F462836

General Info

Members Datasets Scaffolds Average Seq Length
553 260 1106 144

Family's Representative Sequence

Representative Sequence 3300005564|Ga0070664_100229483|Ga0070664_1002294834
Length 157
Sequence VIRLGSLAGYPFEGPRLLGGWTPPTSAAVYAILFKPEPETKPEKYAVTYVDHADDLTAARLPFLHPRAQCWIQRAGSRWKVYIATYEVPGGLRSHREQIAQELCAIYRPRCNQQQYDRAWKDQWIGEYHTPNTTGPLTTGRDPGDPSGGRAPHSPEA

Samples

Sample ID Description Type Environment
1 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
4 3300002073 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 Metagenome Rhizosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
15 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
16 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
17 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
18 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
19 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
20 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
21 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
22 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
23 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
24 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
25 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
26 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
27 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
28 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
29 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
30 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
31 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
32 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
33 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
34 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
35 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
36 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
37 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
38 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
39 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
40 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
41 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
42 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
43 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
44 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
45 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
46 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
47 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
48 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
49 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
50 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
51 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
52 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
53 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
54 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
55 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
56 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
57 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
58 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
59 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
60 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
61 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
62 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
63 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
64 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
65 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
66 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
67 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
68 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
69 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
70 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
71 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
72 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
73 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
74 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
75 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
76 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
77 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
78 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
79 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
80 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
81 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
82 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
83 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
84 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
85 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
86 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
87 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
88 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
89 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
90 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
91 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
92 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
93 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
94 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
95 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
96 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
97 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
98 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
99 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
100 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
101 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
102 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
103 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
104 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
105 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
106 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
107 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
108 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
109 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
110 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
111 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
165 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
169 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
170 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
171 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
172 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
173 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
174 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
175 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
176 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
177 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
178 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
179 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
180 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
181 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
182 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
183 3300033545 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE4 Metagenome Unclassified
184 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
185 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
186 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
187 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
188 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
189 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
190 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
191 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
192 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
193 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
194 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
195 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
196 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
197 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
198 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
199 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
200 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
201 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
202 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
203 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
204 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
205 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
206 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
207 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
208 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
209 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
210 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
211 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
212 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
213 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
214 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
215 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
216 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
217 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
218 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
219 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
220 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
221 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
222 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
223 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
224 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
225 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
226 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
227 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
228 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
229 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
230 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
231 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
232 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
233 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
234 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
235 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
236 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
237 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
238 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
239 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
240 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
241 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
242 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
243 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
244 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
245 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
246 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
247 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
248 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
249 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
250 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
251 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
252 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
253 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
254 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
255 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
256 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
257 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
258 2643221615 Nocardioides sp. Root224 Isolate Unclassified
259 2643221657 Nocardioides sp. Root1257 Isolate Unclassified
260 8002775197 Frankia nepalensis CN7 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 99.1
Metatranscriptomes 0.36
Isolates 0.54

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.8
Nodule 0.18
Rhizoplane 9.4
Rhizosphere 85.71
Stem 0
Stem Tuber 0
Unclassified 11.21

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070664_100229483 3300005564 Bacteria 1664
2 JGI24740J21852_10031585 3300001979 Bacteria 1705
3 JGI24737J22298_10164246 3300001990 Bacteria 656
4 JGI24745J21846_1009376 3300002073 Bacteria 1109
5 Ga0070658_10009307 3300005327 Bacteria 7902
6 Ga0070658_10267294 3300005327 Bacteria 1454
7 Ga0070658_10585988 3300005327 Bacteria 966
8 Ga0070676_10044705 3300005328 Bacteria 2578
9 Ga0070683_100014802 3300005329 Bacteria 6836
10 Ga0070683_100054848 3300005329 Bacteria 3696
11 Ga0070683_100748827 3300005329 Unclassified 936
12 Ga0070670_100292201 3300005331 Bacteria 1424
13 Ga0070670_100949780 3300005331 Unclassified 781
14 Ga0070670_101247976 3300005331 Bacteria 680
15 Ga0068869_100076679 3300005334 Bacteria 2485
16 Ga0068869_100112648 3300005334 Bacteria 2071
17 Ga0070666_10101829 3300005335 Bacteria 1980
18 Ga0070680_100142919 3300005336 Bacteria 2007
19 Ga0070680_101148588 3300005336 Unclassified 671
20 Ga0070682_100207902 3300005337 Bacteria 1385
21 Ga0070682_101552271 3300005337 Unclassified 571
22 Ga0068868_100003930 3300005338 Bacteria 10383
23 Ga0068868_100122992 3300005338 Bacteria 2117
24 Ga0070660_100067578 3300005339 Bacteria 2785
25 Ga0070660_100070213 3300005339 Bacteria 2733
26 Ga0070660_100620842 3300005339 Unclassified 904
27 Ga0070689_100212268 3300005340 Bacteria 1585
28 Ga0070689_100402000 3300005340 Bacteria 1158
29 Ga0070687_100122736 3300005343 Bacteria 1488
30 Ga0070661_100083830 3300005344 Bacteria 2355
31 Ga0070692_10060090 3300005345 Bacteria 2000
32 Ga0070692_10145668 3300005345 Bacteria 1345
33 Ga0070668_100208794 3300005347 Bacteria 1605
34 Ga0070669_100522448 3300005353 Bacteria 987
35 Ga0070669_101014289 3300005353 Unclassified 712
36 Ga0070675_100013492 3300005354 Bacteria 6421
37 Ga0070675_100076539 3300005354 Bacteria 2783
38 Ga0070674_100475362 3300005356 Bacteria 1036
39 Ga0070674_100588865 3300005356 Bacteria 938
40 Ga0070688_100092405 3300005365 Bacteria 1979
41 Ga0070659_100178775 3300005366 Bacteria 1740
42 Ga0070659_100552767 3300005366 Bacteria 986
43 Ga0070659_101106480 3300005366 Bacteria 698
44 Ga0070667_100678032 3300005367 Bacteria 953
45 Ga0070709_11312006 3300005434 Bacteria 584
46 Ga0070714_100063150 3300005435 Bacteria 3184
47 Ga0070714_100386139 3300005435 Bacteria 1321
48 Ga0070713_100198882 3300005436 Bacteria 1809
49 Ga0070713_100628658 3300005436 Bacteria 1021
50 Ga0070710_10576794 3300005437 Unclassified 780
51 Ga0070701_10333295 3300005438 Bacteria 942
52 Ga0070701_10760215 3300005438 Bacteria 657
53 Ga0070711_100621924 3300005439 Unclassified 903
54 Ga0070700_100004764 3300005441 Bacteria 7118
55 Ga0070700_100062224 3300005441 Bacteria 2357
56 Ga0070700_100202505 3300005441 Bacteria 1395
57 Ga0070708_100047767 3300005445 Bacteria 3782
58 Ga0070708_100782687 3300005445 Bacteria 897
59 Ga0070663_100184794 3300005455 Bacteria 1619
60 Ga0070663_100204008 3300005455 Bacteria 1544
61 Ga0070678_100070424 3300005456 Bacteria 2614
62 Ga0070678_100488561 3300005456 Bacteria 1085
63 Ga0070678_100769814 3300005456 Bacteria 872
64 Ga0070662_100052733 3300005457 Bacteria 2942
65 Ga0070662_100085262 3300005457 Bacteria 2360
66 Ga0070681_10108604 3300005458 Bacteria 2715
67 Ga0068867_100108262 3300005459 Bacteria 2131
68 Ga0070685_10213603 3300005466 Bacteria 1260
69 Ga0070706_100005656 3300005467 Bacteria 11892
70 Ga0070706_100256979 3300005467 Bacteria 1631
71 Ga0070707_100022054 3300005468 Bacteria 6021
72 Ga0070707_100028251 3300005468 Bacteria 5337
73 Ga0070707_100095514 3300005468 Bacteria 2879
74 Ga0070707_100147046 3300005468 Bacteria 2294
75 Ga0070707_100285120 3300005468 Bacteria 1605
76 Ga0070698_100022303 3300005471 Bacteria 6624
77 Ga0070698_100040242 3300005471 Bacteria 4805
78 Ga0070679_100031267 3300005530 Bacteria 5258
79 Ga0070679_100279048 3300005530 Bacteria 1624
80 Ga0070684_100040630 3300005535 Bacteria 4006
81 Ga0070684_100124450 3300005535 Bacteria 2321
82 Ga0070684_100348992 3300005535 Bacteria 1361
83 Ga0070684_100966600 3300005535 Unclassified 799
84 Ga0070697_100496911 3300005536 Bacteria 1066
85 Ga0068853_100418869 3300005539 Bacteria 1256
86 Ga0070672_100038279 3300005543 Bacteria 3664
87 Ga0070672_100149362 3300005543 Bacteria 1932
88 Ga0070672_100341487 3300005543 Bacteria 1275
89 Ga0070686_100036891 3300005544 Bacteria 3029
90 Ga0070695_100470123 3300005545 Bacteria 967
91 Ga0070695_101157612 3300005545 Bacteria 635
92 Ga0070693_100246783 3300005547 Bacteria 1182
93 Ga0070693_101197715 3300005547 Bacteria 583
94 Ga0070665_100120210 3300005548 Bacteria 2629
95 Ga0070665_100218068 3300005548 Bacteria 1908
96 Ga0070664_100000166 3300005564 Bacteria 45730
97 Ga0070664_100042397 3300005564 Bacteria 3842
98 Ga0070664_100203684 3300005564 Bacteria 1766
99 Ga0070664_100437151 3300005564 Bacteria 1200
100 Ga0070664_100475551 3300005564 Bacteria 1149
101 Ga0068857_100136265 3300005577 Bacteria 2217
102 Ga0068857_100201038 3300005577 Bacteria 1816
103 Ga0068857_100281214 3300005577 Bacteria 1531
104 Ga0068854_100062767 3300005578 Bacteria 2695
105 Ga0068854_100097507 3300005578 Bacteria 2198
106 Ga0068856_100069880 3300005614 Bacteria 3472
107 Ga0068856_100351044 3300005614 Bacteria 1494
108 Ga0068856_101142640 3300005614 Bacteria 796
109 Ga0070702_100025044 3300005615 Bacteria 3192
110 Ga0070702_100305164 3300005615 Bacteria 1103
111 Ga0070702_100313555 3300005615 Bacteria 1090
112 Ga0068852_100012594 3300005616 Bacteria 6428
113 Ga0068852_100089622 3300005616 Bacteria 2749
114 Ga0068852_101375305 3300005616 Bacteria 728
115 Ga0068859_100165838 3300005617 Bacteria 2289
116 Ga0068859_100502535 3300005617 Bacteria 1307
117 Ga0068859_100569762 3300005617 Bacteria 1226
118 Ga0068864_100048986 3300005618 Bacteria 3633
119 Ga0068864_100166984 3300005618 Bacteria 2004
120 Ga0068864_100173596 3300005618 Bacteria 1967
121 Ga0068864_100185606 3300005618 Bacteria 1903
122 Ga0068864_100706872 3300005618 Bacteria 985
123 Ga0068866_10252595 3300005718 Bacteria 1079
124 Ga0068866_11155697 3300005718 Bacteria 557
125 Ga0068861_100048195 3300005719 Bacteria 3220
126 Ga0068861_100113060 3300005719 Bacteria 2178
127 Ga0068861_101012870 3300005719 Bacteria 793
128 Ga0068851_10039364 3300005834 Bacteria 2374
129 Ga0068870_10062603 3300005840 Bacteria 2005
130 Ga0068870_10518583 3300005840 Bacteria 797
131 Ga0068863_101157172 3300005841 Bacteria 779
132 Ga0068863_101446226 3300005841 Bacteria 695
133 Ga0068858_100441569 3300005842 Bacteria 1253
134 Ga0068858_100473397 3300005842 Bacteria 1208
135 Ga0068858_100655836 3300005842 Unclassified 1020
136 Ga0068860_100114767 3300005843 Bacteria 2575
137 Ga0068860_100177081 3300005843 Bacteria 2061
138 Ga0068860_101748850 3300005843 Unclassified 644
139 Ga0068862_100133642 3300005844 Bacteria 2197
140 Ga0068862_101013926 3300005844 Bacteria 821
141 Ga0068862_101089906 3300005844 Bacteria 793
142 Ga0070717_10577438 3300006028 Unclassified 1019
143 Ga0075365_10027168 3300006038 Bacteria 3638
144 Ga0075365_10087226 3300006038 Bacteria 2121
145 Ga0075365_10088927 3300006038 Bacteria 2102
146 Ga0075365_10248183 3300006038 Bacteria 1250
147 Ga0075365_10711319 3300006038 Unclassified 709
148 Ga0075368_10017207 3300006042 Bacteria 2704
149 Ga0075364_10076490 3300006051 Bacteria 2209
150 Ga0075364_10320857 3300006051 Bacteria 1055
151 Ga0075364_10462806 3300006051 Unclassified 866
152 Ga0075432_10042856 3300006058 Bacteria 1585
153 Ga0070715_10924876 3300006163 Bacteria 538
154 Ga0070716_100608632 3300006173 Bacteria 823
155 Ga0070712_100047967 3300006175 Bacteria 2959
156 Ga0075367_10467492 3300006178 Unclassified 799
157 Ga0075367_11111425 3300006178 Bacteria 505
158 Ga0097621_101568578 3300006237 Bacteria 626
159 Ga0075370_10021031 3300006353 Bacteria 3572
160 Ga0075370_10074250 3300006353 Bacteria 1949
161 Ga0075428_100037401 3300006844 Bacteria 5344
162 Ga0075428_100324553 3300006844 Bacteria 1654
163 Ga0075430_100942935 3300006846 Bacteria 711
164 Ga0075430_101010780 3300006846 Bacteria 685
165 Ga0068865_100136846 3300006881 Bacteria 1842
166 Ga0068865_100255733 3300006881 Bacteria 1384
167 Ga0097620_100165832 3300006931 Bacteria 2289
168 Ga0097620_100502538 3300006931 Bacteria 1307
169 Ga0097620_100569776 3300006931 Bacteria 1226
170 Ga0075435_100767519 3300007076 Bacteria 839
171 Ga0111539_10019751 3300009094 Bacteria 8309
172 Ga0111539_10225490 3300009094 Bacteria 2183
173 Ga0111539_10445592 3300009094 Bacteria 1508
174 Ga0111539_12493801 3300009094 Bacteria 600
175 Ga0105245_10255802 3300009098 Bacteria 1703
176 Ga0105245_10399214 3300009098 Bacteria 1374
177 Ga0105245_10500540 3300009098 Bacteria 1231
178 Ga0105245_10583630 3300009098 Bacteria 1142
179 Ga0105247_10036682 3300009101 Bacteria 2988
180 Ga0105247_10038299 3300009101 Bacteria 2927
181 Ga0105247_10318500 3300009101 Unclassified 1084
182 Ga0114129_10966680 3300009147 Bacteria 1075
183 Ga0105243_10065215 3300009148 Bacteria 2924
184 Ga0105243_10311728 3300009148 Bacteria 1430
185 Ga0105243_10510646 3300009148 Bacteria 1141
186 Ga0105243_10682775 3300009148 Bacteria 999
187 Ga0105243_10739444 3300009148 Bacteria 963
188 Ga0105243_11663049 3300009148 Bacteria 666
189 Ga0105241_10117859 3300009174 Bacteria 2134
190 Ga0105241_10479597 3300009174 Bacteria 1105
191 Ga0105242_10176837 3300009176 Bacteria 1880
192 Ga0105242_10179607 3300009176 Bacteria 1866
193 Ga0105242_11720443 3300009176 Bacteria 664
194 Ga0105248_11340946 3300009177 Bacteria 809
195 Ga0105237_10529939 3300009545 Unclassified 1184
196 Ga0105237_10883258 3300009545 Bacteria 901
197 Ga0105237_11142945 3300009545 Bacteria 785
198 Ga0105238_10148117 3300009551 Bacteria 2323
199 Ga0105238_11580944 3300009551 Bacteria 685
200 Ga0105249_10251629 3300009553 Bacteria 1752
201 Ga0105249_10462668 3300009553 Bacteria 1309
202 Ga0105239_10095265 3300010375 Bacteria 3288
203 Ga0105239_10532097 3300010375 Bacteria 1338
204 Ga0105239_10714682 3300010375 Bacteria 1146
205 Ga0105246_10183269 3300011119 Bacteria 1614
206 Ga0105246_10458007 3300011119 Bacteria 1073
207 Ga0105246_11903685 3300011119 Unclassified 571
208 Ga0157371_10148831 3300013102 Bacteria 1669
209 Ga0157370_10644758 3300013104 Unclassified 968
210 Ga0157370_11919648 3300013104 Unclassified 531
211 Ga0157369_10187828 3300013105 Bacteria 2172
212 Ga0157374_10371288 3300013296 Bacteria 1424
213 Ga0157374_11222131 3300013296 Bacteria 773
214 Ga0163162_10019568 3300013306 Bacteria 6645
215 Ga0163162_11395306 3300013306 Bacteria 797
216 Ga0157372_10332836 3300013307 Bacteria 1768
217 Ga0157375_10257892 3300013308 Bacteria 1905
218 Ga0157375_10729831 3300013308 Bacteria 1143
219 Ga0157375_11216741 3300013308 Bacteria 884
220 Ga0157375_11711315 3300013308 Bacteria 745
221 Ga0157375_12236491 3300013308 Unclassified 652
222 Ga0163163_10051819 3300014325 Bacteria 4046
223 Ga0163163_10200121 3300014325 Bacteria 2046
224 Ga0163163_10240966 3300014325 Bacteria 1858
225 Ga0163163_10563453 3300014325 Bacteria 1202
226 Ga0163163_13095088 3300014325 Bacteria 519
227 Ga0157380_10060878 3300014326 Bacteria 3019
228 Ga0157380_10694803 3300014326 Bacteria 1021
229 Ga0157380_12745453 3300014326 Bacteria 559
230 Ga0157377_10011793 3300014745 Bacteria 4373
231 Ga0157379_10022427 3300014968 Bacteria 5593
232 Ga0157379_10307074 3300014968 Bacteria 1447
233 Ga0157379_10687856 3300014968 Bacteria 959
234 Ga0157376_10106730 3300014969 Bacteria 2457
235 Ga0163161_10297337 3300017792 Bacteria 1271
236 Ga0163161_11382497 3300017792 Bacteria 614
237 Ga0197907_11397645 3300020069 Bacteria 727
238 Ga0206353_10410167 3300020082 Bacteria 3767
239 Ga0207656_10096832 3300025321 Bacteria 1347
240 Ga0207692_10420168 3300025898 Unclassified 837
241 Ga0207688_10000217 3300025901 Bacteria 25744
242 Ga0207680_10058331 3300025903 Bacteria 2339
243 Ga0207647_10021010 3300025904 Bacteria 4365
244 Ga0207647_10042601 3300025904 Bacteria 2847
245 Ga0207645_10186961 3300025907 Bacteria 1360
246 Ga0207643_10007297 3300025908 Bacteria 5931
247 Ga0207643_10070550 3300025908 Bacteria 2010
248 Ga0207643_10193002 3300025908 Bacteria 1237
249 Ga0207705_10050095 3300025909 Bacteria 3006
250 Ga0207705_10067564 3300025909 Bacteria 2587
251 Ga0207684_10020633 3300025910 Bacteria 5630
252 Ga0207684_11091024 3300025910 Bacteria 665
253 Ga0207654_10066257 3300025911 Bacteria 2129
254 Ga0207707_10172232 3300025912 Bacteria 1891
255 Ga0207707_10796292 3300025912 Bacteria 788
256 Ga0207671_11062522 3300025914 Bacteria 637
257 Ga0207663_10503489 3300025916 Unclassified 941
258 Ga0207660_11022647 3300025917 Unclassified 674
259 Ga0207662_10041087 3300025918 Bacteria 2722
260 Ga0207662_10179903 3300025918 Bacteria 1360
261 Ga0207657_10021703 3300025919 Bacteria 6036
262 Ga0207657_10036696 3300025919 Bacteria 4384
263 Ga0207657_10075338 3300025919 Bacteria 2848
264 Ga0207657_10452012 3300025919 Bacteria 1008
265 Ga0207649_10235959 3300025920 Bacteria 1310
266 Ga0207649_10312355 3300025920 Unclassified 1152
267 Ga0207652_10030950 3300025921 Bacteria 4488
268 Ga0207652_10675257 3300025921 Unclassified 923
269 Ga0207646_10003697 3300025922 Bacteria 17078
270 Ga0207646_10015660 3300025922 Bacteria 7147
271 Ga0207646_10077411 3300025922 Bacteria 2972
272 Ga0207646_10084170 3300025922 Bacteria 2846
273 Ga0207646_11171087 3300025922 Bacteria 675
274 Ga0207681_10250174 3300025923 Bacteria 1383
275 Ga0207681_10290285 3300025923 Bacteria 1291
276 Ga0207694_10951924 3300025924 Bacteria 726
277 Ga0207694_11639850 3300025924 Bacteria 542
278 Ga0207650_10080107 3300025925 Bacteria 2475
279 Ga0207659_10292378 3300025926 Bacteria 1335
280 Ga0207659_10422255 3300025926 Bacteria 1118
281 Ga0207687_10169182 3300025927 Bacteria 1684
282 Ga0207687_10179291 3300025927 Bacteria 1640
283 Ga0207687_10368274 3300025927 Bacteria 1174
284 Ga0207687_10647495 3300025927 Bacteria 894
285 Ga0207687_10866396 3300025927 Bacteria 772
286 Ga0207700_10466098 3300025928 Unclassified 1115
287 Ga0207664_10337702 3300025929 Bacteria 1332
288 Ga0207664_10446366 3300025929 Unclassified 1154
289 Ga0207690_10165195 3300025932 Bacteria 1654
290 Ga0207690_10176732 3300025932 Bacteria 1604
291 Ga0207690_10428327 3300025932 Bacteria 1060
292 Ga0207690_11328782 3300025932 Unclassified 601
293 Ga0207706_10210138 3300025933 Bacteria 1706
294 Ga0207686_10060671 3300025934 Bacteria 2395
295 Ga0207686_11810334 3300025934 Unclassified 505
296 Ga0207670_10176651 3300025936 Bacteria 1605
297 Ga0207670_10501330 3300025936 Bacteria 986
298 Ga0207704_10094024 3300025938 Bacteria 1978
299 Ga0207704_10125779 3300025938 Bacteria 1764
300 Ga0207704_10193399 3300025938 Bacteria 1482
301 Ga0207691_10249929 3300025940 Bacteria 1531
302 Ga0207691_10384116 3300025940 Bacteria 1199
303 Ga0207711_10159846 3300025941 Bacteria 2038
304 Ga0207711_11133742 3300025941 Bacteria 723
305 Ga0207689_10045092 3300025942 Bacteria 3647
306 Ga0207689_10089003 3300025942 Bacteria 2536
307 Ga0207661_10061019 3300025944 Bacteria 3045
308 Ga0207661_10683174 3300025944 Unclassified 944
309 Ga0207661_10687139 3300025944 Bacteria 941
310 Ga0207679_10050175 3300025945 Bacteria 3047
311 Ga0207679_10070760 3300025945 Bacteria 2629
312 Ga0207679_10110502 3300025945 Bacteria 2169
313 Ga0207679_11861742 3300025945 Bacteria 549
314 Ga0207667_11641784 3300025949 Bacteria 611
315 Ga0207712_10034212 3300025961 Bacteria 3442
316 Ga0207712_10169712 3300025961 Bacteria 1704
317 Ga0207668_10168669 3300025972 Bacteria 1714
318 Ga0207640_10128957 3300025981 Bacteria 1825
319 Ga0207640_10416784 3300025981 Bacteria 1098
320 Ga0207640_11782446 3300025981 Unclassified 556
321 Ga0207658_10528201 3300025986 Bacteria 1054
322 Ga0207677_10129894 3300026023 Bacteria 1911
323 Ga0207703_10153333 3300026035 Bacteria 2011
324 Ga0207703_10213113 3300026035 Bacteria 1723
325 Ga0207703_11026003 3300026035 Bacteria 792
326 Ga0207639_10328763 3300026041 Bacteria 1359
327 Ga0207639_10834697 3300026041 Unclassified 860
328 Ga0207678_10221171 3300026067 Bacteria 1621
329 Ga0207678_10436068 3300026067 Bacteria 1137
330 Ga0207708_10004104 3300026075 Bacteria 10717
331 Ga0207708_10006917 3300026075 Bacteria 8391
332 Ga0207708_10181369 3300026075 Unclassified 1672
333 Ga0207702_10255442 3300026078 Bacteria 1648
334 Ga0207702_10530413 3300026078 Bacteria 1150
335 Ga0207702_10777610 3300026078 Bacteria 946
336 Ga0207702_11798005 3300026078 Bacteria 605
337 Ga0207641_11252316 3300026088 Bacteria 742
338 Ga0207648_10039192 3300026089 Bacteria 4166
339 Ga0207676_10076841 3300026095 Bacteria 2699
340 Ga0207676_10258745 3300026095 Bacteria 1570
341 Ga0207676_11348392 3300026095 Bacteria 709
342 Ga0207676_12366244 3300026095 Unclassified 528
343 Ga0207674_10032798 3300026116 Bacteria 5444
344 Ga0207674_10109695 3300026116 Bacteria 2735
345 Ga0207674_10138625 3300026116 Bacteria 2393
346 Ga0207674_10350555 3300026116 Unclassified 1427
347 Ga0207674_10455892 3300026116 Bacteria 1236
348 Ga0207674_11471317 3300026116 Bacteria 650
349 Ga0207674_11806688 3300026116 Bacteria 578
350 Ga0207683_10041184 3300026121 Bacteria 4032
351 Ga0207683_10105866 3300026121 Bacteria 2514
352 Ga0207683_10326879 3300026121 Bacteria 1405
353 Ga0207698_10060129 3300026142 Bacteria 2953
354 Ga0207698_11038746 3300026142 Bacteria 831
355 Ga0207698_11710862 3300026142 Bacteria 644
356 Ga0207428_10122428 3300027907 Bacteria 1994
357 Ga0268266_10042497 3300028379 Bacteria 3882
358 Ga0268266_10423752 3300028379 Bacteria 1261
359 Ga0268265_10023622 3300028380 Bacteria 4336
360 Ga0268265_10048814 3300028380 Bacteria 3180
361 Ga0268265_11486414 3300028380 Unclassified 681
362 Ga0268265_11613842 3300028380 Bacteria 654
363 Ga0268264_10097795 3300028381 Bacteria 2545
364 Ga0268264_10116406 3300028381 Bacteria 2349
365 Ga0268264_11131782 3300028381 Bacteria 792
366 Ga0268264_11159910 3300028381 Unclassified 782
367 Ga0265338_10009869 3300028800 Bacteria 11303
368 Ga0265332_10294156 3300031238 Unclassified 671
369 Ga0265320_10191796 3300031240 Unclassified 914
370 Ga0265325_10003767 3300031241 Bacteria 9786
371 Ga0265325_10025534 3300031241 Unclassified 3207
372 Ga0265340_10004794 3300031247 Bacteria 7526
373 Ga0265316_10087854 3300031344 Bacteria 2375
374 Ga0265313_10160563 3300031595 Unclassified 955
375 Ga0265342_10014517 3300031712 Bacteria 5226
376 Ga0307405_10204117 3300031731 Bacteria 1438
377 Ga0307413_10200594 3300031824 Bacteria 1441
378 Ga0307410_10820050 3300031852 Bacteria 792
379 Ga0307412_10277166 3300031911 Bacteria 1315
380 Ga0307412_11443367 3300031911 Unclassified 624
381 Ga0307409_100071030 3300031995 Bacteria 2766
382 Ga0307409_100816826 3300031995 Bacteria 941
383 Ga0307416_100283968 3300032002 Bacteria 1634
384 Ga0307416_100373953 3300032002 Bacteria 1452
385 Ga0307416_101992798 3300032002 Unclassified 683
386 Ga0307415_100237403 3300032126 Bacteria 1472
387 Ga0307415_100324406 3300032126 Bacteria 1285
388 Ga0316214_1001070 3300033545 Bacteria 3063
389 Ga0373954_0077969 3300035118 Bacteria 1580
390 Ga0373954_0438125 3300035118 Unclassified 647
391 Ga0373935_0015396 3300035692 Bacteria 4623
392 Ga0373925_0541450 3300037068 Unclassified 957
393 Ga0436365_0569722 3300039437 Bacteria 1478
394 Ga0436360_0255695 3300039438 Bacteria 1075
395 Ga0466965_0521236 3300044683 Bacteria 668
396 Ga0495629_0229099 3300046459 Bacteria 1281
397 Ga0495651_0347022 3300046462 Bacteria 982
398 Ga0495630_0157982 3300046517 Unclassified 1726
399 Ga0495643_0523243 3300046522 Bacteria 508
400 Ga0495587_0535672 3300046536 Bacteria 646
401 Ga0495667_0129706 3300046559 Bacteria 1627
402 Ga0495668_0428773 3300046616 Bacteria 727
403 Ga0495657_0623846 3300046675 Unclassified 623
404 Ga0495623_0324690 3300046679 Bacteria 844
405 Ga0495680_0060851 3300047322 Bacteria 2908
406 Ga0496100_0438679 3300048903 Bacteria 1000
407 Ga0496100_0451350 3300048903 Unclassified 986
408 Ga0496100_0619923 3300048903 Unclassified 841
409 Ga0496100_0690008 3300048903 Unclassified 796
410 Ga0496101_0161320 3300048904 Bacteria 1719
411 Ga0496101_0419001 3300048904 Archaea 1055
412 Ga0496101_0738310 3300048904 Bacteria 777
413 Ga0496101_0964018 3300048904 Bacteria 671
414 Ga0496102_0067296 3300048905 Bacteria 3285
415 Ga0496102_0122572 3300048905 Bacteria 2429
416 Ga0496102_0262462 3300048905 Bacteria 1628
417 Ga0496102_0315360 3300048905 Bacteria 1473
418 Ga0496102_1245619 3300048905 Bacteria 663
419 Ga0496103_0269185 3300048906 Unclassified 1096
420 Ga0496104_0067971 3300048907 Bacteria 3385
421 Ga0496104_0069091 3300048907 Bacteria 3357
422 Ga0496104_0230497 3300048907 Bacteria 1764
423 Ga0496104_0850665 3300048907 Bacteria 818
424 Ga0496105_0000534 3300048908 Bacteria 25137
425 Ga0496105_0006304 3300048908 Bacteria 9113
426 Ga0496105_0030443 3300048908 Bacteria 4422
427 Ga0496106_0505846 3300048909 Bacteria 970
428 Ga0496107_0041340 3300048910 Bacteria 3310
429 Ga0496107_0091324 3300048910 Bacteria 2225
430 Ga0496108_0213288 3300048911 Bacteria 1676
431 Ga0496108_0251018 3300048911 Bacteria 1539
432 Ga0496108_0529980 3300048911 Bacteria 1028
433 Ga0496108_0879252 3300048911 Unclassified 770
434 Ga0496109_0091137 3300048912 Bacteria 2819
435 Ga0496109_0096575 3300048912 Bacteria 2738
436 Ga0496109_0164659 3300048912 Bacteria 2078
437 Ga0496109_0199657 3300048912 Bacteria 1880
438 Ga0496109_0296242 3300048912 Bacteria 1525
439 Ga0496109_0639849 3300048912 Bacteria 1000
440 Ga0496109_0768531 3300048912 Unclassified 901
441 Ga0496109_0835072 3300048912 Bacteria 859
442 Ga0496109_1325517 3300048912 Bacteria 656
443 Ga0496110_0093440 3300048913 Bacteria 2693
444 Ga0496111_0005869 3300048914 Bacteria 7919
445 Ga0496111_0226775 3300048914 Bacteria 1388
446 Ga0496111_0568299 3300048914 Bacteria 832
447 Ga0496112_0332309 3300048915 Bacteria 1463
448 Ga0496113_0011520 3300048916 Bacteria 5905
449 Ga0496113_0090537 3300048916 Bacteria 2357
450 Ga0496113_0372036 3300048916 Bacteria 1147
451 Ga0496113_0424019 3300048916 Bacteria 1069
452 Ga0496114_0028331 3300048917 Bacteria 4595
453 Ga0496114_0028734 3300048917 Bacteria 4565
454 Ga0496114_0035794 3300048917 Bacteria 4101
455 Ga0496115_0012002 3300048918 Bacteria 6511
456 Ga0496115_0397698 3300048918 Unclassified 1118
457 Ga0496115_0955130 3300048918 Unclassified 658
458 Ga0496126_0704702 3300048929 Bacteria 784
459 Ga0501034_0027866 3300049571 Bacteria 5745
460 Ga0501034_0128255 3300049571 Bacteria 2521
461 Ga0501036_0023095 3300049572 Bacteria 5235
462 Ga0501036_0024558 3300049572 Bacteria 5082
463 Ga0501036_1525575 3300049572 Bacteria 540
464 Ga0501037_0171873 3300049573 Bacteria 1540
465 Ga0501038_0091739 3300049574 Bacteria 2544
466 Ga0501038_0640463 3300049574 Bacteria 801
467 Ga0501039_0008724 3300049575 Bacteria 7720
468 Ga0501040_0013967 3300049576 Bacteria 5287
469 Ga0501040_0092815 3300049576 Bacteria 2099
470 Ga0501041_0113011 3300049577 Bacteria 1685
471 Ga0501041_0128773 3300049577 Bacteria 1577
472 Ga0501042_0004580 3300049578 Bacteria 8825
473 Ga0501046_0023505 3300049580 Bacteria 5070
474 Ga0501047_0216148 3300049581 Bacteria 1774
475 Ga0501048_0063849 3300049582 Bacteria 2604
476 Ga0501067_0012553 3300049583 Bacteria 4700
477 Ga0501067_0016194 3300049583 Bacteria 4120
478 Ga0501068_0008217 3300049584 Bacteria 5802
479 Ga0501068_0031216 3300049584 Bacteria 3164
480 Ga0501068_0218534 3300049584 Bacteria 1211
481 Ga0501069_0026250 3300049585 Bacteria 3190
482 Ga0501070_0004104 3300049586 Bacteria 12522
483 Ga0501070_0027507 3300049586 Bacteria 4770
484 Ga0501070_0078833 3300049586 Bacteria 2725
485 Ga0501071_0005661 3300049587 Bacteria 8056
486 Ga0501071_0110051 3300049587 Bacteria 2035
487 Ga0501071_0112948 3300049587 Bacteria 2009
488 Ga0501071_0259893 3300049587 Bacteria 1311
489 Ga0501072_0019122 3300049588 Bacteria 5291
490 Ga0501072_0045579 3300049588 Bacteria 3448
491 Ga0501072_0057294 3300049588 Bacteria 3070
492 Ga0501072_0621491 3300049588 Unclassified 851
493 Ga0501073_0022301 3300049589 Bacteria 4561
494 Ga0501073_0064200 3300049589 Bacteria 2560
495 Ga0501074_0002465 3300049590 Bacteria 12903
496 Ga0501074_0007614 3300049590 Bacteria 7838
497 Ga0501074_0022489 3300049590 Bacteria 4580
498 Ga0501074_0149438 3300049590 Bacteria 1670
499 Ga0501074_0426486 3300049590 Bacteria 941
500 Ga0501074_0864211 3300049590 Unclassified 637
501 Ga0501075_0012059 3300049591 Bacteria 6136
502 Ga0501076_0049521 3300049592 Bacteria 3323
503 Ga0501076_0216398 3300049592 Bacteria 1566
504 Ga0501076_0349101 3300049592 Unclassified 1215
505 Ga0501076_0469829 3300049592 Unclassified 1036
506 Ga0501077_0022668 3300049593 Bacteria 3979
507 Ga0501077_0028327 3300049593 Bacteria 3560
508 Ga0501077_0710442 3300049593 Bacteria 646
509 Ga0501079_0046199 3300049741 Bacteria 3360
510 Ga0501079_0087126 3300049741 Bacteria 2417
511 Ga0501079_0270600 3300049741 Bacteria 1328
512 Ga0501080_0010722 3300049742 Bacteria 8385
513 Ga0501080_0021517 3300049742 Bacteria 5969
514 Ga0501080_0047234 3300049742 Bacteria 4007
515 Ga0501083_0027487 3300049744 Bacteria 3926
516 Ga0501083_0047472 3300049744 Bacteria 2901
517 Ga0501083_0072150 3300049744 Bacteria 2295
518 Ga0501035_0118321 3300049822 Bacteria 2318
519 Ga0501035_0367539 3300049822 Bacteria 1201
520 Ga0501045_0078294 3300049824 Bacteria 2437
521 Ga0501045_0289725 3300049824 Bacteria 1218
522 Ga0501045_0578030 3300049824 Bacteria 833
523 nmdc:mga03n38_82478_c1 3300050490 Bacteria 1514
524 nmdc:mga00v17_232968_c1 3300050491 Bacteria 1193
525 nmdc:mga00v17_56733_c1 3300050491 Bacteria 2395
526 nmdc:mga0yw44_207405_c1 3300050492 Bacteria 1296
527 nmdc:mga0yw44_59642_c1 3300050492 Bacteria 2335
528 nmdc:mga0yw44_9073_c1 3300050492 Bacteria 5003
529 nmdc:mga07m45_86212_c1 3300050496 Bacteria 1796
530 nmdc:mga05p37_1488889_c1 3300050507 Bacteria 675
531 nmdc:mga09592_1129286_c1 3300050508 Unclassified 650
532 nmdc:mga0qj67_791273_c1 3300050509 Bacteria 751
533 nmdc:mga06r32_645795_c1 3300050510 Bacteria 1026
534 nmdc:mga08y16_1006652_c1 3300050511 Bacteria 813
535 nmdc:mga08y16_129853_c1 3300050511 Bacteria 2621
536 nmdc:mga08y16_301119_c1 3300050511 Bacteria 1653
537 Ga0495595_0111266 3300053084 Bacteria 1328
538 Ga0495595_0492037 3300053084 Bacteria 625
539 Ga0500573_0299830 3300053140 Bacteria 804
540 Ga0501084_0084433 3300054114 Bacteria 2665
541 Ga0501084_0096306 3300054114 Bacteria 2485
542 Ga0501084_0117151 3300054114 Bacteria 2240
543 Ga0501084_1523680 3300054114 Unclassified 559
544 Ga0501082_0022886 3300060353 Bacteria 5383
545 Ga0501082_0029714 3300060353 Bacteria 4709
546 Ga0501082_0081696 3300060353 Bacteria 2789
547 Ga0501082_0246527 3300060353 Bacteria 1555
548 Ga0501082_0433825 3300060353 Bacteria 1147
549 Ga0530510_0093337 3300061734 Bacteria 2197
550 Ga0530510_1387522 3300061734 Bacteria 539
551 2644092078 2643221615 Bacteria 5487866
552 2644321881 2643221657 Bacteria 5490246
553 8002775263 8002775197 Bacteria 10728764
554 Ga0070664_100229483
555 JGI24740J21852_10031585
556 JGI24737J22298_10164246
557 JGI24745J21846_1009376
558 Ga0070658_10009307
559 Ga0070658_10267294
560 Ga0070658_10585988
561 Ga0070676_10044705
562 Ga0070683_100014802
563 Ga0070683_100054848
564 Ga0070683_100748827
565 Ga0070670_100292201
566 Ga0070670_100949780
567 Ga0070670_101247976
568 Ga0068869_100076679
569 Ga0068869_100112648
570 Ga0070666_10101829
571 Ga0070680_100142919
572 Ga0070680_101148588
573 Ga0070682_100207902
574 Ga0070682_101552271
575 Ga0068868_100003930
576 Ga0068868_100122992
577 Ga0070660_100067578
578 Ga0070660_100070213
579 Ga0070660_100620842
580 Ga0070689_100212268
581 Ga0070689_100402000
582 Ga0070687_100122736
583 Ga0070661_100083830
584 Ga0070692_10060090
585 Ga0070692_10145668
586 Ga0070668_100208794
587 Ga0070669_100522448
588 Ga0070669_101014289
589 Ga0070675_100013492
590 Ga0070675_100076539
591 Ga0070674_100475362
592 Ga0070674_100588865
593 Ga0070688_100092405
594 Ga0070659_100178775
595 Ga0070659_100552767
596 Ga0070659_101106480
597 Ga0070667_100678032
598 Ga0070709_11312006
599 Ga0070714_100063150
600 Ga0070714_100386139
601 Ga0070713_100198882
602 Ga0070713_100628658
603 Ga0070710_10576794
604 Ga0070701_10333295
605 Ga0070701_10760215
606 Ga0070711_100621924
607 Ga0070700_100004764
608 Ga0070700_100062224
609 Ga0070700_100202505
610 Ga0070708_100047767
611 Ga0070708_100782687
612 Ga0070663_100184794
613 Ga0070663_100204008
614 Ga0070678_100070424
615 Ga0070678_100488561
616 Ga0070678_100769814
617 Ga0070662_100052733
618 Ga0070662_100085262
619 Ga0070681_10108604
620 Ga0068867_100108262
621 Ga0070685_10213603
622 Ga0070706_100005656
623 Ga0070706_100256979
624 Ga0070707_100022054
625 Ga0070707_100028251
626 Ga0070707_100095514
627 Ga0070707_100147046
628 Ga0070707_100285120
629 Ga0070698_100022303
630 Ga0070698_100040242
631 Ga0070679_100031267
632 Ga0070679_100279048
633 Ga0070684_100040630
634 Ga0070684_100124450
635 Ga0070684_100348992
636 Ga0070684_100966600
637 Ga0070697_100496911
638 Ga0068853_100418869
639 Ga0070672_100038279
640 Ga0070672_100149362
641 Ga0070672_100341487
642 Ga0070686_100036891
643 Ga0070695_100470123
644 Ga0070695_101157612
645 Ga0070693_100246783
646 Ga0070693_101197715
647 Ga0070665_100120210
648 Ga0070665_100218068
649 Ga0070664_100000166
650 Ga0070664_100042397
651 Ga0070664_100203684
652 Ga0070664_100437151
653 Ga0070664_100475551
654 Ga0068857_100136265
655 Ga0068857_100201038
656 Ga0068857_100281214
657 Ga0068854_100062767
658 Ga0068854_100097507
659 Ga0068856_100069880
660 Ga0068856_100351044
661 Ga0068856_101142640
662 Ga0070702_100025044
663 Ga0070702_100305164
664 Ga0070702_100313555
665 Ga0068852_100012594
666 Ga0068852_100089622
667 Ga0068852_101375305
668 Ga0068859_100165838
669 Ga0068859_100502535
670 Ga0068859_100569762
671 Ga0068864_100048986
672 Ga0068864_100166984
673 Ga0068864_100173596
674 Ga0068864_100185606
675 Ga0068864_100706872
676 Ga0068866_10252595
677 Ga0068866_11155697
678 Ga0068861_100048195
679 Ga0068861_100113060
680 Ga0068861_101012870
681 Ga0068851_10039364
682 Ga0068870_10062603
683 Ga0068870_10518583
684 Ga0068863_101157172
685 Ga0068863_101446226
686 Ga0068858_100441569
687 Ga0068858_100473397
688 Ga0068858_100655836
689 Ga0068860_100114767
690 Ga0068860_100177081
691 Ga0068860_101748850
692 Ga0068862_100133642
693 Ga0068862_101013926
694 Ga0068862_101089906
695 Ga0070717_10577438
696 Ga0075365_10027168
697 Ga0075365_10087226
698 Ga0075365_10088927
699 Ga0075365_10248183
700 Ga0075365_10711319
701 Ga0075368_10017207
702 Ga0075364_10076490
703 Ga0075364_10320857
704 Ga0075364_10462806
705 Ga0075432_10042856
706 Ga0070715_10924876
707 Ga0070716_100608632
708 Ga0070712_100047967
709 Ga0075367_10467492
710 Ga0075367_11111425
711 Ga0097621_101568578
712 Ga0075370_10021031
713 Ga0075370_10074250
714 Ga0075428_100037401
715 Ga0075428_100324553
716 Ga0075430_100942935
717 Ga0075430_101010780
718 Ga0068865_100136846
719 Ga0068865_100255733
720 Ga0097620_100165832
721 Ga0097620_100502538
722 Ga0097620_100569776
723 Ga0075435_100767519
724 Ga0111539_10019751
725 Ga0111539_10225490
726 Ga0111539_10445592
727 Ga0111539_12493801
728 Ga0105245_10255802
729 Ga0105245_10399214
730 Ga0105245_10500540
731 Ga0105245_10583630
732 Ga0105247_10036682
733 Ga0105247_10038299
734 Ga0105247_10318500
735 Ga0114129_10966680
736 Ga0105243_10065215
737 Ga0105243_10311728
738 Ga0105243_10510646
739 Ga0105243_10682775
740 Ga0105243_10739444
741 Ga0105243_11663049
742 Ga0105241_10117859
743 Ga0105241_10479597
744 Ga0105242_10176837
745 Ga0105242_10179607
746 Ga0105242_11720443
747 Ga0105248_11340946
748 Ga0105237_10529939
749 Ga0105237_10883258
750 Ga0105237_11142945
751 Ga0105238_10148117
752 Ga0105238_11580944
753 Ga0105249_10251629
754 Ga0105249_10462668
755 Ga0105239_10095265
756 Ga0105239_10532097
757 Ga0105239_10714682
758 Ga0105246_10183269
759 Ga0105246_10458007
760 Ga0105246_11903685
761 Ga0157371_10148831
762 Ga0157370_10644758
763 Ga0157370_11919648
764 Ga0157369_10187828
765 Ga0157374_10371288
766 Ga0157374_11222131
767 Ga0163162_10019568
768 Ga0163162_11395306
769 Ga0157372_10332836
770 Ga0157375_10257892
771 Ga0157375_10729831
772 Ga0157375_11216741
773 Ga0157375_11711315
774 Ga0157375_12236491
775 Ga0163163_10051819
776 Ga0163163_10200121
777 Ga0163163_10240966
778 Ga0163163_10563453
779 Ga0163163_13095088
780 Ga0157380_10060878
781 Ga0157380_10694803
782 Ga0157380_12745453
783 Ga0157377_10011793
784 Ga0157379_10022427
785 Ga0157379_10307074
786 Ga0157379_10687856
787 Ga0157376_10106730
788 Ga0163161_10297337
789 Ga0163161_11382497
790 Ga0197907_11397645
791 Ga0206353_10410167
792 Ga0207656_10096832
793 Ga0207692_10420168
794 Ga0207688_10000217
795 Ga0207680_10058331
796 Ga0207647_10021010
797 Ga0207647_10042601
798 Ga0207645_10186961
799 Ga0207643_10007297
800 Ga0207643_10070550
801 Ga0207643_10193002
802 Ga0207705_10050095
803 Ga0207705_10067564
804 Ga0207684_10020633
805 Ga0207684_11091024
806 Ga0207654_10066257
807 Ga0207707_10172232
808 Ga0207707_10796292
809 Ga0207671_11062522
810 Ga0207663_10503489
811 Ga0207660_11022647
812 Ga0207662_10041087
813 Ga0207662_10179903
814 Ga0207657_10021703
815 Ga0207657_10036696
816 Ga0207657_10075338
817 Ga0207657_10452012
818 Ga0207649_10235959
819 Ga0207649_10312355
820 Ga0207652_10030950
821 Ga0207652_10675257
822 Ga0207646_10003697
823 Ga0207646_10015660
824 Ga0207646_10077411
825 Ga0207646_10084170
826 Ga0207646_11171087
827 Ga0207681_10250174
828 Ga0207681_10290285
829 Ga0207694_10951924
830 Ga0207694_11639850
831 Ga0207650_10080107
832 Ga0207659_10292378
833 Ga0207659_10422255
834 Ga0207687_10169182
835 Ga0207687_10179291
836 Ga0207687_10368274
837 Ga0207687_10647495
838 Ga0207687_10866396
839 Ga0207700_10466098
840 Ga0207664_10337702
841 Ga0207664_10446366
842 Ga0207690_10165195
843 Ga0207690_10176732
844 Ga0207690_10428327
845 Ga0207690_11328782
846 Ga0207706_10210138
847 Ga0207686_10060671
848 Ga0207686_11810334
849 Ga0207670_10176651
850 Ga0207670_10501330
851 Ga0207704_10094024
852 Ga0207704_10125779
853 Ga0207704_10193399
854 Ga0207691_10249929
855 Ga0207691_10384116
856 Ga0207711_10159846
857 Ga0207711_11133742
858 Ga0207689_10045092
859 Ga0207689_10089003
860 Ga0207661_10061019
861 Ga0207661_10683174
862 Ga0207661_10687139
863 Ga0207679_10050175
864 Ga0207679_10070760
865 Ga0207679_10110502
866 Ga0207679_11861742
867 Ga0207667_11641784
868 Ga0207712_10034212
869 Ga0207712_10169712
870 Ga0207668_10168669
871 Ga0207640_10128957
872 Ga0207640_10416784
873 Ga0207640_11782446
874 Ga0207658_10528201
875 Ga0207677_10129894
876 Ga0207703_10153333
877 Ga0207703_10213113
878 Ga0207703_11026003
879 Ga0207639_10328763
880 Ga0207639_10834697
881 Ga0207678_10221171
882 Ga0207678_10436068
883 Ga0207708_10004104
884 Ga0207708_10006917
885 Ga0207708_10181369
886 Ga0207702_10255442
887 Ga0207702_10530413
888 Ga0207702_10777610
889 Ga0207702_11798005
890 Ga0207641_11252316
891 Ga0207648_10039192
892 Ga0207676_10076841
893 Ga0207676_10258745
894 Ga0207676_11348392
895 Ga0207676_12366244
896 Ga0207674_10032798
897 Ga0207674_10109695
898 Ga0207674_10138625
899 Ga0207674_10350555
900 Ga0207674_10455892
901 Ga0207674_11471317
902 Ga0207674_11806688
903 Ga0207683_10041184
904 Ga0207683_10105866
905 Ga0207683_10326879
906 Ga0207698_10060129
907 Ga0207698_11038746
908 Ga0207698_11710862
909 Ga0207428_10122428
910 Ga0268266_10042497
911 Ga0268266_10423752
912 Ga0268265_10023622
913 Ga0268265_10048814
914 Ga0268265_11486414
915 Ga0268265_11613842
916 Ga0268264_10097795
917 Ga0268264_10116406
918 Ga0268264_11131782
919 Ga0268264_11159910
920 Ga0265338_10009869
921 Ga0265332_10294156
922 Ga0265320_10191796
923 Ga0265325_10003767
924 Ga0265325_10025534
925 Ga0265340_10004794
926 Ga0265316_10087854
927 Ga0265313_10160563
928 Ga0265342_10014517
929 Ga0307405_10204117
930 Ga0307413_10200594
931 Ga0307410_10820050
932 Ga0307412_10277166
933 Ga0307412_11443367
934 Ga0307409_100071030
935 Ga0307409_100816826
936 Ga0307416_100283968
937 Ga0307416_100373953
938 Ga0307416_101992798
939 Ga0307415_100237403
940 Ga0307415_100324406
941 Ga0316214_1001070
942 Ga0373954_0077969
943 Ga0373954_0438125
944 Ga0373935_0015396
945 Ga0373925_0541450
946 Ga0436365_0569722
947 Ga0436360_0255695
948 Ga0466965_0521236
949 Ga0495629_0229099
950 Ga0495651_0347022
951 Ga0495630_0157982
952 Ga0495643_0523243
953 Ga0495587_0535672
954 Ga0495667_0129706
955 Ga0495668_0428773
956 Ga0495657_0623846
957 Ga0495623_0324690
958 Ga0495680_0060851
959 Ga0496100_0438679
960 Ga0496100_0451350
961 Ga0496100_0619923
962 Ga0496100_0690008
963 Ga0496101_0161320
964 Ga0496101_0419001
965 Ga0496101_0738310
966 Ga0496101_0964018
967 Ga0496102_0067296
968 Ga0496102_0122572
969 Ga0496102_0262462
970 Ga0496102_0315360
971 Ga0496102_1245619
972 Ga0496103_0269185
973 Ga0496104_0067971
974 Ga0496104_0069091
975 Ga0496104_0230497
976 Ga0496104_0850665
977 Ga0496105_0000534
978 Ga0496105_0006304
979 Ga0496105_0030443
980 Ga0496106_0505846
981 Ga0496107_0041340
982 Ga0496107_0091324
983 Ga0496108_0213288
984 Ga0496108_0251018
985 Ga0496108_0529980
986 Ga0496108_0879252
987 Ga0496109_0091137
988 Ga0496109_0096575
989 Ga0496109_0164659
990 Ga0496109_0199657
991 Ga0496109_0296242
992 Ga0496109_0639849
993 Ga0496109_0768531
994 Ga0496109_0835072
995 Ga0496109_1325517
996 Ga0496110_0093440
997 Ga0496111_0005869
998 Ga0496111_0226775
999 Ga0496111_0568299
1000 Ga0496112_0332309
1001 Ga0496113_0011520
1002 Ga0496113_0090537
1003 Ga0496113_0372036
1004 Ga0496113_0424019
1005 Ga0496114_0028331
1006 Ga0496114_0028734
1007 Ga0496114_0035794
1008 Ga0496115_0012002
1009 Ga0496115_0397698
1010 Ga0496115_0955130
1011 Ga0496126_0704702
1012 Ga0501034_0027866
1013 Ga0501034_0128255
1014 Ga0501036_0023095
1015 Ga0501036_0024558
1016 Ga0501036_1525575
1017 Ga0501037_0171873
1018 Ga0501038_0091739
1019 Ga0501038_0640463
1020 Ga0501039_0008724
1021 Ga0501040_0013967
1022 Ga0501040_0092815
1023 Ga0501041_0113011
1024 Ga0501041_0128773
1025 Ga0501042_0004580
1026 Ga0501046_0023505
1027 Ga0501047_0216148
1028 Ga0501048_0063849
1029 Ga0501067_0012553
1030 Ga0501067_0016194
1031 Ga0501068_0008217
1032 Ga0501068_0031216
1033 Ga0501068_0218534
1034 Ga0501069_0026250
1035 Ga0501070_0004104
1036 Ga0501070_0027507
1037 Ga0501070_0078833
1038 Ga0501071_0005661
1039 Ga0501071_0110051
1040 Ga0501071_0112948
1041 Ga0501071_0259893
1042 Ga0501072_0019122
1043 Ga0501072_0045579
1044 Ga0501072_0057294
1045 Ga0501072_0621491
1046 Ga0501073_0022301
1047 Ga0501073_0064200
1048 Ga0501074_0002465
1049 Ga0501074_0007614
1050 Ga0501074_0022489
1051 Ga0501074_0149438
1052 Ga0501074_0426486
1053 Ga0501074_0864211
1054 Ga0501075_0012059
1055 Ga0501076_0049521
1056 Ga0501076_0216398
1057 Ga0501076_0349101
1058 Ga0501076_0469829
1059 Ga0501077_0022668
1060 Ga0501077_0028327
1061 Ga0501077_0710442
1062 Ga0501079_0046199
1063 Ga0501079_0087126
1064 Ga0501079_0270600
1065 Ga0501080_0010722
1066 Ga0501080_0021517
1067 Ga0501080_0047234
1068 Ga0501083_0027487
1069 Ga0501083_0047472
1070 Ga0501083_0072150
1071 Ga0501035_0118321
1072 Ga0501035_0367539
1073 Ga0501045_0078294
1074 Ga0501045_0289725
1075 Ga0501045_0578030
1076 nmdc:mga03n38_82478_c1
1077 nmdc:mga00v17_232968_c1
1078 nmdc:mga00v17_56733_c1
1079 nmdc:mga0yw44_207405_c1
1080 nmdc:mga0yw44_59642_c1
1081 nmdc:mga0yw44_9073_c1
1082 nmdc:mga07m45_86212_c1
1083 nmdc:mga05p37_1488889_c1
1084 nmdc:mga09592_1129286_c1
1085 nmdc:mga0qj67_791273_c1
1086 nmdc:mga06r32_645795_c1
1087 nmdc:mga08y16_1006652_c1
1088 nmdc:mga08y16_129853_c1
1089 nmdc:mga08y16_301119_c1
1090 Ga0495595_0111266
1091 Ga0495595_0492037
1092 Ga0500573_0299830
1093 Ga0501084_0084433
1094 Ga0501084_0096306
1095 Ga0501084_0117151
1096 Ga0501084_1523680
1097 Ga0501082_0022886
1098 Ga0501082_0029714
1099 Ga0501082_0081696
1100 Ga0501082_0246527
1101 Ga0501082_0433825
1102 Ga0530510_0093337
1103 Ga0530510_1387522
1104 2644092078
1105 2644321881
1106 8002775263

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
1yd1-assembly1.cif.gz_A crystal structure of the giy-yig n-terminal endonuclease domain of uvrc from thermotoga maritima bound to its catalytic divalent cation: magnesium 0.7374 23 110
1yd4-assembly1.cif.gz_A crystal structure of the giy-yig n-terminal endonuclease domain of uvrc from thermotoga maritima: point mutant y29f bound to its catalytic divalent cation 0.737 23 110
1yd3-assembly1.cif.gz_A crystal structure of the giy-yig n-terminal endonuclease domain of uvrc from thermotoga maritima: point mutant y43f bound to its catalytic divalent cation 0.7222 23 110
1yd2-assembly1.cif.gz_A crystal structure of the giy-yig n-terminal endonuclease domain of uvrc from thermotoga maritima: point mutant y19f bound to the catalytic divalent cation 0.6948 23 110
1yd5-assembly1.cif.gz_A crystal structure of the giy-yig n-terminal endonuclease domain of uvrc from thermotoga maritima: point mutant n88a bound to its catalytic divalent cation 0.6924 23 109
ID Description Score Start End Superfamily
af_Q2FZD0_4_102_3.40.1440.10 Alpha Beta;3-Layer(aba) Sandwich;GIY-YIG endonuclease;GIY-YIG endonuclease 0.7046 22 117 3.40.1440.10
1yd2A00 Alpha Beta;3-Layer(aba) Sandwich;GIY-YIG endonuclease;GIY-YIG endonuclease 0.6948 23 110 3.40.1440.10
af_P9WLJ1_236_332_3.40.1440.10 Alpha Beta;3-Layer(aba) Sandwich;GIY-YIG endonuclease;GIY-YIG endonuclease 0.6857 17 112 3.40.1440.10
af_P9WFC5_7_103_3.40.1440.10 Alpha Beta;3-Layer(aba) Sandwich;GIY-YIG endonuclease;GIY-YIG endonuclease 0.6695 22 117 3.40.1440.10
af_A4HS69_129_420_2.60.40.1710 Mainly Beta;Sandwich;Immunoglobulin-like;Subtilisin-like superfamily 0.6576 26 54 2.60.40.1710
ID Description Score Start End GO Terms
AF-A0A2C6W8M1-F1-model_v4 deleted 0.9482 6 110
AF-A0A1D2W7R7-F1-model_v4 GyrI-like small molecule binding domain-containing protein 0.9335 6 112
AF-A0A1F5DDV4-F1-model_v4 GIY-YIG domain-containing protein 0.9281 6 110
AF-A0A7J2YEV4-F1-model_v4 GIY-YIG nuclease family protein 0.9263 6 110
AF-A0A835XGV8-F1-model_v4 Uncharacterized protein 0.9128 6 113

Map