga0307513_10106065 | 3300031456 | Bacteria | 2817 |
| 274 | Ga0307513_10321853 | 3300031456 | Unclassified | 1304 |
| 275 | Ga0307509_10088835 | 3300031507 | Bacteria | 3171 |
| 276 | Ga0307508_10076047 | 3300031616 | Bacteria | 2935 |
| 277 | Ga0307508_10218956 | 3300031616 | Bacteria | 1504 |
| 278 | Ga0265314_10011519 | 3300031711 | Bacteria | 7289 |
| 279 | Ga0307516_10021897 | 3300031730 | Bacteria | 6567 |
| 280 | Ga0307516_10023744 | 3300031730 | Bacteria | 6274 |
| 281 | Ga0307516_10093568 | 3300031730 | Bacteria | 2831 |
| 282 | Ga0307516_10094528 | 3300031730 | Bacteria | 2813 |
| 283 | Ga0307411_10331360 | 3300032005 | Bacteria | 1233 |
| 284 | Ga0307510_10031363 | 3300033180 | Bacteria | 6007 |
| 285 | Ga0307510_10071226 | 3300033180 | Bacteria | 3464 |
| 286 | Ga0315911_1000001 | 3300033442 | Bacteria | 1088602 |
| 287 | Ga0373926_0078363 | 3300035083 | Bacteria | 1219 |
| 288 | Ga0373954_0026894 | 3300035118 | Bacteria | 2639 |
| 289 | Ga0373943_0004616 | 3300035170 | Bacteria | 6227 |
| 290 | Ga0373943_0009069 | 3300035170 | Bacteria | 4460 |
| 291 | Ga0373946_0010906 | 3300035171 | Bacteria | 3377 |
| 292 | Ga0373955_0013494 | 3300035172 | Bacteria | 3953 |
| 293 | Ga0373924_0008760 | 3300035410 | Bacteria | 3688 |
| 294 | Ga0373924_0028357 | 3300035410 | Bacteria | 2231 |
| 295 | Ga0373935_0001572 | 3300035692 | Bacteria | 12730 |
| 296 | Ga0373935_0131583 | 3300035692 | Bacteria | 1681 |
| 297 | Ga0373927_0000225 | 3300035695 | Bacteria | 44840 |
| 298 | Ga0373927_0011961 | 3300035695 | Bacteria | 5774 |
| 299 | Ga0373927_0058491 | 3300035695 | Bacteria | 2493 |
| 300 | Ga0373927_0090907 | 3300035695 | Bacteria | 1982 |
| 301 | Ga0373933_0099086 | 3300035724 | Bacteria | 1806 |
| 302 | Ga0373947_0006620 | 3300035725 | Bacteria | 6726 |
| 303 | Ga0373947_0058482 | 3300035725 | Bacteria | 2336 |
| 304 | Ga0373947_0071092 | 3300035725 | Bacteria | 2134 |
| 305 | Ga0373937_0031898 | 3300036401 | Bacteria | 4776 |
| 306 | Ga0373937_0068786 | 3300036401 | Bacteria | 3264 |
| 307 | Ga0373925_0021013 | 3300037068 | Bacteria | 4756 |
| 308 | Ga0373925_0023528 | 3300037068 | Bacteria | 4495 |
| 309 | Ga0373925_0187533 | 3300037068 | Bacteria | 1640 |
| 310 | Ga0373925_0331030 | 3300037068 | Bacteria | 1234 |
| 311 | Ga0395900_0021777 | 3300037418 | Bacteria | 6554 |
| 312 | Ga0395898_0158318 | 3300037466 | Bacteria | 2166 |
| 313 | Ga0395898_0494999 | 3300037466 | Bacteria | 1163 |
| 314 | Ga0395905_0309058 | 3300037471 | Bacteria | 1469 |
| 315 | Ga0436364_1479741 | 3300037853 | Bacteria | 1517 |
| 316 | Ga0436360_1081800 | 3300039438 | Bacteria | 4526 |
| 317 | Ga0466963_0073891 | 3300044694 | Bacteria | 2299 |
| 318 | Ga0466957_0187227 | 3300044842 | Bacteria | 1354 |
| 319 | Ga0466959_0017208 | 3300045049 | Bacteria | 5295 |
| 320 | Ga0495617_012026 | 3300046452 | Bacteria | 2952 |
| 321 | Ga0495592_0017565 | 3300046454 | Bacteria | 5437 |
| 322 | Ga0495592_0144323 | 3300046454 | Bacteria | 1652 |
| 323 | Ga0495603_0000979 | 3300046455 | Bacteria | 16459 |
| 324 | Ga0495603_0007702 | 3300046455 | Bacteria | 6487 |
| 325 | Ga0495603_0008232 | 3300046455 | Bacteria | 6301 |
| 326 | Ga0495603_0013636 | 3300046455 | Bacteria | 4918 |
| 327 | Ga0495603_0016041 | 3300046455 | Bacteria | 4528 |
| 328 | Ga0495603_0018117 | 3300046455 | Bacteria | 4259 |
| 329 | Ga0495603_0027555 | 3300046455 | Bacteria | 3428 |
| 330 | Ga0495590_0040957 | 3300046457 | Bacteria | 1615 |
| 331 | Ga0495629_0000179 | 3300046459 | Bacteria | 56885 |
| 332 | Ga0495629_0003119 | 3300046459 | Bacteria | 12560 |
| 333 | Ga0495638_0112414 | 3300046460 | Bacteria | 1616 |
| 334 | Ga0495641_0003369 | 3300046461 | Bacteria | 11993 |
| 335 | Ga0495650_0009048 | 3300046471 | Bacteria | 5714 |
| 336 | Ga0495580_0000280 | 3300046472 | Bacteria | 41385 |
| 337 | Ga0495580_0003054 | 3300046472 | Bacteria | 14336 |
| 338 | Ga0495582_0000061 | 3300046473 | Bacteria | 55522 |
| 339 | Ga0495605_0063923 | 3300046474 | Bacteria | 1754 |
| 340 | Ga0495639_0000102 | 3300046475 | Bacteria | 42249 |
| 341 | Ga0495639_0069681 | 3300046475 | Bacteria | 1622 |
| 342 | Ga0495662_0000074 | 3300046476 | Bacteria | 35316 |
| 343 | Ga0495664_0002543 | 3300046477 | Bacteria | 9805 |
| 344 | Ga0495664_0015775 | 3300046477 | Bacteria | 4299 |
| 345 | Ga0495584_0106303 | 3300046491 | Bacteria | 1419 |
| 346 | Ga0495585_0083380 | 3300046492 | Bacteria | 1730 |
| 347 | Ga0495594_0001268 | 3300046499 | Bacteria | 13196 |
| 348 | Ga0495583_0010408 | 3300046506 | Bacteria | 5427 |
| 349 | Ga0495606_0001785 | 3300046507 | Bacteria | 27439 |
| 350 | Ga0495606_0070937 | 3300046507 | Bacteria | 2195 |
| 351 | Ga0495606_0101957 | 3300046507 | Bacteria | 1746 |
| 352 | Ga0495616_0012917 | 3300046513 | Bacteria | 4722 |
| 353 | Ga0495618_0024078 | 3300046514 | Bacteria | 3768 |
| 354 | Ga0495628_0098838 | 3300046516 | Bacteria | 2254 |
| 355 | Ga0495630_0001199 | 3300046517 | Bacteria | 17892 |
| 356 | Ga0495630_0047711 | 3300046517 | Bacteria | 3204 |
| 357 | Ga0495630_0186201 | 3300046517 | Bacteria | 1584 |
| 358 | Ga0495648_0052735 | 3300046524 | Bacteria | 2468 |
| 359 | Ga0495666_0037846 | 3300046526 | Bacteria | 2346 |
| 360 | Ga0495642_0097217 | 3300046528 | Bacteria | 1250 |
| 361 | Ga0495652_0035071 | 3300046529 | Bacteria | 4367 |
| 362 | Ga0495652_0126091 | 3300046529 | Bacteria | 2034 |
| 363 | Ga0495665_0001933 | 3300046531 | Bacteria | 11181 |
| 364 | Ga0495640_0010326 | 3300046533 | Bacteria | 7219 |
| 365 | Ga0495640_0019162 | 3300046533 | Bacteria | 5054 |
| 366 | Ga0495586_0021475 | 3300046535 | Bacteria | 3442 |
| 367 | Ga0495586_0023410 | 3300046535 | Bacteria | 3299 |
| 368 | Ga0495587_0201900 | 3300046536 | Bacteria | 1124 |
| 369 | Ga0495609_0065341 | 3300046538 | Bacteria | 1604 |
| 370 | Ga0495645_0002457 | 3300046543 | Bacteria | 12589 |
| 371 | Ga0495645_0003310 | 3300046543 | Bacteria | 10916 |
| 372 | Ga0495645_0161324 | 3300046543 | Bacteria | 1550 |
| 373 | Ga0495622_0044015 | 3300046557 | Bacteria | 2075 |
| 374 | Ga0495667_0011524 | 3300046559 | Bacteria | 5986 |
| 375 | Ga0495667_0035341 | 3300046559 | Bacteria | 3340 |
| 376 | Ga0495656_0018236 | 3300046615 | Bacteria | 2691 |
| 377 | Ga0495656_0035019 | 3300046615 | Bacteria | 2060 |
| 378 | Ga0495634_0000161 | 3300046642 | Bacteria | 60925 |
| 379 | Ga0495635_0003296 | 3300046663 | Bacteria | 11153 |
| 380 | Ga0495659_0073631 | 3300046664 | Bacteria | 1284 |
| 381 | Ga0495588_0009563 | 3300046674 | Bacteria | 4486 |
| 382 | Ga0495588_0034143 | 3300046674 | Bacteria | 2573 |
| 383 | Ga0495588_0063424 | 3300046674 | Bacteria | 1916 |
| 384 | Ga0495599_0030208 | 3300046678 | Bacteria | 3399 |
| 385 | Ga0495646_0026646 | 3300046680 | Bacteria | 3629 |
| 386 | Ga0495647_0001722 | 3300046681 | Bacteria | 6782 |
| 387 | Ga0495647_0003514 | 3300046681 | Bacteria | 5017 |
| 388 | Ga0495658_0000315 | 3300046683 | Bacteria | 27478 |
| 389 | Ga0495613_0009584 | 3300046689 | Bacteria | 7195 |
| 390 | Ga0495613_0068514 | 3300046689 | Bacteria | 2588 |
| 391 | Ga0495649_0143650 | 3300046694 | Bacteria | 1255 |
| 392 | Ga0495581_0000918 | 3300047315 | Bacteria | 15788 |
| 393 | Ga0495581_0014764 | 3300047315 | Bacteria | 4531 |
| 394 | Ga0495636_0026391 | 3300047318 | Bacteria | 2363 |
| 395 | Ga0495674_0000117 | 3300047319 | Bacteria | 60130 |
| 396 | Ga0495674_0007336 | 3300047319 | Bacteria | 10539 |
| 397 | Ga0495676_0002643 | 3300047321 | Bacteria | 16024 |
| 398 | Ga0495683_0002636 | 3300047323 | Bacteria | 10716 |
| 399 | Ga0495675_0145584 | 3300047444 | Bacteria | 1466 |
| 400 | Ga0495684_0013860 | 3300047471 | Bacteria | 6201 |
| 401 | Ga0495593_0000086 | 3300047673 | Bacteria | 40986 |
| 402 | Ga0495593_0069308 | 3300047673 | Bacteria | 1834 |
| 403 | Ga0495614_0011012 | 3300048089 | Bacteria | 3980 |
| 404 | Ga0496100_0126057 | 3300048903 | Bacteria | 1797 |
| 405 | Ga0496101_0291517 | 3300048904 | Bacteria | 1277 |
| 406 | Ga0496102_0219913 | 3300048905 | Bacteria | 1790 |
| 407 | Ga0496102_0220772 | 3300048905 | Bacteria | 1787 |
| 408 | Ga0496102_0248720 | 3300048905 | Bacteria | 1676 |
| 409 | Ga0496103_0027533 | 3300048906 | Bacteria | 3445 |
| 410 | Ga0496104_0061731 | 3300048907 | Bacteria | 3553 |
| 411 | Ga0496105_0033780 | 3300048908 | Bacteria | 4203 |
| 412 | Ga0496105_0080800 | 3300048908 | Bacteria | 2685 |
| 413 | Ga0496106_0004564 | 3300048909 | Bacteria | 10267 |
| 414 | Ga0496106_0019045 | 3300048909 | Bacteria | 5088 |
| 415 | Ga0496106_0040371 | 3300048909 | Bacteria | 3495 |
| 416 | Ga0496106_0118619 | 3300048909 | Bacteria | 2066 |
| 417 | Ga0496106_0124671 | 3300048909 | Bacteria | 2016 |
| 418 | Ga0496107_0134707 | 3300048910 | Bacteria | 1825 |
| 419 | Ga0496108_0052161 | 3300048911 | Bacteria | 3427 |
| 420 | Ga0496109_0058239 | 3300048912 | Bacteria | 3529 |
| 421 | Ga0496110_0462144 | 3300048913 | Bacteria | 1157 |
| 422 | Ga0496112_0000067 | 3300048915 | Bacteria | 68767 |
| 423 | Ga0496112_0011424 | 3300048915 | Bacteria | 8108 |
| 424 | Ga0496112_0028943 | 3300048915 | Bacteria | 5354 |
| 425 | Ga0496113_0000967 | 3300048916 | Bacteria | 15283 |
| 426 | Ga0496113_0044789 | 3300048916 | Bacteria | 3279 |
| 427 | Ga0496114_0063218 | 3300048917 | Bacteria | 3099 |
| 428 | Ga0496114_0204690 | 3300048917 | Bacteria | 1729 |
| 429 | Ga0496115_0078244 | 3300048918 | Bacteria | 2690 |
| 430 | Ga0496115_0180007 | 3300048918 | Bacteria | 1748 |
| 431 | Ga0496116_0041215 | 3300048919 | Bacteria | 3170 |
| 432 | Ga0496118_0006552 | 3300048921 | Bacteria | 12733 |
| 433 | Ga0496121_0000576 | 3300048924 | Bacteria | 69005 |
| 434 | Ga0496121_0007183 | 3300048924 | Bacteria | 13491 |
| 435 | Ga0496121_0032853 | 3300048924 | Bacteria | 4708 |
| 436 | Ga0496121_0039386 | 3300048924 | Bacteria | 4166 |
| 437 | Ga0496121_0082857 | 3300048924 | Bacteria | 2534 |
| 438 | Ga0496121_0098708 | 3300048924 | Bacteria | 2259 |
| 439 | Ga0496121_0135527 | 3300048924 | Bacteria | 1835 |
| 440 | Ga0496122_0117923 | 3300048925 | Bacteria | 1722 |
| 441 | Ga0496123_0029826 | 3300048926 | Bacteria | 4005 |
| 442 | Ga0496124_0003339 | 3300048927 | Bacteria | 19760 |
| 443 | Ga0496124_0234304 | 3300048927 | Bacteria | 1370 |
| 444 | Ga0496125_0136940 | 3300048928 | Bacteria | 1711 |
| 445 | Ga0496126_0004944 | 3300048929 | Bacteria | 15539 |
| 446 | Ga0496126_0013155 | 3300048929 | Bacteria | 8438 |
| 447 | Ga0496126_0025255 | 3300048929 | Bacteria | 5720 |
| 448 | Ga0496126_0039062 | 3300048929 | Bacteria | 4408 |
| 449 | Ga0496126_0069708 | 3300048929 | Bacteria | 3135 |
| 450 | Ga0496126_0071462 | 3300048929 | Bacteria | 3089 |
| 451 | Ga0501039_0086894 | 3300049575 | Bacteria | 2436 |
| 452 | Ga0501039_0283794 | 3300049575 | Bacteria | 1301 |
| 453 | Ga0501042_0163704 | 3300049578 | Bacteria | 1605 |
| 454 | Ga0501046_0144198 | 3300049580 | Bacteria | 1800 |
| 455 | Ga0501047_0077975 | 3300049581 | Bacteria | 3186 |
| 456 | Ga0501047_0343389 | 3300049581 | Bacteria | 1330 |
| 457 | Ga0501071_0321204 | 3300049587 | Bacteria | 1176 |
| 458 | Ga0501073_0026289 | 3300049589 | Bacteria | 4170 |
| 459 | Ga0501074_0057717 | 3300049590 | Bacteria | 2796 |
| 460 | Ga0501080_0037943 | 3300049742 | Bacteria | 4499 |
| 461 | Ga0501083_0087869 | 3300049744 | Bacteria | 2055 |
| 462 | Ga0501035_0125999 | 3300049822 | Bacteria | 2236 |
| 463 | nmdc:mga03683_16312_c1 | 3300050489 | Bacteria | 2788 |
| 464 | nmdc:mga00v17_139988_c1 | 3300050491 | Bacteria | 1551 |
| 465 | nmdc:mga00v17_83781_c1 | 3300050491 | Bacteria | 1995 |
| 466 | nmdc:mga0k408_115129_c1 | 3300050493 | Bacteria | 1591 |
| 467 | nmdc:mga06z11_30933_c1 | 3300050494 | Bacteria | 2595 |
| 468 | nmdc:mga04h51_50875_c1 | 3300050495 | Bacteria | 1390 |
| 469 | nmdc:mga07m45_31978_c1 | 3300050496 | Bacteria | 2917 |
| 470 | nmdc:mga07m45_36085_c1 | 3300050496 | Bacteria | 2752 |
| 471 | nmdc:mga06r32_28100_c1 | 3300050510 | Bacteria | 5260 |
| 472 | nmdc:mga0n895_194196_c1 | 3300050512 | Bacteria | 2061 |
| 473 | nmdc:mga0n895_40378_c1 | 3300050512 | Bacteria | 4532 |
| 474 | nmdc:mga0rr50_17104_c1 | 3300050513 | Bacteria | 4831 |
| 475 | nmdc:mga0sz30_14479_c1 | 3300050516 | Bacteria | 3106 |
| 476 | Ga0495612_0009682 | 3300053078 | Bacteria | 3903 |
| 477 | Ga0495619_0055590 | 3300053085 | Bacteria | 2622 |
| 478 | Ga0495619_0068850 | 3300053085 | Bacteria | 2365 |
| 479 | Ga0500643_046831 | 3300053087 | Bacteria | 1248 |
| 480 | Ga0500646_0022057 | 3300053090 | Bacteria | 1701 |
| 481 | Ga0500583_0075511 | 3300053092 | Bacteria | 1619 |
| 482 | Ga0500651_0000540 | 3300053093 | Bacteria | 19274 |
| 483 | Ga0500641_0005982 | 3300053096 | Bacteria | 4306 |
| 484 | Ga0500554_005539 | 3300053102 | Bacteria | 2763 |
| 485 | Ga0500555_002691 | 3300053103 | Bacteria | 5122 |
| 486 | Ga0500555_030649 | 3300053103 | Bacteria | 1526 |
| 487 | Ga0500572_000582 | 3300053111 | Bacteria | 12422 |
| 488 | Ga0500595_001090 | 3300053119 | Bacteria | 15074 |
| 489 | Ga0500607_028559 | 3300053121 | Bacteria | 3088 |
| 490 | Ga0500658_0108519 | 3300053134 | Bacteria | 1219 |
| 491 | Ga0500559_0001841 | 3300053136 | Bacteria | 11563 |
| 492 | Ga0500559_0005881 | 3300053136 | Bacteria | 5589 |
| 493 | Ga0500573_0006528 | 3300053140 | Bacteria | 6323 |
| 494 | Ga0500577_0051209 | 3300053142 | Bacteria | 1552 |
| 495 | Ga0500589_050511 | 3300053147 | Bacteria | 1930 |
| 496 | Ga0500590_019493 | 3300053148 | Bacteria | 3515 |
| 497 | Ga0500603_000291 | 3300053150 | Bacteria | 13250 |
| 498 | Ga0500622_0041694 | 3300053156 | Bacteria | 2388 |
| 499 | Ga0500627_0068485 | 3300053158 | Bacteria | 1569 |
| 500 | Ga0500634_0092964 | 3300053161 | Bacteria | 1526 |
| 501 | Ga0500638_114909 | 3300053162 | Bacteria | 1239 |
| 502 | Ga0500639_033713 | 3300053163 | Bacteria | 2706 |
| 503 | Ga0500636_0057050 | 3300053177 | Bacteria | 2286 |
| 504 | Ga0500637_0039640 | 3300053178 | Bacteria | 2657 |
| 505 | Ga0500609_002798 | 3300053731 | Bacteria | 2485 |
| 506 | Ga0500596_002419 | 3300053735 | Bacteria | 3681 |
| 507 | 2509147244 | 2508501128 | Bacteria | 8613869 |
| 508 | 2513656666 | 2513237096 | Bacteria | 8722461 |
| 509 | 2513672300 | 2513237098 | Bacteria | 9902361 |
| 510 | 2513691818 | 2513237101 | Bacteria | 7952346 |
| 511 | 2513858542 | 2513237137 | Bacteria | 9558895 |
| 512 | 2513889218 | 2513237141 | Bacteria | 8496279 |
| 513 | 2513917851 | 2513237145 | Bacteria | 8979722 |
| 514 | 2517893101 | 2517572143 | Bacteria | 9484767 |
| 515 | 2524466896 | 2524023210 | Bacteria | 9029266 |
| 516 | 2563056122 | 2562617112 | Bacteria | 10918404 |
| 517 | 2644325200 | 2643221658 | Bacteria | 6064537 |
| 518 | 2671117726 | 2667528175 | Bacteria | 7532676 |
| 519 | 2713481770 | 2711768613 | Bacteria | 11048459 |
| 520 | 2723845779 | 2721755755 | Bacteria | 8322773 |
| 521 | 2728753206 | 2728368998 | Bacteria | 8720350 |
| 522 | 2793070031 | 2791355197 | Bacteria | 8420563 |
| 523 | 2793077245 | |||
| 524 | 2874609580 | 2874604998 | Bacteria | 7834745 |
| 525 | 2876810919 | 2876808645 | Bacteria | 8824342 |
| 526 | 2879115646 | 2879110137 | Bacteria | 8907982 |
| 527 | 2883095913 | 2883087390 | Bacteria | 9532701 |
| 528 | 2885392688 | 2885383462 | Bacteria | 9473874 |
| 529 | 2889040604 | 2889033259 | Bacteria | 9099371 |
| 530 | 2903753033 | 2903748898 | Bacteria | 9972761 |
| 531 | 2903772748 | 2903768456 | Bacteria | 9749579 |
| 532 | 2904548937 | 2904541872 | Bacteria | 8915136 |
| 533 | 2904696556 | 2904690495 | Bacteria | 9412302 |
| 534 | 2904702534 | |||
| 535 | 2906640726 | 2906635258 | Bacteria | 8601019 |
| 536 | 2906661388 | 2906660503 | Bacteria | 8595048 |
| 537 | 2908743495 | 2908739725 | Bacteria | 8628932 |
| 538 | 2908760410 | 2908756301 | Bacteria | 8864324 |
| 539 | 2922367725 | 2922361189 | Bacteria | 7436256 |
| 540 | 2922392381 | 2922386360 | Bacteria | 7017218 |
| 541 | 2929160944 | 2929160207 | Bacteria | 9075316 |
| 542 | 2935633736 | 2935630451 | Bacteria | 8169952 |
| 543 | 2939634465 | 2939631187 | Bacteria | 6118131 |
| 544 | 2941510627 | 2941507105 | Bacteria | 8166816 |
| 545 | 2941517634 | 2941515067 | Bacteria | 8166720 |
| 546 | 2941525651 | 2941523033 | Bacteria | 8169134 |
| 547 | 3005479555 | 3005474847 | Bacteria | 9259049 |
| 548 | 8006941575 | 8006933436 | Bacteria | 10410654 |
| 549 | 8006981285 | 8006973647 | Bacteria | 10679141 |
| 550 | 8006988118 | 8006984368 | Bacteria | 9651211 |
| 551 | 8007001505 | 8006994254 | Bacteria | 8309700 |
| 552 | 8056674530 | 8056673599 | Bacteria | 7871253 |
| 553 | 8056690197 | 8056689827 | Bacteria | 6712655 |
| 554 | Ga0500641_0010007 | |||
| 555 | JGI25151J46595_10001974 | |||
| 556 | JGI25406J46586_10000094 | |||
| 557 | JGI25406J46586_10003160 | |||
| 558 | JGI25153J46596_10000149 | |||
| 559 | JGI25153J46596_10007264 | |||
| 560 | JGI25153J46596_10038385 | |||
| 561 | JGI25404J52841_10004541 | |||
| 562 | JGI25404J52841_10007823 | |||
| 563 | Ga0070683_100007041 | |||
| 564 | Ga0070683_100008603 | |||
| 565 | Ga0068869_100048603 | |||
| 566 | Ga0068869_100107060 | |||
| 567 | Ga0068869_100195800 | |||
| 568 | Ga0068869_100196491 | |||
| 569 | Ga0070680_100029489 | |||
| 570 | Ga0070680_100055643 | |||
| 571 | Ga0070680_100198046 | |||
| 572 | Ga0070682_100017196 | |||
| 573 | Ga0068868_100088914 | |||
| 574 | Ga0070687_100098603 | |||
| 575 | Ga0070661_100079087 | |||
| 576 | Ga0070668_100023548 | |||
| 577 | Ga0070668_100032687 | |||
| 578 | Ga0070669_100165144 | |||
| 579 | Ga0070669_100173211 | |||
| 580 | Ga0070675_100142451 | |||
| 581 | Ga0070671_100105690 | |||
| 582 | Ga0070674_100057177 | |||
| 583 | Ga0070667_100081597 | |||
| 584 | Ga0070709_10001264 | |||
| 585 | Ga0070709_10004642 | |||
| 586 | Ga0070714_100002981 | |||
| 587 | Ga0070714_100053302 | |||
| 588 | Ga0070714_100059779 | |||
| 589 | Ga0070714_100089748 | |||
| 590 | Ga0070713_100005695 | |||
| 591 | Ga0070713_100010724 | |||
| 592 | Ga0070713_100016387 | |||
| 593 | Ga0070713_100037520 | |||
| 594 | Ga0070713_100358267 | |||
| 595 | Ga0070710_10007335 | |||
| 596 | Ga0070711_100004753 | |||
| 597 | Ga0070711_100007851 | |||
| 598 | Ga0070711_100017321 | |||
| 599 | Ga0070711_100177100 | |||
| 600 | Ga0070663_100065957 | |||
| 601 | Ga0070663_100086412 | |||
| 602 | Ga0070663_100203386 | |||
| 603 | Ga0070678_100050808 | |||
| 604 | Ga0070678_100104077 | |||
| 605 | Ga0070662_100163068 | |||
| 606 | Ga0070681_10066471 | |||
| 607 | Ga0070681_10410214 | |||
| 608 | Ga0068867_100141540 | |||
| 609 | Ga0070706_100135043 | |||
| 610 | Ga0070679_100027886 | |||
| 611 | Ga0070679_100041917 | |||
| 612 | Ga0070679_100245808 | |||
| 613 | Ga0070684_100009914 | |||
| 614 | Ga0070684_100193719 | |||
| 615 | Ga0070697_100083463 | |||
| 616 | Ga0068853_100002706 | |||
| 617 | Ga0070693_100133618 | |||
| 618 | Ga0070665_100075383 | |||
| 619 | Ga0070665_100236343 | |||
| 620 | Ga0068855_100075938 | |||
| 621 | Ga0068855_100107746 | |||
| 622 | Ga0068857_100035560 | |||
| 623 | Ga0068857_100048961 | |||
| 624 | Ga0068856_100057701 | |||
| 625 | Ga0068856_100235861 | |||
| 626 | Ga0068856_100480108 | |||
| 627 | Ga0070702_100091278 | |||
| 628 | Ga0070702_100155465 | |||
| 629 | Ga0068852_100211760 | |||
| 630 | Ga0068852_100267801 | |||
| 631 | Ga0068861_100315117 | |||
| 632 | Ga0068851_10016664 | |||
| 633 | Ga0068863_100098279 | |||
| 634 | Ga0068863_100122754 | |||
| 635 | Ga0068858_100079432 | |||
| 636 | Ga0068858_100111317 | |||
| 637 | Ga0068860_100001477 | |||
| 638 | Ga0068860_100084034 | |||
| 639 | Ga0068860_100103635 | |||
| 640 | Ga0068862_100056605 | |||
| 641 | Ga0068862_100102317 | |||
| 642 | Ga0068862_100147743 | |||
| 643 | Ga0068862_100221103 | |||
| 644 | Ga0081455_10007096 | |||
| 645 | Ga0081455_10031301 | |||
| 646 | Ga0081540_1004669 | |||
| 647 | Ga0081540_1010490 | |||
| 648 | Ga0081540_1013940 | |||
| 649 | Ga0081540_1016177 | |||
| 650 | Ga0081540_1016835 | |||
| 651 | Ga0081540_1027130 | |||
| 652 | Ga0081539_10000250 | |||
| 653 | Ga0081539_10000269 | |||
| 654 | Ga0081539_10014715 | |||
| 655 | Ga0070717_10009054 | |||
| 656 | Ga0070717_10035629 | |||
| 657 | Ga0075365_10038517 | |||
| 658 | Ga0075368_10052921 | |||
| 659 | Ga0075364_10048260 | |||
| 660 | Ga0075364_10119230 | |||
| 661 | Ga0070715_10001102 | |||
| 662 | Ga0070716_100001236 | |||
| 663 | Ga0070716_100184958 | |||
| 664 | Ga0070712_100016683 | |||
| 665 | Ga0070712_100018956 | |||
| 666 | Ga0075362_10021993 | |||
| 667 | Ga0075362_10106022 | |||
| 668 | Ga0075367_10037947 | |||
| 669 | Ga0075369_10009307 | |||
| 670 | Ga0097621_100081902 | |||
| 671 | Ga0075370_10012361 | |||
| 672 | Ga0075370_10024305 | |||
| 673 | Ga0068871_100145584 | |||
| 674 | Ga0075428_100096612 | |||
| 675 | Ga0075431_100031117 | |||
| 676 | Ga0068865_100070716 | |||
| 677 | Ga0068865_100161318 | |||
| 678 | Ga0099822_1006648 | |||
| 679 | Ga0075435_100215937 | |||
| 680 | Ga0105250_10100738 | |||
| 681 | Ga0105240_10001577 | |||
| 682 | Ga0105240_10019439 | |||
| 683 | Ga0105240_10038636 | |||
| 684 | Ga0105240_10077635 | |||
| 685 | Ga0105240_10083377 | |||
| 686 | Ga0105240_10275483 | |||
| 687 | Ga0111539_10124322 | |||
| 688 | Ga0105245_10057612 | |||
| 689 | Ga0105245_10303697 | |||
| 690 | Ga0105245_10412134 | |||
| 691 | Ga0105241_10027170 | |||
| 692 | Ga0105241_10055509 | |||
| 693 | Ga0105242_10083765 | |||
| 694 | Ga0105248_10222326 | |||
| 695 | Ga0105237_10004568 | |||
| 696 | Ga0105237_10052370 | |||
| 697 | Ga0105237_10078407 | |||
| 698 | Ga0105237_10207078 | |||
| 699 | Ga0105238_10005843 | |||
| 700 | Ga0105238_10042779 | |||
| 701 | Ga0105238_10158150 | |||
| 702 | Ga0105238_10292870 | |||
| 703 | Ga0105249_10074377 | |||
| 704 | Ga0105239_10043422 | |||
| 705 | Ga0157370_10055693 | |||
| 706 | Ga0157369_10015838 | |||
| 707 | Ga0157369_10023684 | |||
| 708 | Ga0157378_10146201 | |||
| 709 | Ga0163162_10065198 | |||
| 710 | Ga0163162_10205737 | |||
| 711 | Ga0163163_10165731 | |||
| 712 | Ga0157380_10093575 | |||
| 713 | Ga0157379_10072770 | |||
| 714 | Ga0157376_10212548 | |||
| 715 | Ga0163161_10117690 | |||
| 716 | Ga0213871_10008001 | |||
| 717 | Ga0209759_1015018 | |||
| 718 | Ga0209675_1005427 | |||
| 719 | Ga0209025_1000325 | |||
| 720 | Ga0209758_1000060 | |||
| 721 | Ga0209758_1036135 | |||
| 722 | Ga0207692_10006316 | |||
| 723 | Ga0207685_10005165 | |||
| 724 | Ga0207699_10010444 | |||
| 725 | Ga0207699_10019827 | |||
| 726 | Ga0207643_10149714 | |||
| 727 | Ga0207705_10070224 | |||
| 728 | Ga0207684_10078276 | |||
| 729 | Ga0207654_10038187 | |||
| 730 | Ga0207654_10183683 | |||
| 731 | Ga0207707_10000896 | |||
| 732 | Ga0207707_10018267 | |||
| 733 | Ga0207707_10035359 | |||
| 734 | Ga0207695_10037684 | |||
| 735 | Ga0207695_10048335 | |||
| 736 | Ga0207695_10223334 | |||
| 737 | Ga0207671_10023632 | |||
| 738 | Ga0207671_10029052 | |||
| 739 | Ga0207693_10007674 | |||
| 740 | Ga0207693_10015377 | |||
| 741 | Ga0207663_10000119 | |||
| 742 | Ga0207663_10038439 | |||
| 743 | Ga0207660_10055597 | |||
| 744 | Ga0207662_10086981 | |||
| 745 | Ga0207649_10035308 | |||
| 746 | Ga0207652_10006082 | |||
| 747 | Ga0207652_10013939 | |||
| 748 | Ga0207652_10047431 | |||
| 749 | Ga0207652_10051269 | |||
| 750 | Ga0207681_10035228 | |||
| 751 | Ga0207694_10002784 | |||
| 752 | Ga0207694_10039037 | |||
| 753 | Ga0207650_10329462 | |||
| 754 | Ga0207659_10035019 | |||
| 755 | Ga0207687_10077985 | |||
| 756 | Ga0207700_10011329 | |||
| 757 | Ga0207700_10016527 | |||
| 758 | Ga0207700_10034662 | |||
| 759 | Ga0207700_10125033 | |||
| 760 | Ga0207700_10434293 | |||
| 761 | Ga0207664_10051694 | |||
| 762 | Ga0207664_10078812 | |||
| 763 | Ga0207706_10075000 | |||
| 764 | Ga0207686_10097031 | |||
| 765 | Ga0207686_10302174 | |||
| 766 | Ga0207709_10153309 | |||
| 767 | Ga0207704_10133629 | |||
| 768 | Ga0207665_10001615 | |||
| 769 | Ga0207691_10083519 | |||
| 770 | Ga0207711_10028910 | |||
| 771 | Ga0207689_10026177 | |||
| 772 | Ga0207689_10042287 | |||
| 773 | Ga0207689_10107827 | |||
| 774 | Ga0207661_10000890 | |||
| 775 | Ga0207661_10113983 | |||
| 776 | Ga0207679_10074549 | |||
| 777 | Ga0207679_10265416 | |||
| 778 | Ga0207667_10010705 | |||
| 779 | Ga0207667_10094713 | |||
| 780 | Ga0207712_10031219 | |||
| 781 | Ga0207668_10025678 | |||
| 782 | Ga0207668_10104149 | |||
| 783 | Ga0207668_10290811 | |||
| 784 | Ga0207668_10341797 | |||
| 785 | Ga0207640_10079583 | |||
| 786 | Ga0207658_10041738 | |||
| 787 | Ga0207677_10011362 | |||
| 788 | Ga0207677_10134518 | |||
| 789 | Ga0207703_10073419 | |||
| 790 | Ga0207639_10004965 | |||
| 791 | Ga0207639_10062319 | |||
| 792 | Ga0207678_10033152 | |||
| 793 | Ga0207678_10043113 | |||
| 794 | Ga0207678_10053913 | |||
| 795 | Ga0207678_10058524 | |||
| 796 | Ga0207678_10081953 | |||
| 797 | Ga0207702_10240379 | |||
| 798 | Ga0207641_10090731 | |||
| 799 | Ga0207641_10285764 | |||
| 800 | Ga0207641_10413999 | |||
| 801 | Ga0207648_10018893 | |||
| 802 | Ga0207674_10069521 | |||
| 803 | Ga0207674_10207061 | |||
| 804 | Ga0207675_100041173 | |||
| 805 | Ga0207675_100160419 | |||
| 806 | Ga0207683_10059656 | |||
| 807 | Ga0207683_10077156 | |||
| 808 | Ga0207683_10123805 | |||
| 809 | Ga0207683_10201704 | |||
| 810 | Ga0209589_1000023 | |||
| 811 | Ga0209489_100032 | |||
| 812 | Ga0209700_100040 | |||
| 813 | Ga0268266_10017541 | |||
| 814 | Ga0268266_10037391 | |||
| 815 | Ga0268266_10083441 | |||
| 816 | Ga0268265_10127116 | |||
| 817 | Ga0268265_10177633 | |||
| 818 | Ga0268264_10000022 | |||
| 819 | Ga0268264_10164178 | |||
| 820 | Ga0307517_10001054 | |||
| 821 | Ga0307515_10000636 | |||
| 822 | Ga0307515_10073774 | |||
| 823 | Ga0307511_10030850 | |||
| 824 | Ga0265320_10001870 | |||
| 825 | Ga0265327_10007017 | |||
| 826 | Ga0307513_10106065 | |||
| 827 | Ga0307513_10321853 | |||
| 828 | Ga0307509_10088835 | |||
| 829 | Ga0307508_10076047 | |||
| 830 | Ga0307508_10218956 | |||
| 831 | Ga0265314_10011519 | |||
| 832 | Ga0307516_10021897 | |||
| 833 | Ga0307516_10023744 | |||
| 834 | Ga0307516_10093568 | |||
| 835 | Ga0307516_10094528 | |||
| 836 | Ga0307411_10331360 | |||
| 837 | Ga0307510_10031363 | |||
| 838 | Ga0307510_10071226 | |||
| 839 | Ga0315911_1000001 | |||
| 840 | Ga0373926_0078363 | |||
| 841 | Ga0373954_0026894 | |||
| 842 | Ga0373943_0004616 | |||
| 843 | Ga0373943_0009069 | |||
| 844 | Ga0373946_0010906 | |||
| 845 | Ga0373955_0013494 | |||
| 846 | Ga0373924_0008760 | |||
| 847 | Ga0373924_0028357 | |||
| 848 | Ga0373935_0001572 | |||
| 849 | Ga0373935_0131583 | |||
| 850 | Ga0373927_0000225 | |||
| 851 | Ga0373927_0011961 | |||
| 852 | Ga0373927_0058491 | |||
| 853 | Ga0373927_0090907 | |||
| 854 | Ga0373933_0099086 | |||
| 855 | Ga0373947_0006620 | |||
| 856 | Ga0373947_0058482 | |||
| 857 | Ga0373947_0071092 | |||
| 858 | Ga0373937_0031898 | |||
| 859 | Ga0373937_0068786 | |||
| 860 | Ga0373925_0021013 | |||
| 861 | Ga0373925_0023528 | |||
| 862 | Ga0373925_0187533 | |||
| 863 | Ga0373925_0331030 | |||
| 864 | Ga0395900_0021777 | |||
| 865 | Ga0395898_0158318 | |||
| 866 | Ga0395898_0494999 | |||
| 867 | Ga0395905_0309058 | |||
| 868 | Ga0436364_1479741 | |||
| 869 | Ga0436360_1081800 | |||
| 870 | Ga0466963_0073891 | |||
| 871 | Ga0466957_0187227 | |||
| 872 | Ga0466959_0017208 | |||
| 873 | Ga0495617_012026 | |||
| 874 | Ga0495592_0017565 | |||
| 875 | Ga0495592_0144323 | |||
| 876 | Ga0495603_0000979 | |||
| 877 | Ga0495603_0007702 | |||
| 878 | Ga0495603_0008232 | |||
| 879 | Ga0495603_0013636 | |||
| 880 | Ga0495603_0016041 | |||
| 881 | Ga0495603_0018117 | |||
| 882 | Ga0495603_0027555 | |||
| 883 | Ga0495590_0040957 | |||
| 884 | Ga0495629_0000179 | |||
| 885 | Ga0495629_0003119 | |||
| 886 | Ga0495638_0112414 | |||
| 887 | Ga0495641_0003369 | |||
| 888 | Ga0495650_0009048 | |||
| 889 | Ga0495580_0000280 | |||
| 890 | Ga0495580_0003054 | |||
| 891 | Ga0495582_0000061 | |||
| 892 | Ga0495605_0063923 | |||
| 893 | Ga0495639_0000102 | |||
| 894 | Ga0495639_0069681 | |||
| 895 | Ga0495662_0000074 | |||
| 896 | Ga0495664_0002543 | |||
| 897 | Ga0495664_0015775 | |||
| 898 | Ga0495584_0106303 | |||
| 899 | Ga0495585_0083380 | |||
| 900 | Ga0495594_0001268 | |||
| 901 | Ga0495583_0010408 | |||
| 902 | Ga0495606_0001785 | |||
| 903 | Ga0495606_0070937 | |||
| 904 | Ga0495606_0101957 | |||
| 905 | Ga0495616_0012917 | |||
| 906 | Ga0495618_0024078 | |||
| 907 | Ga0495628_0098838 | |||
| 908 | Ga0495630_0001199 | |||
| 909 | Ga0495630_0047711 | |||
| 910 | Ga0495630_0186201 | |||
| 911 | Ga0495648_0052735 | |||
| 912 | Ga0495666_0037846 | |||
| 913 | Ga0495642_0097217 | |||
| 914 | Ga0495652_0035071 | |||
| 915 | Ga0495652_0126091 | |||
| 916 | Ga0495665_0001933 | |||
| 917 | Ga0495640_0010326 | |||
| 918 | Ga0495640_0019162 | |||
| 919 | Ga0495586_0021475 | |||
| 920 | Ga0495586_0023410 | |||
| 921 | Ga0495587_0201900 | |||
| 922 | Ga0495609_0065341 | |||
| 923 | Ga0495645_0002457 | |||
| 924 | Ga0495645_0003310 | |||
| 925 | Ga0495645_0161324 | |||
| 926 | Ga0495622_0044015 | |||
| 927 | Ga0495667_0011524 | |||
| 928 | Ga0495667_0035341 | |||
| 929 | Ga0495656_0018236 | |||
| 930 | Ga0495656_0035019 | |||
| 931 | Ga0495634_0000161 | |||
| 932 | Ga0495635_0003296 | |||
| 933 | Ga0495659_0073631 | |||
| 934 | Ga0495588_0009563 | |||
| 935 | Ga0495588_0034143 | |||
| 936 | Ga0495588_0063424 | |||
| 937 | Ga0495599_0030208 | |||
| 938 | Ga0495646_0026646 | |||
| 939 | Ga0495647_0001722 | |||
| 940 | Ga0495647_0003514 | |||
| 941 | Ga0495658_0000315 | |||
| 942 | Ga0495613_0009584 | |||
| 943 | Ga0495613_0068514 | |||
| 944 | Ga0495649_0143650 | |||
| 945 | Ga0495581_0000918 | |||
| 946 | Ga0495581_0014764 | |||
| 947 | Ga0495636_0026391 | |||
| 948 | Ga0495674_0000117 | |||
| 949 | Ga0495674_0007336 | |||
| 950 | Ga0495676_0002643 | |||
| 951 | Ga0495683_0002636 | |||
| 952 | Ga0495675_0145584 | |||
| 953 | Ga0495684_0013860 | |||
| 954 | Ga0495593_0000086 | |||
| 955 | Ga0495593_0069308 | |||
| 956 | Ga0495614_0011012 | |||
| 957 | Ga0496100_0126057 | |||
| 958 | Ga0496101_0291517 | |||
| 959 | Ga0496102_0219913 | |||
| 960 | Ga0496102_0220772 | |||
| 961 | Ga0496102_0248720 | |||
| 962 | Ga0496103_0027533 | |||
| 963 | Ga0496104_0061731 | |||
| 964 | Ga0496105_0033780 | |||
| 965 | Ga0496105_0080800 | |||
| 966 | Ga0496106_0004564 | |||
| 967 | Ga0496106_0019045 | |||
| 968 | Ga0496106_0040371 | |||
| 969 | Ga0496106_0118619 | |||
| 970 | Ga0496106_0124671 | |||
| 971 | Ga0496107_0134707 | |||
| 972 | Ga0496108_0052161 | |||
| 973 | Ga0496109_0058239 | |||
| 974 | Ga0496110_0462144 | |||
| 975 | Ga0496112_0000067 | |||
| 976 | Ga0496112_0011424 | |||
| 977 | Ga0496112_0028943 | |||
| 978 | Ga0496113_0000967 | |||
| 979 | Ga0496113_0044789 | |||
| 980 | Ga0496114_0063218 | |||
| 981 | Ga0496114_0204690 | |||
| 982 | Ga0496115_0078244 | |||
| 983 | Ga0496115_0180007 | |||
| 984 | Ga0496116_0041215 | |||
| 985 | Ga0496118_0006552 | |||
| 986 | Ga0496121_0000576 | |||
| 987 | Ga0496121_0007183 | |||
| 988 | Ga0496121_0032853 | |||
| 989 | Ga0496121_0039386 | |||
| 990 | Ga0496121_0082857 | |||
| 991 | Ga0496121_0098708 | |||
| 992 | Ga0496121_0135527 | |||
| 993 | Ga0496122_0117923 | |||
| 994 | Ga0496123_0029826 | |||
| 995 | Ga0496124_0003339 | |||
| 996 | Ga0496124_0234304 | |||
| 997 | Ga0496125_0136940 | |||
| 998 | Ga0496126_0004944 | |||
| 999 | Ga0496126_0013155 | |||
| 1000 | Ga0496126_0025255 | |||
| 1001 | Ga0496126_0039062 | |||
| 1002 | Ga0496126_0069708 | |||
| 1003 | Ga0496126_0071462 | |||
| 1004 | Ga0501039_0086894 | |||
| 1005 | Ga0501039_0283794 | |||
| 1006 | Ga0501042_0163704 | |||
| 1007 | Ga0501046_0144198 | |||
| 1008 | Ga0501047_0077975 | |||
| 1009 | Ga0501047_0343389 | |||
| 1010 | Ga0501071_0321204 | |||
| 1011 | Ga0501073_0026289 | |||
| 1012 | Ga0501074_0057717 | |||
| 1013 | Ga0501080_0037943 | |||
| 1014 | Ga0501083_0087869 | |||
| 1015 | Ga0501035_0125999 | |||
| 1016 | nmdc:mga03683_16312_c1 | |||
| 1017 | nmdc:mga00v17_139988_c1 | |||
| 1018 | nmdc:mga00v17_83781_c1 | |||
| 1019 | nmdc:mga0k408_115129_c1 | |||
| 1020 | nmdc:mga06z11_30933_c1 | |||
| 1021 | nmdc:mga04h51_50875_c1 | |||
| 1022 | nmdc:mga07m45_31978_c1 | |||
| 1023 | nmdc:mga07m45_36085_c1 | |||
| 1024 | nmdc:mga06r32_28100_c1 | |||
| 1025 | nmdc:mga0n895_194196_c1 | |||
| 1026 | nmdc:mga0n895_40378_c1 | |||
| 1027 | nmdc:mga0rr50_17104_c1 | |||
| 1028 | nmdc:mga0sz30_14479_c1 | |||
| 1029 | Ga0495612_0009682 | |||
| 1030 | Ga0495619_0055590 | |||
| 1031 | Ga0495619_0068850 | |||
| 1032 | Ga0500643_046831 | |||
| 1033 | Ga0500646_0022057 | |||
| 1034 | Ga0500583_0075511 | |||
| 1035 | Ga0500651_0000540 | |||
| 1036 | Ga0500641_0005982 | |||
| 1037 | Ga0500554_005539 | |||
| 1038 | Ga0500555_002691 | |||
| 1039 | Ga0500555_030649 | |||
| 1040 | Ga0500572_000582 | |||
| 1041 | Ga0500595_001090 | |||
| 1042 | Ga0500607_028559 | |||
| 1043 | Ga0500658_0108519 | |||
| 1044 | Ga0500559_0001841 | |||
| 1045 | Ga0500559_0005881 | |||
| 1046 | Ga0500573_0006528 | |||
| 1047 | Ga0500577_0051209 | |||
| 1048 | Ga0500589_050511 | |||
| 1049 | Ga0500590_019493 | |||
| 1050 | Ga0500603_000291 | |||
| 1051 | Ga0500622_0041694 | |||
| 1052 | Ga0500627_0068485 | |||
| 1053 | Ga0500634_0092964 | |||
| 1054 | Ga0500638_114909 | |||
| 1055 | Ga0500639_033713 | |||
| 1056 | Ga0500636_0057050 | |||
| 1057 | Ga0500637_0039640 | |||
| 1058 | Ga0500609_002798 | |||
| 1059 | Ga0500596_002419 | |||
| 1060 | 2509147244 | |||
| 1061 | 2513656666 | |||
| 1062 | 2513672300 | |||
| 1063 | 2513691818 | |||
| 1064 | 2513858542 | |||
| 1065 | 2513889218 | |||
| 1066 | 2513917851 | |||
| 1067 | 2517893101 | |||
| 1068 | 2524466896 | |||
| 1069 | 2563056122 | |||
| 1070 | 2644325200 | |||
| 1071 | 2671117726 | |||
| 1072 | 2713481770 | |||
| 1073 | 2723845779 | |||
| 1074 | 2728753206 | |||
| 1075 | 2793070031 | |||
| 1076 | 2793077245 | |||
| 1077 | 2874609580 | |||
| 1078 | 2876810919 | |||
| 1079 | 2879115646 | |||
| 1080 | 2883095913 | |||
| 1081 | 2885392688 | |||
| 1082 | 2889040604 | |||
| 1083 | 2903753033 | |||
| 1084 | 2903772748 | |||
| 1085 | 2904548937 | |||
| 1086 | 2904696556 | |||
| 1087 | 2904702534 | |||
| 1088 | 2906640726 | |||
| 1089 | 2906661388 | |||
| 1090 | 2908743495 | |||
| 1091 | 2908760410 | |||
| 1092 | 2922367725 | |||
| 1093 | 2922392381 | |||
| 1094 | 2929160944 | |||
| 1095 | 2935633736 | |||
| 1096 | 2939634465 | |||
| 1097 | 2941510627 | |||
| 1098 | 2941517634 | |||
| 1099 | 2941525651 | |||
| 1100 | 3005479555 | |||
| 1101 | 8006941575 | |||
| 1102 | 8006981285 | |||
| 1103 | 8006988118 | |||
| 1104 | 8007001505 | |||
| 1105 | 8056674530 | |||
| 1106 | 8056690197 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1dtn-assembly1.cif.gz_A | mandelate racemase mutant d270n co-crystallized with (s)-atrolactate | 0.9915 | 9 | 364 |
| 1mra-assembly1.cif.gz_A | mandelate racemase mutant d270n co-crystallized with (s)-atrolactate | 0.9909 | 9 | 364 |
| 4fp1-assembly1.cif.gz_A | p. putida mandelate racemase co-crystallized with 3,3,3-trifluoro-2-hydroxy-2-(trifluoromethyl) propionic acid | 0.9898 | 9 | 364 |
| 4hnc-assembly1.cif.gz_B | p. putida c92s/k166c/c264s mandelate racemase co-crystallized with benzilic acid | 0.9884 | 9 | 364 |
| 1dtn-assembly1.cif.gz_A | mandelate racemase mutant d270n co-crystallized with (s)-atrolactate | 0.986 | 9 | 364 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3uxlA02 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Enolase-like C-terminal domain | 0.9897 | 127 | 354 | 3.20.20.120 |
| 3toyD01 | Alpha Beta;2-Layer Sandwich;Enolase-like; domain 1;Enolase-like, N-terminal domain | 0.985 | 9 | 122 | 3.30.390.10 |
| 4fp1B01 | Alpha Beta;2-Layer Sandwich;Enolase-like; domain 1;Enolase-like, N-terminal domain | 0.9831 | 9 | 124 | 3.30.390.10 |
| 3uxlA02 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Enolase-like C-terminal domain | 0.9769 | 127 | 354 | 3.20.20.120 |
| 3toyC02 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Enolase-like C-terminal domain | 0.9586 | 127 | 355 | 3.20.20.120 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A1F4H331-F1-model_v4 | deleted | 0.9979 | 9 | 364 |
|
| AF-A0A1F4H331-F1-model_v4 | deleted | 0.9896 | 9 | 364 |
|
| AF-A0A849EB74-F1-model_v4 | Mandelate racemase | 0.988 | 10 | 364 |
GO:0000287
GO:0016052 GO:0016836 |
| AF-A0A5C8P5A4-F1-model_v4 | Mandelate racemase | 0.9877 | 10 | 364 |
GO:0000287
GO:0009063 GO:0016052 GO:0016836 |
| AF-A0A2E1TIT6-F1-model_v4 | Mandelate racemase | 0.9858 | 7 | 364 |
GO:0000287
GO:0009063 GO:0016052 GO:0016836 |