F462916

General Info

Members Datasets Scaffolds Average Seq Length
553 458 264 241

Family's Representative Sequence

Representative Sequence 3300049568|Ga0501031_0091756|Ga0501031_0091756_478_1335
Length 285
Sequence MGRLLGFAHGFGNGGARLQLGVYQIRKEAHDPFKTKKTNGRNTMPADMPTLSFAAEAARSASPGLPSTPGEKINMMAHYYRGELGRMAGWRDRIDRTSNWAITVVAALLSVSLSTPNAHHGVLLFAMLLVTXXLLIEARRYRFFDVYRARVRQLERFYFAELLGPNDQLALDWAAPIAKSLRKPEFLISYRDAACRRLRRNYCWMYLILLLAWALKISSSALQRPATAGRDMTLAVEHVVGNAALGPVPGGVVICLVLVFYLTIAYFSLKVDMSDSELSHGSVHV

Samples

Sample ID Description Type Environment
1 2509276021 Rhizobium leguminosarum bv. trifolii WSM597 Isolate Nodule
2 2509276033 Rhizobium leguminosarum bv. trifolii WSM2012 Isolate Nodule
3 2510065019 Rhizobium leguminosarum bv. trifolii WSM1689 Isolate Nodule
4 2510065057 Sinorhizobium meliloti WSM1022 Isolate Nodule
5 2510461069 Rhizobium sp. PDO1-076 Isolate Rhizosphere
6 2510461076 Rhizobium leguminosarum bv. trifolii TA1 Isolate Nodule
7 2510917028 Rhizobium sp. CF122 Isolate Rhizosphere
8 2513237084 Rhizobium leguminosarum bv. viciae UPM1131 Isolate Nodule
9 2513237085 Rhizobium leguminosarum bv. viciae UPM1137 Isolate Nodule
10 2513237088 Rhizobium mesoamericanum STM6155 Isolate Nodule
11 2513237093 Rhizobium leguminosarum bv. phaseoli FA23 Isolate Nodule
12 2513237103 Rhizobium leguminosarum bv. viciae VF39 Isolate Nodule
13 2513237138 Rhizobium favelukesii OR191 Isolate Nodule
14 2513237144 Rhizobium sullae WSM1592 Isolate Nodule
15 2513237146 Rhizobium mongolense USDA 1844 (Illumina) Isolate Nodule
16 2513237159 Rhizobium giardinii bv. giardinii H152 Isolate Nodule
17 2513237162 Rhizobium ruizarguesonis GB30 Isolate Nodule
18 2515075009 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
19 2515154107 Sinorhizobium meliloti 4H41 Isolate Nodule
20 2515154113 Rhizobium ruizarguesonis Vc2 Isolate Nodule
21 2515154114 Rhizobium ruizarguesonis Vh3 Isolate Nodule
22 2515154116 Rhizobium ruizarguesonis Ps8 Isolate Nodule
23 2515154134 Rhizobium gallicum bv. gallicum R602sp Isolate Nodule
24 2516653077 Rhizobium acaciae WSM1481 Isolate Nodule
25 2516653085 Rhizobium leguminosarum bv. phaseoli 4292 Isolate Nodule
26 2517093000 Rhizobium leguminosarum bv. trifolii SRDI943 Isolate Nodule
27 2517287029 Rhizobium leguminosarum bv. trifolii SRDI565 Isolate Nodule
28 2519899620 Rhizobium sp. Pop5 Isolate Nodule
29 2524023209 Rhizobium leucaenae USDA 9039 Isolate Nodule
30 2529292951 Rhizobium sp. CCGE 510 Isolate Nodule
31 2534681796 Rhizobium grahamii CCGE 502 Isolate Nodule
32 2551306090 Sinorhizobium meliloti A0641M Isolate Nodule
33 2582581294 Rhizobium sp. CF394 Isolate Rhizosphere
34 2582581306 Rhizobium sp. YR295 Isolate Rhizosphere
35 2582581308 Rhizobium sp. OK494 Isolate Rhizosphere
36 2582581315 Agrobacterium rhizogenes YR147 Isolate Rhizosphere
37 2582581316 Agrobacterium rhizogenes OK036 Isolate Rhizosphere
38 2582581865 Rhizobium sp. CF258 Isolate Rhizosphere
39 2582581866 Rhizobium sp. CF097 Isolate Rhizosphere
40 2582581867 Rhizobium sp. OV201 Isolate Rhizosphere
41 2585427526 Rhizobium leguminosarum OV152 Isolate Rhizosphere
42 2585427527 Rhizobium lusitanum YR374 Isolate Rhizosphere
43 2585427528 Rhizobium leguminosarum CF307 Isolate Rhizosphere
44 2585427530 Rhizobium tropici YR635 Isolate Rhizosphere
45 2585427590 Rhizobium sp. CF048 Isolate Rhizosphere
46 2585427593 Rhizobium tropici CF286 Isolate Rhizosphere
47 2585427633 Neorhizobium galegae bv. officinalis HAMBI 1141 Isolate Nodule
48 2585427634 Neorhizobium galegae bv. orientalis HAMBI 540 Isolate Nodule
49 2599185170 Rhizobium mongolense USDA 1844 (PacBio) Isolate Nodule
50 2599185352 Sinorhizobium sp. NFACC03 Isolate Rhizoplane
51 2615840624 Rhizobium aethiopicum HBR26 Isolate Nodule
52 2615840626 Rhizobium lusitanum P1-7 Isolate Nodule
53 2615840698 Rhizobium multihospitium HAMBI 2975 Isolate Nodule
54 2617270742 Rhizobium miluonense HAMBI 2971 Isolate Nodule
55 2643221618 Ensifer sp. Root231 Isolate Unclassified
56 2643221626 Ensifer sp. Root31 Isolate Unclassified
57 2643221637 Rhizobium sp. Root1212 Isolate Unclassified
58 2643221653 Rhizobium sp. Root1240 Isolate Unclassified
59 2643221655 Ensifer sp. Root1252 Isolate Unclassified
60 2643221659 Ensifer sp. Root127 Isolate Unclassified
61 2643221688 Rhizobium sp. Root482 Isolate Unclassified
62 2643221689 Rhizobium sp. Root483D2 Isolate Unclassified
63 2643221698 Ensifer sp. Root142 Isolate Unclassified
64 2643221712 Ensifer sp. Root258 Isolate Unclassified
65 2643221718 Rhizobium sp. Root268 Isolate Unclassified
66 2643221719 Rhizobium sp. Root274 Isolate Unclassified
67 2643221723 Ensifer sp. Root278 Isolate Unclassified
68 2657244999 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
69 2718217927 Rhizobium sp. N324 Isolate Nodule
70 2718217997 Rhizobium phaseoli sv. phaseoli R723 Isolate Nodule
71 2718218009 Rhizobium sp. N561 Isolate Nodule
72 2718218199 Rhizobium phaseoli sv. phaseoli N261 Isolate Nodule
73 2718218232 Rhizobium phaseoli sv. phaseoli N161 Isolate Nodule
74 2718218233 Rhizobium phaseoli sv. phaseoli R744 Isolate Nodule
75 2718218235 Rhizobium phaseoli sv. phaseoli R620 Isolate Nodule
76 2718218269 Rhizobium phaseoli sv. phaseoli N671 Isolate Nodule
77 2718218363 Rhizobium sp. N113 Isolate Nodule
78 2718218365 Rhizobium sp. N731 Isolate Nodule
79 2718218366 Rhizobium sp. N621 Isolate Nodule
80 2718218423 Rhizobium sp. N941 Isolate Nodule
81 2721755514 Rhizobium sp. N6212 Isolate Nodule
82 2721755556 Rhizobium phaseoli sv. phaseoli N931 Isolate Nodule
83 2721755684 Rhizobium phaseoli sv. phaseoli N841 Isolate Nodule
84 2721755685 Rhizobium phaseoli sv. phaseoli R611 Isolate Nodule
85 2721755809 Rhizobium sp. N541 Isolate Nodule
86 2721755810 Rhizobium sp. N871 Isolate Nodule
87 2721755819 Rhizobium phaseoli sv. phaseoli N771 Isolate Nodule
88 2721755822 Rhizobium phaseoli sv. phaseoli R650 Isolate Nodule
89 2721755823 Rhizobium phaseoli sv. phaseoli R630 Isolate Nodule
90 2724679232 Rhizobium leguminosarum Vaf12 Isolate Unclassified
91 2728369352 Rhizobium phaseoli sv. phaseoli N831 Isolate Nodule
92 2728369365 Rhizobium sp. N1341 Isolate Nodule
93 2728369397 Rhizobium sp. N1314 Isolate Nodule
94 2738541317 Rhizobium halophytocola DSM 21600 Isolate Unclassified
95 2738541333 Rhizobium sophoriradicis CCBAU 03470 Isolate Unclassified
96 2765235942 Rhizobium sp. WYCCWR10014 Isolate Nodule
97 2775507266 Rhizobium tropici PRF 81 Isolate Nodule
98 2791355082 Ensifer alkalisoli YIC4027 Isolate Nodule
99 2791355259 Rhizobium hidalgonense FH14 Isolate Nodule
100 2791355260 Rhizobium sp. L9 Isolate Nodule
101 2791355261 Rhizobium sp. J15 Isolate Nodule
102 2791355262 Rhizobium sp. M1 Isolate Nodule
103 2791355263 Rhizobium chutanense C5 Isolate Nodule
104 2791355264 Rhizobium sp. S9 Isolate Nodule
105 2791355265 Rhizobium sp. H4 Isolate Nodule
106 2791355266 Rhizobium sp. L43 Isolate Nodule
107 2791355267 Rhizobium sp. L18 Isolate Nodule
108 2802429268 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
109 2802429606 Rhizobium sophoriradicis JJW1 Isolate Nodule
110 2802429633 Rhizobium anhuiense J3 Isolate Nodule
111 2802429634 Rhizobium anhuiense S10 Isolate Nodule
112 2802429635 Rhizobium anhuiense Y27 Isolate Nodule
113 2802429636 Rhizobium anhuiense JX3 Isolate Nodule
114 2802429637 Rhizobium anhuiense C15 Isolate Nodule
115 2818991272 Rhizobium sp. SLBN-4 Isolate Unclassified
116 2818991448 Rhizobium miluonense 1234 Isolate Unclassified
117 2818991453 Rhizobium lusitanum 1158 Isolate Unclassified
118 2838016132 Rhizobium phaseoli SEMIA 4071 Isolate Nodule
119 2838022645 Rhizobium aethiopicum SEMIA 4074 Isolate Nodule
120 2838035591 Rhizobium mongolense SEMIA 4087 Isolate Nodule
121 2838042994 Rhizobium esperanzae SEMIA 4089 Isolate Nodule
122 2838048938 Rhizobium pisi 27/80 Isolate Nodule
123 2838061910 Rhizobium phaseoli L15 Isolate Nodule
124 2838068647 Rhizobium esperanzae VC28 Isolate Nodule
125 2838074704 Sinorhizobium terangae SEMIA 6460 Isolate Unclassified
126 2838661181 Rhizobium mongolense SEMIA 402 Isolate Nodule
127 2838668709 Rhizobium sophoriradicis SEMIA 403 Isolate Nodule
128 2838680041 Rhizobium leguminosarum SEMIA 415 Isolate Nodule
129 2838686498 Rhizobium leguminosarum SEMIA 416 Isolate Nodule
130 2838694306 Rhizobium leguminosarum SEMIA 421 Isolate Nodule
131 2838701080 Rhizobium aethiopicum SEMIA 428 Isolate Nodule
132 2838707686 Rhizobium leguminosarum SEMIA 430 Isolate Nodule
133 2838729681 Rhizobium leguminosarum SEMIA 445 Isolate Nodule
134 2838742623 Rhizobium leguminosarum SEMIA 449 Isolate Nodule
135 2841851746 Rhizobium leguminosarum SEMIA 498 Isolate Nodule
136 2841864319 Rhizobium leguminosarum SEMIA 4052 Isolate Nodule
137 2842077413 Rhizobium leguminosarum SEMIA 422 Isolate Nodule
138 2842110456 Rhizobium esperanzae SEMIA 414 Isolate Nodule
139 2842118031 Rhizobium esperanzae SEMIA 420 Isolate Nodule
140 2842146304 Rhizobium sophoriradicis SEMIA 454 Isolate Nodule
141 2842156927 Rhizobium leguminosarum SEMIA 459 Isolate Nodule
142 2842163707 Rhizobium leguminosarum SEMIA 460 Isolate Nodule
143 2842180545 Rhizobium leguminosarum SEMIA 463 Isolate Nodule
144 2842192696 Rhizobium esperanzae SEMIA 468 Isolate Nodule
145 2842198810 Rhizobium aethiopicum SEMIA 470 Isolate Nodule
146 2842205361 Rhizobium etli SEMIA 471 Isolate Nodule
147 2842217011 Rhizobium leguminosarum SEMIA 475 Isolate Nodule
148 2842229732 Rhizobium leguminosarum SEMIA 481 Isolate Nodule
149 2842237096 Rhizobium leguminosarum SEMIA 482 Isolate Nodule
150 2842243621 Rhizobium leguminosarum SEMIA 483 Isolate Nodule
151 2842250916 Rhizobium etli SEMIA 484 Isolate Nodule
152 2842257432 Rhizobium leguminosarum SEMIA 485 Isolate Nodule
153 2842264693 Rhizobium phaseoli SEMIA 487 Isolate Nodule
154 2842271015 Rhizobium leguminosarum SEMIA 488 Isolate Nodule
155 2842278818 Rhizobium etli SEMIA 489 Isolate Nodule
156 2842285085 Rhizobium lentis SEMIA 490 Isolate Nodule
157 2842291075 Rhizobium leguminosarum SEMIA 491 Isolate Nodule
158 2842298080 Rhizobium leucaenae SEMIA 492 Isolate Nodule
159 2842304105 Rhizobium leguminosarum SEMIA 499 Isolate Nodule
160 2842311132 Rhizobium phaseoli SEMIA 4002 Isolate Nodule
161 2842317721 Rhizobium etli SEMIA 4004 Isolate Nodule
162 2842341865 Rhizobium leguminosarum SEMIA 4011 Isolate Nodule
163 2842357229 Rhizobium leucaenae SEMIA 4015 Isolate Nodule
164 2842363717 Rhizobium leguminosarum SEMIA 4016 Isolate Nodule
165 2842370503 Rhizobium leguminosarum SEMIA 4022 Isolate Nodule
166 2842377471 Rhizobium leguminosarum SEMIA 4024 Isolate Nodule
167 2842384541 Rhizobium leguminosarum SEMIA 4025 Isolate Nodule
168 2842402390 Rhizobium lentis SEMIA 4033 Isolate Nodule
169 2842409023 Rhizobium lentis SEMIA 4034 Isolate Nodule
170 2842415677 Rhizobium lentis SEMIA 4036 Isolate Nodule
171 2842422224 Rhizobium esperanzae SEMIA 4042 Isolate Nodule
172 2842428310 Rhizobium phaseoli SEMIA 4050 Isolate Nodule
173 2842434925 Rhizobium esperanzae SEMIA 4051 Isolate Nodule
174 2842441272 Rhizobium esperanzae SEMIA 4053 Isolate Nodule
175 2842447887 Rhizobium esperanzae SEMIA 4055 Isolate Nodule
176 2842462802 Rhizobium phaseoli SEMIA 4057 Isolate Nodule
177 2842469257 Rhizobium phaseoli SEMIA 4058 Isolate Nodule
178 2842482326 Rhizobium lusitanum SEMIA 4060 Isolate Nodule
179 2842495871 Rhizobium etli SEMIA 4062 Isolate Nodule
180 2842509118 Rhizobium paranaense SEMIA 4064 Isolate Nodule
181 2842521101 Rhizobium giardinii SEMIA 4084 Isolate Nodule
182 2844163670 Ensifer sp. 1H6 Isolate Unclassified
183 2844454524 Rhizobium leguminosarum bv. viciae BIHB 1217 Isolate Nodule
184 2852387548 Rhizobium jaguaris CCGE525 Isolate Unclassified
185 2854896431 Neorhizobium alkalisoli DSM 21826 Isolate Unclassified
186 2854916844 Neorhizobium huautlense DSM 21817 Isolate Unclassified
187 2855839649 Sinorhizobium meliloti AK555 Isolate Unclassified
188 2857516855 Rhizobium sp. R-72456 Isolate Unclassified
189 2899803654 Agrobacterium sp. a22-2 Isolate Unclassified
190 2913295892 Sinorhizobium kostiensis DSM 13372 Isolate Nodule
191 2913308742 Rhizobium halophytocola DSM 21600 Isolate Unclassified
192 2915993759 Sinorhizobium meliloti USDA1336 Isolate Nodule
193 2919100787 Rhizobium sp. 1399 Isolate Rhizosphere
194 2919171160 Neorhizobium sp. 2083 Isolate Unclassified
195 2920760137 Ensifer psoraleae CCBAU 65732 Isolate Unclassified
196 2920822456 Ensifer sesbaniae CCBAU 65729 Isolate Unclassified
197 2921201388 Sinorhizobium meliloti USDA1692 Isolate Nodule
198 2921257292 Sinorhizobium meliloti USDA1320 Isolate Nodule
199 2923556063 Rhizobium tibeticum 3740 Isolate Unclassified
200 2924158325 Sinorhizobium meliloti USDA1146 Isolate Nodule
201 2933016740 Rhizobium sp. SEMIA 4085 Isolate Nodule
202 2933570622 Rhizobium leguminosarum SEMIA 409 Isolate Nodule
203 2933586486 Rhizobium leguminosarum SEMIA 4039 Isolate Nodule
204 2933599457 Rhizobium phaseoli M3 Isolate Nodule
205 2935894831 Rhizobium leguminosarum SEMIA 419 Isolate Nodule
206 2935901341 Rhizobium leguminosarum SEMIA 4082 Isolate Nodule
207 2936367885 Rhizobium changzhiense WYCCWR 11290 Isolate Nodule
208 2936375103 Rhizobium changzhiense WYCCWR 11317 Isolate Nodule
209 2936381700 Rhizobium chutanense C16 Isolate Unclassified
210 2936996657 Sinorhizobium meliloti USDA1025 Isolate Nodule
211 2937023124 Sinorhizobium meliloti USDA1335 Isolate Nodule
212 2937049772 Sinorhizobium meliloti USDA1691 Isolate Nodule
213 2937063883 Sinorhizobium meliloti USDA1808 Isolate Nodule
214 2937091812 Sinorhizobium meliloti USDA1221 Isolate Nodule
215 2937098957 Sinorhizobium meliloti USDA1519 Isolate Nodule
216 2937106411 Sinorhizobium meliloti USDA1214 Isolate Nodule
217 2941499720 Ensifer sp. 4252 Isolate Rhizosphere
218 2957388812 Sinorhizobium meliloti USDA1195 Isolate Nodule
219 2957395598 Sinorhizobium meliloti USDA1237 Isolate Nodule
220 2964615318 Sinorhizobium meliloti USDA1248 Isolate Nodule
221 2964649959 Sinorhizobium meliloti USDA1591 Isolate Nodule
222 2964656573 Sinorhizobium meliloti USDA1308 Isolate Nodule
223 2967664464 Sinorhizobium meliloti USDA1208 Isolate Nodule
224 2967678726 Sinorhizobium meliloti USDA1467 Isolate Nodule
225 2967693043 Sinorhizobium meliloti USDA1183 Isolate Nodule
226 2967714385 Sinorhizobium meliloti USDA1023 Isolate Nodule
227 2967721400 Sinorhizobium meliloti USDA1742 Isolate Nodule
228 2967735183 Sinorhizobium meliloti USDA1710 Isolate Nodule
229 2967755722 Sinorhizobium meliloti USDA1302 Isolate Nodule
230 2967762386 Sinorhizobium meliloti USDA1397 Isolate Nodule
231 2970019648 Sinorhizobium meliloti USDA1603 Isolate Nodule
232 2970033650 Sinorhizobium meliloti USDA1565 Isolate Nodule
233 2970040964 Sinorhizobium meliloti USDA1501 Isolate Nodule
234 2970068827 Sinorhizobium meliloti USDA1227 Isolate Nodule
235 2970102677 Sinorhizobium meliloti USDA1325 Isolate Nodule
236 2970116247 Sinorhizobium meliloti USDA1566 Isolate Nodule
237 2970129317 Sinorhizobium meliloti USDA1008 Isolate Nodule
238 2970184632 Sinorhizobium meliloti USDA1593 Isolate Nodule
239 2977551784 Sinorhizobium meliloti USDA1035 Isolate Nodule
240 2977579622 Sinorhizobium meliloti USDA1161 Isolate Nodule
241 2989349275 Shinella kummerowiae CCBAU 25048 Isolate Unclassified
242 2989776772 Rhizobium glycinendophyticum CL12 Isolate Unclassified
243 2996887358 Rhizobium sp. R711 Isolate Nodule
244 2996893221 Rhizobium sp. R635 Isolate Nodule
245 3003930520 Sinorhizobium sp. BG8 Isolate Unclassified
246 3005409236 Rhizobium sp. P32RR-XVIII Isolate Rhizosphere
247 3005416602 Rhizobium sp. P40RR-XXII Isolate Rhizosphere
248 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
249 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
250 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
251 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
252 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
253 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
254 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
255 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
256 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
257 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
258 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
259 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
260 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
261 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
262 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
263 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
264 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
265 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
266 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
267 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
268 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
269 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
270 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
271 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
272 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
273 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
274 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
275 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
276 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
277 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
278 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
279 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
280 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
281 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
282 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
283 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
284 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
285 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
286 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
287 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
288 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
289 3300009766 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule Metagenome Nodule
290 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
291 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
292 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
293 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
294 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
295 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
296 3300022739 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - brown nodules Metagenome Nodule
297 3300022740 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - pink nodules Metagenome Nodule
298 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
299 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
300 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
301 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
302 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
303 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
304 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
305 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
306 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
307 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
308 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
309 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
310 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
311 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
312 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
313 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
314 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
315 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
316 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
317 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
318 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
319 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
320 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
321 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
322 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
323 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
324 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
325 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
326 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
327 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
328 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
329 3300031967 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - elongated nodules Metagenome Nodule
330 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
331 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
332 3300033430 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - small nodules Metagenome Nodule
333 3300033464 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - branched nodules Metagenome Nodule
334 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
335 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
336 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
337 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
338 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
339 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
340 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
341 3300041502 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaT Metatranscriptome Unclassified
342 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
343 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
344 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
345 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
346 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
347 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
348 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
349 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
350 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
351 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
352 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
353 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
354 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
355 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
356 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
357 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
358 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
359 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
360 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
361 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
362 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
363 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
364 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
365 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
366 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
367 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
368 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
369 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
370 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
371 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
372 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
373 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
374 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
375 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
376 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
377 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
378 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
379 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
380 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
381 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
382 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
383 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
384 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
385 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
386 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
387 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
388 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
389 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
390 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
391 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
392 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
393 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
394 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
395 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
396 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
397 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
398 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
399 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
400 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
401 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
402 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
403 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
404 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
405 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
406 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
407 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
408 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
409 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
410 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
411 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
412 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
413 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
414 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
415 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
416 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
417 639633055 Rhizobium leguminosarum bv. viciae 3841 Isolate Unclassified
418 643692032 Sinorhizobium fredii NGR234 Isolate Nodule
419 8005246636 Rhizobium wuzhouense W44 Isolate Rhizosphere
420 8005258706 Rhizobium sp. R693 Isolate Nodule
421 8005275841 Rhizobium sp. N4311 Isolate Nodule
422 8005282627 Rhizobium phaseoli NC1 Isolate Nodule
423 8005289223 Rhizobium bangladeshense 1002 Isolate Nodule
424 8005301065 Rhizobium bangladeshense 1017 Isolate Nodule
425 8005307578 Rhizobium leguminosarum bv. phaseoli LCS0306 Isolate Unclassified
426 8005314921 Rhizobium sp. P28RR-XV Isolate Rhizosphere
427 8005321885 Rhizobium sp. R72 Isolate Nodule
428 8005376324 Rhizobium changzhiense WYCCWR 11279 Isolate Nodule
429 8005382845 Rhizobium sp. R634 Isolate Nodule
430 8005430974 Rhizobium phaseoli Y20 Isolate Nodule
431 8005460587 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
432 8005484373 Rhizobium tropici SARCC-755 Isolate Nodule
433 8005497431 Rhizobium phaseoli CCGM8 Isolate Unclassified
434 8005542996 Rhizobium grahamii CCGM3 Isolate Unclassified
435 8005556819 Rhizobium sp. WYCCWR 11128 Isolate Nodule
436 8005563573 Rhizobium sp. WYCCWR 11152 Isolate Nodule
437 8005570704 Rhizobium anhuiense bv. trifolii WYCCWR10015 Isolate Nodule
438 8005619151 Rhizobium phaseoli CCGM2 Isolate Unclassified
439 8005626139 Rhizobium phaseoli Y18 Isolate Nodule
440 8005645114 Rhizobium tropici IGFRI Rhizo-19 Isolate Rhizosphere
441 8005668836 Rhizobium phaseoli CCGM9 Isolate Unclassified
442 8005682033 Rhizobium dioscoreae S-93 Isolate Unclassified
443 8005688590 Rhizobium bangladeshense 1024 Isolate Nodule
444 8005695170 Rhizobium sp. RMa-01 Isolate Unclassified
445 8018127388 Rhizobium aegyptiacum 950 Isolate Nodule
446 8018163183 Rhizobium sp. WYCCWR 11146 Isolate Nodule
447 8018176218 Rhizobium sp. N122 Isolate Nodule
448 8023680758 Rhizobium leguminosarum SARCC-132 Isolate Nodule
449 8024479707 Rhizobium leguminosarum Tri-43 Isolate Nodule
450 8024501048 Rhizobium sp. H4 Isolate Nodule
451 8046767195 Rhizobium calliandrae CCGE524 Isolate Unclassified
452 8049293176 Ensifer alkalisoli YIC4027 Isolate Nodule
453 8054558443 Rhizobium alarense TRM95111 Isolate Nodule
454 8056375014 Rhizobium redzepovicii 18T Isolate Nodule
455 8056382006 Rhizobium croatiense 13T Isolate Nodule
456 8056875544 Rhizobium halophilum TRM95001 Isolate Rhizosphere
457 8057575449 Rhizobium mayense CCGE526 Isolate Nodule
458 8057874678 Rhizobium acaciae 1AS12 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 47.38
Metatranscriptomes 0.18
Isolates 52.44

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 22.24
Nodule 41.41
Rhizoplane 1.99
Rhizosphere 16.46
Stem 0
Stem Tuber 0
Unclassified 17.9

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25156J39149_1000001 3300002705 Bacteria 354557
2 JGI25154J39366_1000011 3300002738 Bacteria 296007
3 JGI25158J39367_1003035 3300002739 Bacteria 2638
4 JGI25157J39369_1000030 3300002741 Bacteria 146112
5 JGI25159J45721_1000082 3300002987 Bacteria 45028
6 JGI25159J45721_1000850 3300002987 Bacteria 13326
7 JGI25159J45721_1005240 3300002987 Bacteria 4101
8 JGI25151J46595_10001347 3300003187 Bacteria 17045
9 JGI25151J46595_10054610 3300003187 Bacteria 1323
10 JGI25165J46597_1001001 3300003214 Bacteria 18747
11 JGI25165J46597_1001852 3300003214 Bacteria 8742
12 JGI25153J46596_10005132 3300003215 Bacteria 6902
13 rootH2_10052347 3300003320 Bacteria 2942
14 rootL2_10073726 3300003322 Bacteria 5872
15 rootH1_10000039 3300003316 Bacteria 23242
16 rootH1_10000039 3300003323 Bacteria 6950
17 rootH1_10014639 3300003323 Bacteria 3755
18 JGI25160J50197_1000010 3300003354 Bacteria 279365
19 JGI25160J50197_1000011 3300003354 Bacteria 275577
20 JGI25160J50197_1003560 3300003354 Bacteria 6932
21 JGI25161J50226_1000006 3300003374 Bacteria 279563
22 JGI25161J50226_1000478 3300003374 Bacteria 18125
23 Ga0055526_1000490 3300003771 Bacteria 31450
24 Ga0055526_1000966 3300003771 Bacteria 21268
25 Ga0055526_1001988 3300003771 Bacteria 14102
26 Ga0055526_1004931 3300003771 Bacteria 7844
27 Ga0055524_1001266 3300003775 Bacteria 14812
28 Ga0055524_1007414 3300003775 Bacteria 4658
29 Ga0055524_1011991 3300003775 Bacteria 3352
30 Ga0055536_1003059 3300003781 Bacteria 9135
31 Ga0055528_1000284 3300003790 Bacteria 43328
32 Ga0055528_1003629 3300003790 Bacteria 7678
33 Ga0055528_1014147 3300003790 Bacteria 2971
34 Ga0055530_10006020 3300003791 Bacteria 5557
35 Ga0055530_10018949 3300003791 Bacteria 2101
36 Ga0055540_1000510 3300003792 Bacteria 29334
37 Ga0055540_1004618 3300003792 Bacteria 6113
38 Ga0055540_1019089 3300003792 Bacteria 1858
39 Ga0055531_10003692 3300003794 Bacteria 9632
40 Ga0055531_10007642 3300003794 Bacteria 5852
41 Ga0055543_1000210 3300004625 Bacteria 47374
42 Ga0055543_1000281 3300004625 Bacteria 37377
43 Ga0055543_1000668 3300004625 Bacteria 18040
44 Ga0065165_1000018 3300005262 Bacteria 275082
45 Ga0065165_1000485 3300005262 Bacteria 61473
46 Ga0068855_100229026 3300005563 Bacteria 2082
47 Ga0068854_100206148 3300005578 Bacteria 1548
48 Ga0068852_100283842 3300005616 Bacteria 1597
49 Ga0068851_10043210 3300005834 Bacteria 2271
50 Ga0075365_10001032 3300006038 Bacteria 11976
51 Ga0075365_10012294 3300006038 Bacteria 5076
52 Ga0075368_10089948 3300006042 Bacteria 1255
53 Ga0075363_100027690 3300006048 Bacteria 2908
54 Ga0075364_10161410 3300006051 Bacteria 1513
55 Ga0075362_10000141 3300006177 Bacteria 19610
56 Ga0075367_10002608 3300006178 Bacteria 8282
57 Ga0075367_10052656 3300006178 Bacteria 2410
58 Ga0075369_10000265 3300006186 Bacteria 15524
59 Ga0075369_10001683 3300006186 Bacteria 7632
60 Ga0075366_10005088 3300006195 Bacteria 7112
61 Ga0075370_10002484 3300006353 Bacteria 8551
62 Ga0075370_10021046 3300006353 Bacteria 3571
63 Ga0075370_10134059 3300006353 Bacteria 1446
64 Ga0079104_1003068 3300006946 Bacteria 8154
65 Ga0079104_1003374 3300006946 Bacteria 7488
66 Ga0105251_10041196 3300009011 Bacteria 2249
67 Ga0105240_10000005 3300009093 Bacteria 702630
68 Ga0105243_10056293 3300009148 Bacteria 3126
69 Ga0105237_10003410 3300009545 Bacteria 18891
70 Ga0105249_10176075 3300009553 Bacteria 2078
71 Ga0123342_1010819 3300009766 Bacteria 10273
72 Ga0105239_10010354 3300010375 Bacteria 10440
73 Ga0157370_10000046 3300013104 Bacteria 125612
74 Ga0163162_10295444 3300013306 Bacteria 1752
75 Ga0182008_10022144 3300014497 Bacteria 3255
76 Ga0182007_10001276 3300015262 Bacteria 13646
77 Ga0182005_1000769 3300015265 Bacteria 14613
78 Ga0228711_1000007 3300022739 Bacteria 202413
79 Ga0228710_1012407 3300022740 Bacteria 10574
80 Ga0209435_100012 3300025206 Bacteria 401621
81 Ga0209436_100224 3300025208 Bacteria 26052
82 Ga0209437_100165 3300025233 Bacteria 145009
83 Ga0207425_1007877 3300025245 Bacteria 2774
84 Ga0209646_1000026 3300025246 Bacteria 401621
85 Ga0209026_1000014 3300025250 Bacteria 401621
86 Ga0209677_100511 3300025253 Bacteria 21677
87 Ga0209759_1000012 3300025256 Bacteria 401621
88 Ga0209129_1006116 3300025258 Bacteria 4011
89 Ga0209233_1000069 3300025261 Bacteria 367639
90 Ga0209233_1000195 3300025261 Bacteria 125863
91 Ga0209673_1000013 3300025273 Bacteria 571633
92 Ga0209673_1000296 3300025273 Bacteria 92350
93 Ga0209673_1001255 3300025273 Bacteria 26234
94 Ga0209673_1001781 3300025273 Bacteria 17854
95 Ga0209673_1008078 3300025273 Bacteria 4734
96 Ga0209673_1045716 3300025273 Bacteria 1200
97 Ga0209130_1000021 3300025284 Bacteria 374278
98 Ga0209130_1000029 3300025284 Bacteria 323399
99 Ga0209130_1000313 3300025284 Bacteria 57104
100 Ga0209130_1028724 3300025284 Bacteria 1166
101 Ga0209675_1010434 3300025291 Bacteria 3170
102 Ga0209676_1004053 3300025292 Bacteria 8427
103 Ga0209676_1006200 3300025292 Bacteria 5979
104 Ga0209025_1000166 3300025294 Bacteria 164692
105 Ga0209025_1000843 3300025294 Bacteria 48547
106 Ga0209025_1026537 3300025294 Bacteria 2903
107 Ga0209025_1034271 3300025294 Bacteria 2322
108 Ga0209564_1000273 3300025295 Bacteria 108165
109 Ga0209564_1000501 3300025295 Bacteria 64474
110 Ga0209564_1000584 3300025295 Bacteria 57729
111 Ga0209564_1004952 3300025295 Bacteria 7866
112 Ga0209758_1000155 3300025297 Bacteria 160455
113 Ga0209758_1000218 3300025297 Bacteria 124300
114 Ga0209758_1023129 3300025297 Bacteria 2821
115 Ga0209050_1008595 3300025298 Bacteria 5410
116 Ga0209050_1014269 3300025298 Bacteria 3439
117 Ga0209050_1017792 3300025298 Bacteria 2806
118 Ga0209256_1000194 3300025299 Bacteria 116709
119 Ga0209256_1000701 3300025299 Bacteria 44561
120 Ga0209256_1000946 3300025299 Bacteria 35213
121 Ga0209256_1005098 3300025299 Bacteria 7798
122 Ga0209256_1009808 3300025299 Bacteria 4123
123 Ga0207426_1000010 3300025302 Bacteria 796003
124 Ga0207426_1000039 3300025302 Bacteria 439937
125 Ga0207426_1000065 3300025302 Bacteria 353625
126 Ga0207426_1000074 3300025302 Bacteria 323399
127 Ga0207426_1003783 3300025302 Bacteria 7855
128 Ga0209051_1000142 3300025303 Bacteria 135337
129 Ga0209051_1000691 3300025303 Bacteria 37343
130 Ga0209051_1009657 3300025303 Bacteria 4950
131 Ga0209051_1035401 3300025303 Bacteria 1858
132 Ga0209257_1003722 3300025304 Bacteria 12657
133 Ga0209257_1004318 3300025304 Bacteria 11161
134 Ga0209257_1006632 3300025304 Bacteria 7365
135 Ga0207695_10000011 3300025913 Bacteria 910221
136 Ga0207671_10000241 3300025914 Bacteria 81847
137 Ga0207644_10134331 3300025931 Bacteria 1898
138 Ga0207711_10431503 3300025941 Bacteria 1226
139 Ga0207640_10176401 3300025981 Bacteria 1598
140 Ga0209281_1000483 3300027111 Bacteria 55407
141 Ga0209281_1001582 3300027111 Bacteria 12387
142 Ga0209282_1001687 3300027666 Bacteria 12300
143 Ga0209813_10050165 3300027866 Bacteria 1301
144 Ga0307412_10182450 3300031911 Bacteria 1580
145 Ga0315914_1009665 3300031967 Bacteria 12303
146 Ga0307409_100361030 3300031995 Bacteria 1374
147 Ga0307409_100450450 3300031995 Bacteria 1242
148 Ga0307414_10070678 3300032004 Bacteria 2514
149 Ga0307414_10177654 3300032004 Bacteria 1709
150 Ga0307414_10641843 3300032004 Bacteria 956
151 Ga0315913_1008343 3300033430 Bacteria 12301
152 Ga0315915_1006342 3300033464 Bacteria 14466
153 Ga0439465_0010117 3300041413 Bacteria 2966
154 Ga0451802_0526913 3300041460 Bacteria 1455
155 Ga0451833_0336229 3300041491 Bacteria 1649
156 Ga0451835_0578895 3300041492 Bacteria 1068
157 Ga0451837_0483527 3300041494 Bacteria 2913
158 Ga0451839_0898432 3300041496 Bacteria 3250
159 Ga0451841_0430707 3300041498 Bacteria 950
160 Ga0451841_1435213 3300041498 Bacteria 1753
161 Ga0451846_34943 3300041502 Bacteria 799
162 Ga0451847_0281847 3300041503 Bacteria 1176
163 Ga0451849_1057240 3300041505 Bacteria 2646
164 Ga0451849_1084083 3300041505 Bacteria 919
165 Ga0451851_0071568 3300041507 Bacteria 1642
166 Ga0451843_0966629 3300041509 Bacteria 1087
167 Ga0451855_0370485 3300041511 Bacteria 1277
168 Ga0451855_1979018 3300041511 Bacteria 1700
169 Ga0451853_3769747 3300041512 Bacteria 3981
170 Ga0439449_0008483 3300042007 Bacteria 3905
171 Ga0466966_0210732 3300044684 Bacteria 1174
172 Ga0466963_0028089 3300044694 Bacteria 3609
173 Ga0466968_0110999 3300044735 Bacteria 1233
174 Ga0466970_0013925 3300044765 Bacteria 4126
175 Ga0466967_0352749 3300045976 Bacteria 1424
176 Ga0495638_0000092 3300046460 Bacteria 145060
177 Ga0495605_0032406 3300046474 Bacteria 2660
178 Ga0495583_0014150 3300046506 Bacteria 4415
179 Ga0495606_0014027 3300046507 Bacteria 6282
180 Ga0495610_0004049 3300046512 Bacteria 11018
181 Ga0495610_0123096 3300046512 Bacteria 1134
182 Ga0495616_0049172 3300046513 Bacteria 2115
183 Ga0495616_0062037 3300046513 Bacteria 1832
184 Ga0495620_0042263 3300046515 Bacteria 1992
185 Ga0495631_0022266 3300046518 Bacteria 2946
186 Ga0495632_0063365 3300046519 Bacteria 1790
187 Ga0495648_0010128 3300046524 Bacteria 7219
188 Ga0495663_0008013 3300046525 Bacteria 2922
189 Ga0495654_0146186 3300046530 Bacteria 1049
190 Ga0495609_0144642 3300046538 Bacteria 1013
191 Ga0495633_0062016 3300046558 Bacteria 1750
192 Ga0495668_0134281 3300046616 Bacteria 1354
193 Ga0495611_0004589 3300046648 Bacteria 5945
194 Ga0495625_0014771 3300046660 Bacteria 6216
195 Ga0495625_0042063 3300046660 Bacteria 3323
196 Ga0495625_0184650 3300046660 Bacteria 1384
197 Ga0495661_0036560 3300046665 Bacteria 3074
198 Ga0495670_0062249 3300046691 Bacteria 1877
199 Ga0495670_0067080 3300046691 Bacteria 1811
200 Ga0495660_0096162 3300046810 Bacteria 1531
201 Ga0495672_0027178 3300047320 Bacteria 3639
202 Ga0496100_0027404 3300048903 Bacteria 3504
203 Ga0496102_0013120 3300048905 Bacteria 7168
204 Ga0496102_0096630 3300048905 Bacteria 2739
205 Ga0496103_0006159 3300048906 Bacteria 7167
206 Ga0496104_0187248 3300048907 Bacteria 1981
207 Ga0496108_0267537 3300048911 Bacteria 1488
208 Ga0496110_0036645 3300048913 Bacteria 4260
209 Ga0496113_0093049 3300048916 Bacteria 2326
210 Ga0496113_0237448 3300048916 Bacteria 1454
211 Ga0496116_0010982 3300048919 Bacteria 7540
212 Ga0496116_0051894 3300048919 Bacteria 2720
213 Ga0496116_0127647 3300048919 Bacteria 1457
214 Ga0496116_0139162 3300048919 Bacteria 1369
215 Ga0496117_0000353 3300048920 Bacteria 81061
216 Ga0496117_0115947 3300048920 Bacteria 1657
217 Ga0496118_0000204 3300048921 Bacteria 104260
218 Ga0496118_0032421 3300048921 Bacteria 4304
219 Ga0496119_0001824 3300048922 Bacteria 24672
220 Ga0496119_0018339 3300048922 Bacteria 5217
221 Ga0496119_0117763 3300048922 Bacteria 1464
222 Ga0496120_0024586 3300048923 Bacteria 3752
223 Ga0496121_0000378 3300048924 Bacteria 91381
224 Ga0496121_0017548 3300048924 Bacteria 7301
225 Ga0496122_0005725 3300048925 Bacteria 14650
226 Ga0496123_0012909 3300048926 Bacteria 7068
227 Ga0496123_0242795 3300048926 Bacteria 893
228 Ga0496124_0008097 3300048927 Bacteria 11046
229 Ga0496124_0013035 3300048927 Bacteria 8146
230 Ga0496124_0050510 3300048927 Bacteria 3543
231 Ga0496124_0205888 3300048927 Bacteria 1492
232 Ga0496124_0240017 3300048927 Bacteria 1348
233 Ga0496125_0028923 3300048928 Bacteria 4991
234 Ga0496125_0042841 3300048928 Bacteria 3849
235 Ga0496125_0051744 3300048928 Bacteria 3384
236 Ga0496126_0356034 3300048929 Bacteria 1196
237 Ga0495682_0093770 3300049460 Bacteria 1078
238 Ga0501031_0091756 3300049568 Bacteria 1981
239 Ga0501036_0238212 3300049572 Bacteria 1526
240 Ga0501037_0124046 3300049573 Bacteria 1855
241 Ga0501038_0134332 3300049574 Bacteria 2028
242 Ga0501035_0063672 3300049822 Bacteria 3279
243 Ga0501044_0144394 3300049823 Bacteria 2366
244 Ga0501045_0288459 3300049824 Bacteria 1221
245 nmdc:mga03683_436_c1 3300050489 Bacteria 12047
246 nmdc:mga00v17_31221_c1 3300050491 Bacteria 1853
247 nmdc:mga0yw44_1206_c1 3300050492 Bacteria 10117
248 nmdc:mga0k408_604_c1 3300050493 Bacteria 19838
249 nmdc:mga06z11_6405_c1 3300050494 Bacteria 4788
250 nmdc:mga07m45_26315_c1 3300050496 Bacteria 3197
251 nmdc:mga07m45_286598_c1 3300050496 Bacteria 958
252 nmdc:mga07m45_5653_c1 3300050496 Bacteria 6250
253 Ga0500610_0053883 3300053079 Bacteria 2097
254 Ga0500578_0051444 3300053086 Bacteria 2639
255 Ga0500569_064372 3300053109 Bacteria 1139
256 Ga0500569_081168 3300053109 Bacteria 1037
257 Ga0500594_0068177 3300053118 Bacteria 1040
258 Ga0500658_0127848 3300053134 Bacteria 1131
259 Ga0500658_0178451 3300053134 Bacteria 966
260 Ga0500568_0000225 3300053139 Bacteria 48495
261 Ga0500577_0222366 3300053142 Bacteria 817
262 Ga0500588_0060403 3300053146 Bacteria 1213
263 Ga0500616_0001909 3300053153 Bacteria 18632
264 Ga0500627_0134854 3300053158 Bacteria 1115

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300002987 JGI25159J45721_1005240 JGI25159J45721_10052402 206
2 3300025284 Ga0209130_1000313 Ga0209130_100031333 206
3 3300025302 Ga0207426_1000065 Ga0207426_1000065304 206
4 3300003775 Ga0055524_1007414 Ga0055524_10074142 222
5 3300025299 Ga0209256_1000194 Ga0209256_100019470 222
6 3300002739 JGI25158J39367_1003035 JGI25158J39367_10030352 228
7 3300002987 JGI25159J45721_1000082 JGI25159J45721_100008235 228
8 3300003187 JGI25151J46595_10054610 JGI25151J46595_100546102 228
9 3300003354 JGI25160J50197_1000011 JGI25160J50197_100001134 228
10 3300003374 JGI25161J50226_1000478 JGI25161J50226_100047812 228
11 3300003771 Ga0055526_1000966 Ga0055526_100096622 228
12 3300003771 Ga0055526_1001988 Ga0055526_100198812 228
13 3300003781 Ga0055536_1003059 Ga0055536_10030592 228
14 3300003794 Ga0055531_10007642 Ga0055531_100076426 228
15 3300004625 Ga0055543_1000210 Ga0055543_100021016 228
16 3300005262 Ga0065165_1000018 Ga0065165_100001834 228
17 3300025208 Ga0209436_100224 Ga0209436_10022414 228
18 3300025284 Ga0209130_1000029 Ga0209130_1000029218 228
19 3300025292 Ga0209676_1004053 Ga0209676_10040532 228
20 3300025294 Ga0209025_1000843 Ga0209025_100084327 228
21 3300025295 Ga0209564_1000501 Ga0209564_100050134 228
22 3300025298 Ga0209050_1008595 Ga0209050_10085956 228
23 3300025299 Ga0209256_1000946 Ga0209256_10009462 228
24 3300025302 Ga0207426_1000074 Ga0207426_100007480 228
25 3300025303 Ga0209051_1009657 Ga0209051_10096576 228
26 3300025304 Ga0209257_1004318 Ga0209257_10043186 228
27 3300006946 Ga0079104_1003068 Ga0079104_10030689 229
28 3300006946 Ga0079104_1003374 Ga0079104_10033746 229
29 3300022739 Ga0228711_1000007 Ga0228711_10000077 229
30 3300022740 Ga0228710_1012407 Ga0228710_10124077 229
31 3300027111 Ga0209281_1000483 Ga0209281_100048332 229
32 3300027111 Ga0209281_1001582 Ga0209281_10015829 229
33 3300027666 Ga0209282_1001687 Ga0209282_10016879 229
34 3300031967 Ga0315914_1009665 Ga0315914_10096657 229
35 3300031995 Ga0307409_100450450 Ga0307409_1004504502 229
36 3300032004 Ga0307414_10641843 Ga0307414_106418431 229
37 3300033430 Ga0315913_1008343 Ga0315913_10083438 229
38 3300033464 Ga0315915_1006342 Ga0315915_10063429 229
39 3300042007 Ga0439449_0008483 Ga0439449_0008483_1555_2286 229
40 3300046507 Ga0495606_0014027 Ga0495606_0014027_1155_1853 232
41 3300046460 Ga0495638_0000092 Ga0495638_0000092_25092_25826 234
42 3300053142 Ga0500577_0222366 Ga0500577_0222366_32_766 234
43 iso_pu_bacteria 2738541317 2738946271 234
44 iso_pu_bacteria 2913308742 2913311142 234
45 iso_pu_bacteria 3003930520 3003933719 234
46 iso_pu_bacteria 8054558443 8054559894 234
47 3300006038 Ga0075365_10012294 Ga0075365_100122942 235
48 3300006186 Ga0075369_10000265 Ga0075369_100002656 235
49 3300025294 Ga0209025_1034271 Ga0209025_10342712 235
50 iso_pu_bacteria 2509276033 2509443357 235
51 iso_pu_bacteria 2513237088 2513594633 235
52 iso_pu_bacteria 2615840624 2616292373 235
53 iso_pu_bacteria 2791355259 2793312347 235
54 iso_pu_bacteria 2989349275 2989349386 235
55 iso_pu_bacteria 8018127388 8018130003 235
56 iso_pu_bacteria 2509276021 2509392564 236
57 iso_pu_bacteria 2510461076 2510894797 236
58 iso_pu_bacteria 2510917028 2511187295 236
59 iso_pu_bacteria 2513237084 2513572402 236
60 iso_pu_bacteria 2513237085 2513577383 236
61 iso_pu_bacteria 2513237093 2513629986 236
62 iso_pu_bacteria 2513237103 2513708626 236
63 iso_pu_bacteria 2513237138 2513864694 236
64 iso_pu_bacteria 2513237162 2514021733 236
65 iso_pu_bacteria 2515075009 2515112375 236
66 iso_pu_bacteria 2515154113 2515632727 236
67 iso_pu_bacteria 2515154114 2515639875 236
68 iso_pu_bacteria 2515154116 2515661224 236
69 iso_pu_bacteria 2515154134 2515744230 236
70 iso_pu_bacteria 2516653077 2517036107 236
71 iso_pu_bacteria 2516653085 2517076497 236
72 iso_pu_bacteria 2517093000 2517095263 236
73 iso_pu_bacteria 2517287029 2517406871 236
74 iso_pu_bacteria 2519899620 2520379261 236
75 iso_pu_bacteria 2529292951 2530645621 236
76 iso_pu_bacteria 2534681796 2535516546 236
77 iso_pu_bacteria 2582581294 2585200217 236
78 iso_pu_bacteria 2582581866 2585396697 236
79 iso_pu_bacteria 2582581867 2585402058 236
80 iso_pu_bacteria 2585427526 2585527737 236
81 iso_pu_bacteria 2585427528 2585537631 236
82 iso_pu_bacteria 2585427590 2585821843 236
83 iso_pu_bacteria 2585427593 2585835581 236
84 iso_pu_bacteria 2585427633 2585995720 236
85 iso_pu_bacteria 2585427634 2586000288 236
86 iso_pu_bacteria 2718217927 2719385878 236
87 iso_pu_bacteria 2718217997 2719665692 236
88 iso_pu_bacteria 2718218009 2719732015 236
89 iso_pu_bacteria 2718218199 2720492112 236
90 iso_pu_bacteria 2718218232 2720613377 236
91 iso_pu_bacteria 2718218233 2720620254 236
92 iso_pu_bacteria 2718218235 2720631679 236
93 iso_pu_bacteria 2718218269 2720775407 236
94 iso_pu_bacteria 2718218363 2721147360 236
95 iso_pu_bacteria 2718218365 2721158894 236
96 iso_pu_bacteria 2718218366 2721164278 236
97 iso_pu_bacteria 2718218423 2721399657 236
98 iso_pu_bacteria 2721755514 2722840448 236
99 iso_pu_bacteria 2721755556 2723027025 236
100 iso_pu_bacteria 2721755684 2723560637 236
101 iso_pu_bacteria 2721755685 2723567226 236
102 iso_pu_bacteria 2721755809 2724038470 236
103 iso_pu_bacteria 2721755810 2724044771 236
104 iso_pu_bacteria 2721755819 2724090014 236
105 iso_pu_bacteria 2721755822 2724104491 236
106 iso_pu_bacteria 2721755823 2724110285 236
107 iso_pu_bacteria 2724679232 2725948554 236
108 iso_pu_bacteria 2728369352 2730107961 236
109 iso_pu_bacteria 2728369365 2730164503 236
110 iso_pu_bacteria 2728369397 2730298526 236
111 iso_pu_bacteria 2738541333 2739036594 236
112 iso_pu_bacteria 2765235942 2766067457 236
113 iso_pu_bacteria 2791355260 2793324918 236
114 iso_pu_bacteria 2791355261 2793330622 236
115 iso_pu_bacteria 2791355262 2793335969 236
116 iso_pu_bacteria 2791355264 2793348985 236
117 iso_pu_bacteria 2791355265 2793352984 236
118 iso_pu_bacteria 2791355266 2793361078 236
119 iso_pu_bacteria 2791355267 2793369172 236
120 iso_pu_bacteria 2802429606 2805933486 236
121 iso_pu_bacteria 2802429633 2806046144 236
122 iso_pu_bacteria 2802429634 2806054524 236
123 iso_pu_bacteria 2802429635 2806060528 236
124 iso_pu_bacteria 2802429636 2806065014 236
125 iso_pu_bacteria 2802429637 2806072274 236
126 iso_pu_bacteria 2838016132 2838021383 236
127 iso_pu_bacteria 2838022645 2838028059 236
128 iso_pu_bacteria 2838042994 2838043535 236
129 iso_pu_bacteria 2838048938 2838053446 236
130 iso_pu_bacteria 2838061910 2838065723 236
131 iso_pu_bacteria 2838068647 2838074561 236
132 iso_pu_bacteria 2838668709 2838671942 236
133 iso_pu_bacteria 2838680041 2838682123 236
134 iso_pu_bacteria 2838686498 2838691881 236
135 iso_pu_bacteria 2838694306 2838696695 236
136 iso_pu_bacteria 2838701080 2838704778 236
137 iso_pu_bacteria 2838707686 2838710066 236
138 iso_pu_bacteria 2838729681 2838732972 236
139 iso_pu_bacteria 2838742623 2838745850 236
140 iso_pu_bacteria 2841851746 2841855691 236
141 iso_pu_bacteria 2841864319 2841864443 236
142 iso_pu_bacteria 2842077413 2842078239 236
143 iso_pu_bacteria 2842110456 2842114310 236
144 iso_pu_bacteria 2842118031 2842119253 236
145 iso_pu_bacteria 2842146304 2842148482 236
146 iso_pu_bacteria 2842156927 2842157317 236
147 iso_pu_bacteria 2842163707 2842167976 236
148 iso_pu_bacteria 2842180545 2842181099 236
149 iso_pu_bacteria 2842192696 2842194426 236
150 iso_pu_bacteria 2842198810 2842204018 236
151 iso_pu_bacteria 2842205361 2842205951 236
152 iso_pu_bacteria 2842217011 2842217343 236
153 iso_pu_bacteria 2842229732 2842230843 236
154 iso_pu_bacteria 2842237096 2842239478 236
155 iso_pu_bacteria 2842243621 2842245051 236
156 iso_pu_bacteria 2842250916 2842254458 236
157 iso_pu_bacteria 2842257432 2842258864 236
158 iso_pu_bacteria 2842264693 2842265958 236
159 iso_pu_bacteria 2842271015 2842276466 236
160 iso_pu_bacteria 2842278818 2842279408 236
161 iso_pu_bacteria 2842285085 2842286057 236
162 iso_pu_bacteria 2842291075 2842291901 236
163 iso_pu_bacteria 2842304105 2842304394 236
164 iso_pu_bacteria 2842311132 2842314323 236
165 iso_pu_bacteria 2842317721 2842317822 236
166 iso_pu_bacteria 2842341865 2842345209 236
167 iso_pu_bacteria 2842363717 2842364653 236
168 iso_pu_bacteria 2842370503 2842372690 236
169 iso_pu_bacteria 2842377471 2842378297 236
170 iso_pu_bacteria 2842384541 2842385762 236
171 iso_pu_bacteria 2842402390 2842403417 236
172 iso_pu_bacteria 2842409023 2842409210 236
173 iso_pu_bacteria 2842415677 2842415864 236
174 iso_pu_bacteria 2842422224 2842427448 236
175 iso_pu_bacteria 2842428310 2842429405 236
176 iso_pu_bacteria 2842434925 2842436018 236
177 iso_pu_bacteria 2842441272 2842442365 236
178 iso_pu_bacteria 2842447887 2842450656 236
179 iso_pu_bacteria 2842462802 2842463826 236
180 iso_pu_bacteria 2842469257 2842470347 236
181 iso_pu_bacteria 2842495871 2842496092 236
182 iso_pu_bacteria 2844454524 2844459063 236
183 iso_pu_bacteria 2854896431 2854899143 236
184 iso_pu_bacteria 2854916844 2854917032 236
185 iso_pu_bacteria 2857516855 2857523655 236
186 iso_pu_bacteria 2899803654 2899807723 236
187 iso_pu_bacteria 2919171160 2919175270 236
188 iso_pu_bacteria 2923556063 2923557978 236
189 iso_pu_bacteria 2933570622 2933571668 236
190 iso_pu_bacteria 2933586486 2933590405 236
191 iso_pu_bacteria 2933599457 2933605037 236
192 iso_pu_bacteria 2935894831 2935897450 236
193 iso_pu_bacteria 2935901341 2935905585 236
194 iso_pu_bacteria 2936367885 2936372599 236
195 iso_pu_bacteria 2936375103 2936376404 236
196 iso_pu_bacteria 2996887358 2996891750 236
197 iso_pu_bacteria 2996893221 2996894078 236
198 iso_pu_bacteria 639633055 639648634 236
199 iso_pu_bacteria 8005258706 8005263080 236
200 iso_pu_bacteria 8005275841 8005280659 236
201 iso_pu_bacteria 8005282627 8005287019 236
202 iso_pu_bacteria 8005289223 8005293179 236
203 iso_pu_bacteria 8005301065 8005302647 236
204 iso_pu_bacteria 8005307578 8005309822 236
205 iso_pu_bacteria 8005321885 8005326277 236
206 iso_pu_bacteria 8005376324 8005379319 236
207 iso_pu_bacteria 8005382845 8005388415 236
208 iso_pu_bacteria 8005430974 8005434549 236
209 iso_pu_bacteria 8005460587 8005463046 236
210 iso_pu_bacteria 8005497431 8005500420 236
211 iso_pu_bacteria 8005542996 8005545197 236
212 iso_pu_bacteria 8005556819 8005557612 236
213 iso_pu_bacteria 8005563573 8005568785 236
214 iso_pu_bacteria 8005570704 8005574329 236
215 iso_pu_bacteria 8005619151 8005621795 236
216 iso_pu_bacteria 8005626139 8005626613 236
217 iso_pu_bacteria 8005668836 8005671838 236
218 iso_pu_bacteria 8005688590 8005694661 236
219 iso_pu_bacteria 8005695170 8005699920 236
220 iso_pu_bacteria 8018163183 8018166701 236
221 iso_pu_bacteria 8018176218 8018179745 236
222 iso_pu_bacteria 8023680758 8023685286 236
223 iso_pu_bacteria 8024479707 8024483443 236
224 iso_pu_bacteria 8024501048 8024506510 236
225 iso_pu_bacteria 8056375014 8056376711 236
226 iso_pu_bacteria 8056382006 8056387916 236
227 iso_pu_bacteria 8056875544 8056877491 236
228 iso_pu_bacteria 8057874678 8057874964 236
229 iso_pu_bacteria 2510065057 2510303337 237
230 iso_pu_bacteria 2513237144 2513912471 237
231 iso_pu_bacteria 2513237146 2513926168 237
232 iso_pu_bacteria 2513237159 2513997138 237
233 iso_pu_bacteria 2515154107 2515608708 237
234 iso_pu_bacteria 2524023209 2524460218 237
235 iso_pu_bacteria 2551306090 2551717864 237
236 iso_pu_bacteria 2551306090 2551719344 237
237 iso_pu_bacteria 2582581306 2585268087 237
238 iso_pu_bacteria 2582581308 2585277268 237
239 iso_pu_bacteria 2582581315 2585323724 237
240 iso_pu_bacteria 2582581316 2585331699 237
241 iso_pu_bacteria 2582581865 2585386811 237
242 iso_pu_bacteria 2585427527 2585533998 237
243 iso_pu_bacteria 2585427530 2585552152 237
244 iso_pu_bacteria 2599185170 2599417645 237
245 iso_pu_bacteria 2599185352 2600193156 237
246 iso_pu_bacteria 2615840626 2616308645 237
247 iso_pu_bacteria 2615840698 2616557053 237
248 iso_pu_bacteria 2617270742 2617385739 237
249 iso_pu_bacteria 2643221618 2644107771 237
250 iso_pu_bacteria 2643221626 2644148557 237
251 iso_pu_bacteria 2643221637 2644210268 237
252 iso_pu_bacteria 2643221655 2644309165 237
253 iso_pu_bacteria 2643221659 2644332992 237
254 iso_pu_bacteria 2643221688 2644491747 237
255 iso_pu_bacteria 2643221698 2644545836 237
256 iso_pu_bacteria 2643221712 2644615107 237
257 iso_pu_bacteria 2643221718 2644653820 237
258 iso_pu_bacteria 2643221723 2644672532 237
259 iso_pu_bacteria 2657244999 2657685882 237
260 iso_pu_bacteria 2775507266 2778174079 237
261 iso_pu_bacteria 2791355082 2792581836 237
262 iso_pu_bacteria 2802429268 2804752330 237
263 iso_pu_bacteria 2818991448 2819608925 237
264 iso_pu_bacteria 2818991453 2819637844 237
265 iso_pu_bacteria 2838035591 2838038143 237
266 iso_pu_bacteria 2838074704 2838078946 237
267 iso_pu_bacteria 2838661181 2838667172 237
268 iso_pu_bacteria 2842298080 2842301979 237
269 iso_pu_bacteria 2842357229 2842357554 237
270 iso_pu_bacteria 2842482326 2842484774 237
271 iso_pu_bacteria 2842509118 2842511370 237
272 iso_pu_bacteria 2842521101 2842522619 237
273 iso_pu_bacteria 2844163670 2844167512 237
274 iso_pu_bacteria 2852387548 2852389963 237
275 iso_pu_bacteria 2855839649 2855841291 237
276 iso_pu_bacteria 2913295892 2913300892 237
277 iso_pu_bacteria 2915993759 2916000738 237
278 iso_pu_bacteria 2920760137 2920766142 237
279 iso_pu_bacteria 2920822456 2920824655 237
280 iso_pu_bacteria 2921201388 2921206161 237
281 iso_pu_bacteria 2921257292 2921259610 237
282 iso_pu_bacteria 2924158325 2924163069 237
283 iso_pu_bacteria 2933016740 2933021190 237
284 iso_pu_bacteria 2936996657 2936999578 237
285 iso_pu_bacteria 2937023124 2937028922 237
286 iso_pu_bacteria 2937049772 2937052085 237
287 iso_pu_bacteria 2937063883 2937065854 237
288 iso_pu_bacteria 2937091812 2937092807 237
289 iso_pu_bacteria 2937098957 2937101179 237
290 iso_pu_bacteria 2937106411 2937108005 237
291 iso_pu_bacteria 2941499720 2941503613 237
292 iso_pu_bacteria 2957388812 2957391802 237
293 iso_pu_bacteria 2957395598 2957396637 237
294 iso_pu_bacteria 2964615318 2964616935 237
295 iso_pu_bacteria 2964649959 2964651677 237
296 iso_pu_bacteria 2964656573 2964661615 237
297 iso_pu_bacteria 2967664464 2967666990 237
298 iso_pu_bacteria 2967678726 2967685349 237
299 iso_pu_bacteria 2967693043 2967697457 237
300 iso_pu_bacteria 2967714385 2967716829 237
301 iso_pu_bacteria 2967721400 2967726378 237
302 iso_pu_bacteria 2967735183 2967740050 237
303 iso_pu_bacteria 2967755722 2967758699 237
304 iso_pu_bacteria 2967762386 2967768576 237
305 iso_pu_bacteria 2970019648 2970020390 237
306 iso_pu_bacteria 2970033650 2970034441 237
307 iso_pu_bacteria 2970040964 2970046913 237
308 iso_pu_bacteria 2970068827 2970070852 237
309 iso_pu_bacteria 2970102677 2970107449 237
310 iso_pu_bacteria 2970116247 2970121534 237
311 iso_pu_bacteria 2970129317 2970133419 237
312 iso_pu_bacteria 2970184632 2970189338 237
313 iso_pu_bacteria 2977551784 2977556388 237
314 iso_pu_bacteria 2977579622 2977584239 237
315 iso_pu_bacteria 3005409236 3005415083 237
316 iso_pu_bacteria 3005416602 3005420043 237
317 iso_pu_bacteria 643692032 643825922 237
318 iso_pu_bacteria 8005314921 8005316994 237
319 iso_pu_bacteria 8005484373 8005485210 237
320 iso_pu_bacteria 8005645114 8005649806 237
321 iso_pu_bacteria 8005682033 8005683125 237
322 iso_pu_bacteria 8046767195 8046773727 237
323 iso_pu_bacteria 8049293176 8049294890 237
324 iso_pu_bacteria 8057575449 8057575972 237
325 3300009766 Ga0123342_1010819 Ga0123342_10108197 238
326 3300041491 Ga0451833_0336229 Ga0451833_0336229_892_1611 238
327 3300041494 Ga0451837_0483527 Ga0451837_0483527_47_766 238
328 3300041496 Ga0451839_0898432 Ga0451839_0898432_2489_3208 238
329 3300041507 Ga0451851_0071568 Ga0451851_0071568_853_1572 238
330 3300041509 Ga0451843_0966629 Ga0451843_0966629_61_780 238
331 iso_pu_bacteria 2643221689 2644500872 238
332 iso_pu_bacteria 2791355263 2793341613 238
333 iso_pu_bacteria 2919100787 2919102459 238
334 iso_pu_bacteria 2936381700 2936387114 238
335 3300003187 JGI25151J46595_10001347 JGI25151J46595_1000134714 239
336 3300003215 JGI25153J46596_10005132 JGI25153J46596_100051325 239
337 3300003354 JGI25160J50197_1003560 JGI25160J50197_10035607 239
338 3300003771 Ga0055526_1000490 Ga0055526_100049021 239
339 3300003771 Ga0055526_1004931 Ga0055526_10049316 239
340 3300003775 Ga0055524_1001266 Ga0055524_100126621 239
341 3300003775 Ga0055524_1011991 Ga0055524_10119913 239
342 3300003790 Ga0055528_1000284 Ga0055528_100028441 239
343 3300003790 Ga0055528_1014147 Ga0055528_10141472 239
344 3300003791 Ga0055530_10018949 Ga0055530_100189492 239
345 3300003792 Ga0055540_1000510 Ga0055540_100051020 239
346 3300003792 Ga0055540_1019089 Ga0055540_10190891 239
347 3300004625 Ga0055543_1000668 Ga0055543_100066824 239
348 3300006038 Ga0075365_10001032 Ga0075365_1000103211 239
349 3300006042 Ga0075368_10089948 Ga0075368_100899481 239
350 3300006048 Ga0075363_100027690 Ga0075363_1000276904 239
351 3300006051 Ga0075364_10161410 Ga0075364_101614102 239
352 3300006177 Ga0075362_10000141 Ga0075362_100001414 239
353 3300006178 Ga0075367_10002608 Ga0075367_1000260812 239
354 3300006186 Ga0075369_10001683 Ga0075369_1000168310 239
355 3300006195 Ga0075366_10005088 Ga0075366_100050884 239
356 3300006353 Ga0075370_10002484 Ga0075370_100024842 239
357 3300006353 Ga0075370_10021046 Ga0075370_100210462 239
358 3300025245 Ga0207425_1007877 Ga0207425_10078772 239
359 3300025273 Ga0209673_1000013 Ga0209673_1000013351 239
360 3300025273 Ga0209673_1000296 Ga0209673_10002965 239
361 3300025273 Ga0209673_1001255 Ga0209673_100125519 239
362 3300025273 Ga0209673_1001781 Ga0209673_10017815 239
363 3300025291 Ga0209675_1010434 Ga0209675_10104345 239
364 3300025294 Ga0209025_1000166 Ga0209025_1000166108 239
365 3300025295 Ga0209564_1000273 Ga0209564_10002735 239
366 3300025295 Ga0209564_1000584 Ga0209564_100058413 239
367 3300025297 Ga0209758_1000218 Ga0209758_1000218100 239
368 3300025298 Ga0209050_1014269 Ga0209050_10142692 239
369 3300025299 Ga0209256_1000701 Ga0209256_100070124 239
370 3300025299 Ga0209256_1005098 Ga0209256_10050985 239
371 3300025302 Ga0207426_1000039 Ga0207426_1000039198 239
372 3300025303 Ga0209051_1000142 Ga0209051_100014216 239
373 3300025303 Ga0209051_1035401 Ga0209051_10354012 239
374 3300025304 Ga0209257_1003722 Ga0209257_10037222 239
375 3300027866 Ga0209813_10050165 Ga0209813_100501652 239
376 3300041460 Ga0451802_0526913 Ga0451802_0526913_668_1393 239
377 3300041492 Ga0451835_0578895 Ga0451835_0578895_115_840 239
378 3300041498 Ga0451841_0430707 Ga0451841_0430707_86_865 239
379 3300041498 Ga0451841_1435213 Ga0451841_1435213_143_868 239
380 3300041502 Ga0451846_34943 Ga0451846_34943_57_782 239
381 3300041503 Ga0451847_0281847 Ga0451847_0281847_417_1142 239
382 3300041505 Ga0451849_1057240 Ga0451849_1057240_159_884 239
383 3300041505 Ga0451849_1084083 Ga0451849_1084083_47_772 239
384 3300041511 Ga0451855_0370485 Ga0451855_0370485_288_1046 239
385 3300041511 Ga0451855_1979018 Ga0451855_1979018_90_815 239
386 3300041512 Ga0451853_3769747 Ga0451853_3769747_3228_3953 239
387 3300046474 Ga0495605_0032406 Ga0495605_0032406_671_1396 239
388 3300046512 Ga0495610_0123096 Ga0495610_0123096_299_1024 239
389 3300046513 Ga0495616_0049172 Ga0495616_0049172_1357_2082 239
390 3300046515 Ga0495620_0042263 Ga0495620_0042263_1069_1794 239
391 3300046524 Ga0495648_0010128 Ga0495648_0010128_3195_3920 239
392 3300046525 Ga0495663_0008013 Ga0495663_0008013_59_784 239
393 3300046530 Ga0495654_0146186 Ga0495654_0146186_74_799 239
394 3300046538 Ga0495609_0144642 Ga0495609_0144642_145_936 239
395 3300046558 Ga0495633_0062016 Ga0495633_0062016_473_1264 239
396 3300046616 Ga0495668_0134281 Ga0495668_0134281_214_939 239
397 3300046660 Ga0495625_0184650 Ga0495625_0184650_421_1212 239
398 3300046665 Ga0495661_0036560 Ga0495661_0036560_1953_2744 239
399 3300046691 Ga0495670_0062249 Ga0495670_0062249_547_1338 239
400 3300048919 Ga0496116_0139162 Ga0496116_0139162_579_1337 239
401 3300048920 Ga0496117_0115947 Ga0496117_0115947_801_1559 239
402 3300048921 Ga0496118_0032421 Ga0496118_0032421_2912_3670 239
403 3300049574 Ga0501038_0134332 Ga0501038_0134332_112_840 239
404 3300049823 Ga0501044_0144394 Ga0501044_0144394_1248_1976 239
405 3300050489 nmdc:mga03683_436_c1 nmdc:mga03683_436_c1_4694_5482 239
406 3300050491 nmdc:mga00v17_31221_c1 nmdc:mga00v17_31221_c1_237_1025 239
407 3300050492 nmdc:mga0yw44_1206_c1 nmdc:mga0yw44_1206_c1_1068_1856 239
408 3300050493 nmdc:mga0k408_604_c1 nmdc:mga0k408_604_c1_7387_8175 239
409 3300050494 nmdc:mga06z11_6405_c1 nmdc:mga06z11_6405_c1_2969_3757 239
410 3300050496 nmdc:mga07m45_26315_c1 nmdc:mga07m45_26315_c1_2093_2851 239
411 3300050496 nmdc:mga07m45_5653_c1 nmdc:mga07m45_5653_c1_3645_4433 239
412 3300053118 Ga0500594_0068177 Ga0500594_0068177_85_807 239
413 3300053134 Ga0500658_0178451 Ga0500658_0178451_168_893 239
414 iso_pu_bacteria 2510065019 2510133411 239
415 3300003790 Ga0055528_1003629 Ga0055528_10036295 240
416 3300003791 Ga0055530_10006020 Ga0055530_100060207 240
417 3300003792 Ga0055540_1004618 Ga0055540_10046184 240
418 3300003794 Ga0055531_10003692 Ga0055531_100036922 240
419 3300006178 Ga0075367_10052656 Ga0075367_100526562 240
420 3300006353 Ga0075370_10134059 Ga0075370_101340593 240
421 3300009011 Ga0105251_10041196 Ga0105251_100411963 240
422 3300009553 Ga0105249_10176075 Ga0105249_101760753 240
423 3300025258 Ga0209129_1006116 Ga0209129_10061164 240
424 3300025273 Ga0209673_1008078 Ga0209673_10080782 240
425 3300025273 Ga0209673_1045716 Ga0209673_10457162 240
426 3300025292 Ga0209676_1006200 Ga0209676_10062008 240
427 3300025294 Ga0209025_1026537 Ga0209025_10265373 240
428 3300025295 Ga0209564_1004952 Ga0209564_10049527 240
429 3300025297 Ga0209758_1000155 Ga0209758_100015529 240
430 3300025297 Ga0209758_1023129 Ga0209758_10231293 240
431 3300025298 Ga0209050_1017792 Ga0209050_10177922 240
432 3300025299 Ga0209256_1009808 Ga0209256_10098082 240
433 3300025302 Ga0207426_1003783 Ga0207426_10037836 240
434 3300025303 Ga0209051_1000691 Ga0209051_100069113 240
435 3300025304 Ga0209257_1006632 Ga0209257_10066322 240
436 3300025931 Ga0207644_10134331 Ga0207644_101343312 240
437 3300025941 Ga0207711_10431503 Ga0207711_104315031 240
438 3300031911 Ga0307412_10182450 Ga0307412_101824502 240
439 3300031995 Ga0307409_100361030 Ga0307409_1003610302 240
440 3300032004 Ga0307414_10177654 Ga0307414_101776542 240
441 3300044735 Ga0466968_0110999 Ga0466968_0110999_264_998 240
442 3300048905 Ga0496102_0096630 Ga0496102_0096630_40_762 240
443 3300048907 Ga0496104_0187248 Ga0496104_0187248_264_986 240
444 3300048911 Ga0496108_0267537 Ga0496108_0267537_204_926 240
445 3300048913 Ga0496110_0036645 Ga0496110_0036645_195_917 240
446 3300048916 Ga0496113_0237448 Ga0496113_0237448_649_1371 240
447 3300048919 Ga0496116_0051894 Ga0496116_0051894_1536_2258 240
448 3300048922 Ga0496119_0018339 Ga0496119_0018339_899_1621 240
449 3300048926 Ga0496123_0242795 Ga0496123_0242795_142_864 240
450 3300048927 Ga0496124_0013035 Ga0496124_0013035_6430_7152 240
451 3300048927 Ga0496124_0050510 Ga0496124_0050510_1018_1755 240
452 3300048927 Ga0496124_0205888 Ga0496124_0205888_224_946 240
453 3300048927 Ga0496124_0240017 Ga0496124_0240017_227_964 240
454 3300048928 Ga0496125_0028923 Ga0496125_0028923_761_1483 240
455 3300048929 Ga0496126_0356034 Ga0496126_0356034_104_826 240
456 3300050496 nmdc:mga07m45_286598_c1 nmdc:mga07m45_286598_c1_202_924 240
457 3300053109 Ga0500569_064372 Ga0500569_064372_196_918 240
458 iso_pu_bacteria 2510461069 2510842548 240
459 iso_pu_bacteria 2818991272 2819241583 240
460 iso_pu_bacteria 8005246636 8005248638 240
461 3300002705 JGI25156J39149_1000001 JGI25156J39149_1000001258 241
462 3300002738 JGI25154J39366_1000011 JGI25154J39366_1000011125 241
463 3300002741 JGI25157J39369_1000030 JGI25157J39369_100003060 241
464 3300002987 JGI25159J45721_1000850 JGI25159J45721_10008506 241
465 3300003214 JGI25165J46597_1001001 JGI25165J46597_10010016 241
466 3300003214 JGI25165J46597_1001852 JGI25165J46597_10018522 241
467 3300003320 rootH2_10052347 rootH2_100523474 241
468 3300003322 rootL2_10073726 rootL2_100737264 241
469 3300003323 rootH1_10000039 rootH1_100000391 241
470 3300003323 rootH1_10014639 rootH1_100146394 241
471 3300003354 JGI25160J50197_1000010 JGI25160J50197_100001036 241
472 3300003374 JGI25161J50226_1000006 JGI25161J50226_100000636 241
473 3300004625 Ga0055543_1000281 Ga0055543_100028136 241
474 3300005262 Ga0065165_1000485 Ga0065165_10004853 241
475 3300005563 Ga0068855_100229026 Ga0068855_1002290263 241
476 3300005578 Ga0068854_100206148 Ga0068854_1002061483 241
477 3300005616 Ga0068852_100283842 Ga0068852_1002838422 241
478 3300005834 Ga0068851_10043210 Ga0068851_100432102 241
479 3300009093 Ga0105240_10000005 Ga0105240_10000005661 241
480 3300009148 Ga0105243_10056293 Ga0105243_100562932 241
481 3300009545 Ga0105237_10003410 Ga0105237_1000341010 241
482 3300010375 Ga0105239_10010354 Ga0105239_100103548 241
483 3300013104 Ga0157370_10000046 Ga0157370_10000046115 241
484 3300013306 Ga0163162_10295444 Ga0163162_102954443 241
485 3300014497 Ga0182008_10022144 Ga0182008_100221444 241
486 3300015262 Ga0182007_10001276 Ga0182007_1000127612 241
487 3300015265 Ga0182005_1000769 Ga0182005_10007697 241
488 3300025206 Ga0209435_100012 Ga0209435_100012124 241
489 3300025233 Ga0209437_100165 Ga0209437_10016569 241
490 3300025246 Ga0209646_1000026 Ga0209646_1000026124 241
491 3300025250 Ga0209026_1000014 Ga0209026_1000014124 241
492 3300025253 Ga0209677_100511 Ga0209677_10051117 241
493 3300025256 Ga0209759_1000012 Ga0209759_1000012124 241
494 3300025261 Ga0209233_1000069 Ga0209233_1000069199 241
495 3300025261 Ga0209233_1000195 Ga0209233_100019579 241
496 3300025284 Ga0209130_1000021 Ga0209130_1000021229 241
497 3300025284 Ga0209130_1028724 Ga0209130_10287242 241
498 3300025302 Ga0207426_1000010 Ga0207426_1000010129 241
499 3300025913 Ga0207695_10000011 Ga0207695_10000011256 241
500 3300025914 Ga0207671_10000241 Ga0207671_1000024165 241
501 3300025981 Ga0207640_10176401 Ga0207640_101764011 241
502 3300032004 Ga0307414_10070678 Ga0307414_100706782 241
503 3300041413 Ga0439465_0010117 Ga0439465_0010117_1467_2192 241
504 3300044684 Ga0466966_0210732 Ga0466966_0210732_245_970 241
505 3300044694 Ga0466963_0028089 Ga0466963_0028089_2103_2828 241
506 3300044765 Ga0466970_0013925 Ga0466970_0013925_726_1451 241
507 3300045976 Ga0466967_0352749 Ga0466967_0352749_591_1316 241
508 3300046506 Ga0495583_0014150 Ga0495583_0014150_3104_3838 241
509 3300046512 Ga0495610_0004049 Ga0495610_0004049_1138_1980 241
510 3300046513 Ga0495616_0062037 Ga0495616_0062037_102_836 241
511 3300046518 Ga0495631_0022266 Ga0495631_0022266_1140_1874 241
512 3300046519 Ga0495632_0063365 Ga0495632_0063365_1011_1745 241
513 3300046648 Ga0495611_0004589 Ga0495611_0004589_1182_1916 241
514 3300046660 Ga0495625_0014771 Ga0495625_0014771_3142_3876 241
515 3300046660 Ga0495625_0042063 Ga0495625_0042063_1554_2318 241
516 3300046691 Ga0495670_0067080 Ga0495670_0067080_223_957 241
517 3300046810 Ga0495660_0096162 Ga0495660_0096162_589_1323 241
518 3300047320 Ga0495672_0027178 Ga0495672_0027178_188_922 241
519 3300048903 Ga0496100_0027404 Ga0496100_0027404_266_1138 241
520 3300048905 Ga0496102_0013120 Ga0496102_0013120_3685_4557 241
521 3300048906 Ga0496103_0006159 Ga0496103_0006159_3741_4613 241
522 3300048916 Ga0496113_0093049 Ga0496113_0093049_399_1271 241
523 3300048919 Ga0496116_0010982 Ga0496116_0010982_487_1359 241
524 3300048919 Ga0496116_0127647 Ga0496116_0127647_270_1097 241
525 3300048920 Ga0496117_0000353 Ga0496117_0000353_59105_59977 241
526 3300048921 Ga0496118_0000204 Ga0496118_0000204_84457_85329 241
527 3300048922 Ga0496119_0001824 Ga0496119_0001824_5491_6363 241
528 3300048922 Ga0496119_0117763 Ga0496119_0117763_491_1318 241
529 3300048923 Ga0496120_0024586 Ga0496120_0024586_267_1139 241
530 3300048924 Ga0496121_0000378 Ga0496121_0000378_29973_30845 241
531 3300048924 Ga0496121_0017548 Ga0496121_0017548_426_1253 241
532 3300048925 Ga0496122_0005725 Ga0496122_0005725_551_1423 241
533 3300048926 Ga0496123_0012909 Ga0496123_0012909_2576_3448 241
534 3300048927 Ga0496124_0008097 Ga0496124_0008097_6097_6969 241
535 3300048928 Ga0496125_0042841 Ga0496125_0042841_402_1274 241
536 3300048928 Ga0496125_0051744 Ga0496125_0051744_349_1176 241
537 3300049460 Ga0495682_0093770 Ga0495682_0093770_23_757 241
538 3300049568 Ga0501031_0091756 Ga0501031_0091756_478_1335 241
539 3300049572 Ga0501036_0238212 Ga0501036_0238212_321_1178 241
540 3300049573 Ga0501037_0124046 Ga0501037_0124046_82_939 241
541 3300049822 Ga0501035_0063672 Ga0501035_0063672_2040_2897 241
542 3300049824 Ga0501045_0288459 Ga0501045_0288459_127_984 241
543 3300053079 Ga0500610_0053883 Ga0500610_0053883_1111_1845 241
544 3300053086 Ga0500578_0051444 Ga0500578_0051444_1702_2436 241
545 3300053109 Ga0500569_081168 Ga0500569_081168_99_833 241
546 3300053134 Ga0500658_0127848 Ga0500658_0127848_360_1094 241
547 3300053139 Ga0500568_0000225 Ga0500568_0000225_3620_4354 241
548 3300053146 Ga0500588_0060403 Ga0500588_0060403_16_750 241
549 3300053153 Ga0500616_0001909 Ga0500616_0001909_2733_3467 241
550 3300053158 Ga0500627_0134854 Ga0500627_0134854_262_996 241
551 iso_pu_bacteria 2643221653 2644298551 241
552 iso_pu_bacteria 2643221719 2644656780 241
553 iso_pu_bacteria 2989776772 2989779081 241

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF10028

DUF2270

Predicted integral membrane protein (DUF2270)

77

268

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
8ek4-assembly1.cif.gz_A de novo designed ice-binding proteins from twist-constrained helices 0.5541 37 176
8ek4-assembly1.cif.gz_A de novo designed ice-binding proteins from twist-constrained helices 0.5488 37 176
6zw4-assembly1.cif.gz_E c14 symmetry: bacterial vipp1 and pspa are members of the ancient escrt-iii membrane-remodeling superfamily. 0.4401 27 220
6vvz-assembly1.cif.gz_D mycobacterium tuberculosis rnap s456l mutant transcription initiation intermediate structure with sorangicin 0.4394 31 199
6zw4-assembly1.cif.gz_C c14 symmetry: bacterial vipp1 and pspa are members of the ancient escrt-iii membrane-remodeling superfamily. 0.4345 27 221
ID Description Score Start End Superfamily
af_M0R5H1_717_841_1.20.58.1540 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;Actin interacting protein 3, C-terminal domain 0.6222 31 170 1.20.58.1540
af_M0R5H1_717_841_1.20.58.1540 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;Actin interacting protein 3, C-terminal domain 0.5888 31 170 1.20.58.1540
af_Q5T5P2_704_823_1.20.58.1540 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;Actin interacting protein 3, C-terminal domain 0.5785 36 170 1.20.58.1540
af_Q5T5P2_704_823_1.20.58.1540 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;Actin interacting protein 3, C-terminal domain 0.5462 36 170 1.20.58.1540
af_P0A9K7_1_117_1.20.58.220 Mainly Alpha;Up-down Bundle;Methane Monooxygenase Hydroxylase; Chain G, domain 1;Phosphate transport system protein phou homolog 2; domain 2 0.53 26 169 1.20.58.220
ID Description Score Start End GO Terms
AF-A0A2V6BEZ5-F1-model_v4 Integral membrane-like protein 0.9719 34 151 GO:0016020
AF-A0A2V5T0Q4-F1-model_v4 Integral membrane-like protein 0.9694 34 165 GO:0016020
AF-A0A3L7Y470-F1-model_v4 DUF2270 domain-containing protein 0.9541 26 224 GO:0005886
AF-A0A2R6ND35-F1-model_v4 Uncharacterized protein 0.9451 34 146 GO:0016020
AF-A0A246BL79-F1-model_v4 DUF2270 domain-containing protein 0.9441 27 225 GO:0016020

Feature Viewer

pLDDT pTM Quality
79.87 0.72 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map