F462689

General Info

Members Datasets Scaffolds Average Seq Length
552 175 1104 268

Family's Representative Sequence

Representative Sequence 3300005331|Ga0070670_100225885|Ga0070670_1002258851
Length 291
Sequence MQSSTFKHGERRMKYIRHTATAIALGLALVATGQGNRADAAQGAQATPPPRSGMAYPTPAGNDPIANEGVIEDSAVDALKDMSKYLMSAQTLAITSQGTMDVVTNDGQRIQLDGVTNYKIRRPGFVIDYSSDIKGRRFIYDGKNFTVYSPKLGYYATVPAPGTNREVLDTIYNKFGIALPLEDLFRWGDGANADRIAALKSAYEVGSATVDGVETDHFAFREANVDWEVWVQKGDQPLPRKLVIVDRTDPSRPTFTARLSWQVNPPLTDADFAFVPDANAKRIQLATFKGE

Samples

Sample ID Description Type Environment
1 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
2 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
3 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
4 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
5 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
6 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
7 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
8 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
9 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
10 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
11 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
12 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
13 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
14 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
15 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
16 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
17 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
18 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
19 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
20 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
21 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
22 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
23 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
24 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
25 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
26 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
27 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
28 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
29 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
30 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
31 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
32 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
33 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
34 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
35 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
36 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
37 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
38 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
39 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
40 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
41 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
42 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
43 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
44 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
45 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
46 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
47 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
48 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
49 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
50 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
51 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
52 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
53 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
54 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
55 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
56 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
57 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
58 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
59 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
60 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
61 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
62 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
63 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
64 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
65 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
66 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
67 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
68 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
69 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
70 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
71 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
72 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
73 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
74 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
75 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
76 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
77 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
78 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
79 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
80 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
81 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
82 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
83 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
84 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
129 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
130 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
131 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
132 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
133 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
134 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
135 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
136 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
137 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
138 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
139 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
140 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
141 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
142 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
143 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
144 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
145 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
146 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
147 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
148 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
149 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
150 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
151 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
152 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
153 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
154 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
155 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
156 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
157 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
158 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
159 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
160 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
161 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
162 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
163 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
164 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
165 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
166 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
167 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
168 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
169 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
170 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
171 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
172 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
173 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
174 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
175 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 7.97
Rhizosphere 92.03
Stem 0
Stem Tuber 0
Unclassified 17.03

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070670_100225885 3300005331 Bacteria 1629
2 MBSR1b_contig_13650625 2162886012 Unclassified 1002
3 JGI24740J21852_10023377 3300001979 Bacteria 2113
4 JGI24739J22299_10038743 3300001989 Bacteria 1600
5 JGI24737J22298_10000511 3300001990 Bacteria 13579
6 JGI24743J22301_10007117 3300001991 Bacteria 1930
7 JGI24743J22301_10028295 3300001991 Unclassified 1097
8 JGI24735J21928_10003475 3300002067 Bacteria 5366
9 JGI24738J21930_10000220 3300002075 Bacteria 15441
10 JGI24749J21850_1022516 3300002076 Bacteria 893
11 Ga0065712_10072255 3300005290 Bacteria 4837
12 Ga0065712_10147727 3300005290 Bacteria 1394
13 Ga0065712_10174774 3300005290 Bacteria 1224
14 Ga0065715_10106951 3300005293 Bacteria 2798
15 Ga0065715_10129817 3300005293 Unclassified 2038
16 Ga0065715_10273265 3300005293 Unclassified 1105
17 Ga0070658_10000412 3300005327 Bacteria 37189
18 Ga0070658_10008373 3300005327 Bacteria 8314
19 Ga0070658_10011366 3300005327 Bacteria 7137
20 Ga0070658_10012480 3300005327 Bacteria 6817
21 Ga0070658_10291853 3300005327 Bacteria 1390
22 Ga0070658_10393230 3300005327 Bacteria 1190
23 Ga0070676_10032801 3300005328 Bacteria 2977
24 Ga0070676_10078058 3300005328 Bacteria 2002
25 Ga0070683_100000257 3300005329 Bacteria 36570
26 Ga0070683_100103268 3300005329 Bacteria 2686
27 Ga0070690_100005200 3300005330 Bacteria 7289
28 Ga0070690_100104916 3300005330 Unclassified 1878
29 Ga0070690_100204298 3300005330 Bacteria 1376
30 Ga0070690_100476983 3300005330 Bacteria 929
31 Ga0070670_100000333 3300005331 Bacteria 39598
32 Ga0070670_100004559 3300005331 Bacteria 11621
33 Ga0070670_100007407 3300005331 Bacteria 9319
34 Ga0070670_100015371 3300005331 Bacteria 6573
35 Ga0070670_100051781 3300005331 Bacteria 3525
36 Ga0070670_100097942 3300005331 Bacteria 2523
37 Ga0070670_100103185 3300005331 Bacteria 2456
38 Ga0070670_100209140 3300005331 Bacteria 1696
39 Ga0070670_100215367 3300005331 Bacteria 1670
40 Ga0070677_10005759 3300005333 Unclassified 4097
41 Ga0070677_10011976 3300005333 Bacteria 3002
42 Ga0070677_10012935 3300005333 Bacteria 2907
43 Ga0070677_10016424 3300005333 Bacteria 2635
44 Ga0070677_10020479 3300005333 Bacteria 2410
45 Ga0070677_10061680 3300005333 Bacteria 1548
46 Ga0070666_10000365 3300005335 Bacteria 28530
47 Ga0070666_10001819 3300005335 Bacteria 12991
48 Ga0070666_10010713 3300005335 Bacteria 5739
49 Ga0070682_100039532 3300005337 Bacteria 2899
50 Ga0068868_100041440 3300005338 Unclassified 3587
51 Ga0068868_100071340 3300005338 Bacteria 2770
52 Ga0068868_100156723 3300005338 Unclassified 1878
53 Ga0068868_100293491 3300005338 Bacteria 1379
54 Ga0070660_100001417 3300005339 Bacteria 16326
55 Ga0070660_100073142 3300005339 Unclassified 2680
56 Ga0070687_100278161 3300005343 Unclassified 1052
57 Ga0070661_100000125 3300005344 Bacteria 63406
58 Ga0070661_100007119 3300005344 Bacteria 7717
59 Ga0070661_100037652 3300005344 Bacteria 3519
60 Ga0070669_100019706 3300005353 Bacteria 4819
61 Ga0070669_100073712 3300005353 Bacteria 2530
62 Ga0070675_100001409 3300005354 Bacteria 17655
63 Ga0070675_100001589 3300005354 Bacteria 16784
64 Ga0070675_100065691 3300005354 Bacteria 3000
65 Ga0070675_100315909 3300005354 Bacteria 1379
66 Ga0070675_100326387 3300005354 Bacteria 1356
67 Ga0070675_100353503 3300005354 Bacteria 1303
68 Ga0070671_100002925 3300005355 Bacteria 13280
69 Ga0070671_100006582 3300005355 Bacteria 9287
70 Ga0070671_100009040 3300005355 Bacteria 7995
71 Ga0070671_100123073 3300005355 Bacteria 2183
72 Ga0070671_100143822 3300005355 Unclassified 2013
73 Ga0070671_100146041 3300005355 Bacteria 1996
74 Ga0070671_100158523 3300005355 Bacteria 1913
75 Ga0070671_100183251 3300005355 Bacteria 1773
76 Ga0070671_100183254 3300005355 Bacteria 1773
77 Ga0070671_100271652 3300005355 Bacteria 1441
78 Ga0070671_100427967 3300005355 Unclassified 1134
79 Ga0070674_100014681 3300005356 Bacteria 4872
80 Ga0070674_100099234 3300005356 Unclassified 2118
81 Ga0070674_100121109 3300005356 Bacteria 1937
82 Ga0070674_100201900 3300005356 Bacteria 1536
83 Ga0070674_100240572 3300005356 Bacteria 1417
84 Ga0070674_100241541 3300005356 Bacteria 1414
85 Ga0070674_100380425 3300005356 Bacteria 1148
86 Ga0070673_100000300 3300005364 Bacteria 25842
87 Ga0070673_100001334 3300005364 Bacteria 14370
88 Ga0070673_100003471 3300005364 Bacteria 9816
89 Ga0070673_100028847 3300005364 Bacteria 4132
90 Ga0070673_100081222 3300005364 Bacteria 2628
91 Ga0070673_100092868 3300005364 Unclassified 2470
92 Ga0070659_100051301 3300005366 Bacteria 3244
93 Ga0070659_100121840 3300005366 Unclassified 2113
94 Ga0070659_100192807 3300005366 Bacteria 1675
95 Ga0070659_100297011 3300005366 Unclassified 1346
96 Ga0070659_100339957 3300005366 Bacteria 1257
97 Ga0070667_100002894 3300005367 Bacteria 14761
98 Ga0070667_100003218 3300005367 Bacteria 13983
99 Ga0070667_100009246 3300005367 Bacteria 8163
100 Ga0070667_100016957 3300005367 Bacteria 6028
101 Ga0070667_100017216 3300005367 Bacteria 5986
102 Ga0070667_100038294 3300005367 Bacteria 4020
103 Ga0070667_100304621 3300005367 Bacteria 1435
104 Ga0070663_100000749 3300005455 Bacteria 17566
105 Ga0070663_100308313 3300005455 Bacteria 1269
106 Ga0070678_100014611 3300005456 Bacteria 4962
107 Ga0070678_100069650 3300005456 Plasmid 2627
108 Ga0070678_100225681 3300005456 Bacteria 1559
109 Ga0070678_100508455 3300005456 Bacteria 1064
110 Ga0070662_100000010 3300005457 Bacteria 142717
111 Ga0070662_100003663 3300005457 Bacteria 9597
112 Ga0070662_100004001 3300005457 Bacteria 9242
113 Ga0070662_100005803 3300005457 Bacteria 7915
114 Ga0070662_100021913 3300005457 Bacteria 4367
115 Ga0070662_100024117 3300005457 Bacteria 4187
116 Ga0070662_100031808 3300005457 Plasmid 3706
117 Ga0070662_100061813 3300005457 Bacteria 2735
118 Ga0070662_100089993 3300005457 Bacteria 2302
119 Ga0070662_100155850 3300005457 Bacteria 1783
120 Ga0070662_100222793 3300005457 Bacteria 1506
121 Ga0070662_100225097 3300005457 Unclassified 1498
122 Ga0070662_100363349 3300005457 Bacteria 1188
123 Ga0068867_100010098 3300005459 Bacteria 6653
124 Ga0068867_100012655 3300005459 Bacteria 5967
125 Ga0068867_100308877 3300005459 Bacteria 1306
126 Ga0068867_100590381 3300005459 Unclassified 967
127 Ga0070685_10205018 3300005466 Bacteria 1284
128 Ga0070679_100067647 3300005530 Unclassified 3562
129 Ga0070684_100032798 3300005535 Bacteria 4430
130 Ga0070684_100130185 3300005535 Bacteria 2269
131 Ga0068853_100227723 3300005539 Bacteria 1704
132 Ga0070672_100001602 3300005543 Bacteria 14053
133 Ga0070672_100043868 3300005543 Bacteria 3452
134 Ga0070672_100066683 3300005543 Unclassified 2850
135 Ga0070672_100100483 3300005543 Bacteria 2346
136 Ga0070672_100268055 3300005543 Bacteria 1441
137 Ga0070686_100020605 3300005544 Bacteria 3904
138 Ga0070696_100161441 3300005546 Bacteria 1651
139 Ga0070693_100002007 3300005547 Bacteria 9310
140 Ga0070665_100006777 3300005548 Bacteria 11645
141 Ga0070665_100031815 3300005548 Bacteria 5310
142 Ga0070665_100092977 3300005548 Bacteria 3021
143 Ga0068855_100007260 3300005563 Bacteria 13435
144 Ga0070664_100002041 3300005564 Bacteria 16180
145 Ga0070664_100004556 3300005564 Bacteria 11120
146 Ga0070664_100021707 3300005564 Bacteria 5295
147 Ga0070664_100129627 3300005564 Bacteria 2215
148 Ga0070664_100268954 3300005564 Bacteria 1535
149 Ga0070664_100441270 3300005564 Bacteria 1194
150 Ga0068857_100464815 3300005577 Bacteria 1184
151 Ga0068854_100149037 3300005578 Bacteria 1802
152 Ga0068856_100000442 3300005614 Bacteria 45717
153 Ga0068856_100215407 3300005614 Bacteria 1936
154 Ga0068856_100475648 3300005614 Bacteria 1270
155 Ga0068856_100633663 3300005614 Bacteria 1090
156 Ga0068856_100668551 3300005614 Bacteria 1059
157 Ga0070702_100150224 3300005615 Unclassified 1494
158 Ga0068852_100000241 3300005616 Bacteria 37155
159 Ga0068852_100002928 3300005616 Bacteria 11857
160 Ga0068852_100026422 3300005616 Bacteria 4718
161 Ga0068852_100047770 3300005616 Bacteria 3654
162 Ga0068852_100149597 3300005616 Bacteria 2170
163 Ga0068852_100285605 3300005616 Bacteria 1592
164 Ga0068859_100050423 3300005617 Unclassified 4181
165 Ga0068859_100123289 3300005617 Unclassified 2659
166 Ga0068859_100554564 3300005617 Unclassified 1243
167 Ga0068864_100002110 3300005618 Bacteria 16437
168 Ga0068864_100020430 3300005618 Bacteria 5540
169 Ga0068864_100024886 3300005618 Bacteria 5036
170 Ga0068864_100032885 3300005618 Bacteria 4408
171 Ga0068864_100118156 3300005618 Bacteria 2367
172 Ga0068864_100122817 3300005618 Bacteria 2324
173 Ga0068866_10353500 3300005718 Bacteria 934
174 Ga0068861_100384907 3300005719 Unclassified 1240
175 Ga0068851_10084441 3300005834 Unclassified 1663
176 Ga0068851_10291822 3300005834 Unclassified 935
177 Ga0068870_10082883 3300005840 Bacteria 1777
178 Ga0068870_10298367 3300005840 Bacteria 1016
179 Ga0068863_100021441 3300005841 Bacteria 6166
180 Ga0068863_100062752 3300005841 Bacteria 3514
181 Ga0068863_100119418 3300005841 Bacteria 2513
182 Ga0068863_100351098 3300005841 Unclassified 1436
183 Ga0068863_100491381 3300005841 Bacteria 1208
184 Ga0068858_100000950 3300005842 Bacteria 29938
185 Ga0068858_100034078 3300005842 Unclassified 4723
186 Ga0068860_100056720 3300005843 Bacteria 3723
187 Ga0068860_100107734 3300005843 Bacteria 2663
188 Ga0068860_100115459 3300005843 Unclassified 2568
189 Ga0097621_100016446 3300006237 Bacteria 5593
190 Ga0097621_100034946 3300006237 Bacteria 4012
191 Ga0097621_100053265 3300006237 Unclassified 3298
192 Ga0097621_100227302 3300006237 Bacteria 1628
193 Ga0068871_100008629 3300006358 Bacteria 7330
194 Ga0068871_100059804 3300006358 Plasmid 3106
195 Ga0068871_100208327 3300006358 Unclassified 1690
196 Ga0068871_100348595 3300006358 Unclassified 1309
197 Ga0068865_100008543 3300006881 Bacteria 6330
198 Ga0097620_100050422 3300006931 Unclassified 4181
199 Ga0097620_100123284 3300006931 Unclassified 2659
200 Ga0097620_100554566 3300006931 Unclassified 1243
201 Ga0105240_10084998 3300009093 Unclassified 3878
202 Ga0111539_10288255 3300009094 Bacteria 1911
203 Ga0105245_10397267 3300009098 Bacteria 1377
204 Ga0105242_10106226 3300009176 Unclassified 2386
205 Ga0105248_10000334 3300009177 Bacteria 55634
206 Ga0105248_10021126 3300009177 Bacteria 7213
207 Ga0105248_10024377 3300009177 Bacteria 6727
208 Ga0105248_10031402 3300009177 Bacteria 5937
209 Ga0105248_10060033 3300009177 Bacteria 4270
210 Ga0105248_10063007 3300009177 Unclassified 4162
211 Ga0105248_10130116 3300009177 Bacteria 2839
212 Ga0105248_10241563 3300009177 Unclassified 2033
213 Ga0105248_10296280 3300009177 Bacteria 1821
214 Ga0105248_10401182 3300009177 Bacteria 1544
215 Ga0105248_10542109 3300009177 Unclassified 1312
216 Ga0105238_10004646 3300009551 Bacteria 13590
217 Ga0105238_10224900 3300009551 Unclassified 1853
218 Ga0105238_10455958 3300009551 Bacteria 1276
219 Ga0105238_10517659 3300009551 Bacteria 1195
220 Ga0105249_10043083 3300009553 Bacteria 4106
221 Ga0105249_10299443 3300009553 Bacteria 1612
222 Ga0105239_10101525 3300010375 Bacteria 3182
223 Ga0157373_10012884 3300013100 Bacteria 6139
224 Ga0157373_10059374 3300013100 Unclassified 2710
225 Ga0157373_10139683 3300013100 Unclassified 1703
226 Ga0157371_10000972 3300013102 Bacteria 31828
227 Ga0157371_10247618 3300013102 Bacteria 1283
228 Ga0157370_10435540 3300013104 Bacteria 1206
229 Ga0157369_10013845 3300013105 Bacteria 9114
230 Ga0157369_10100714 3300013105 Bacteria 3079
231 Ga0157369_10407500 3300013105 Bacteria 1410
232 Ga0157374_10005506 3300013296 Bacteria 10637
233 Ga0157374_10071963 3300013296 Unclassified 3261
234 Ga0157374_10090451 3300013296 Bacteria 2918
235 Ga0157374_10148201 3300013296 Bacteria 2280
236 Ga0157378_10064306 3300013297 Unclassified 3281
237 Ga0163162_10008188 3300013306 Bacteria 10199
238 Ga0163162_10041634 3300013306 Bacteria 4597
239 Ga0163162_10072304 3300013306 Plasmid 3504
240 Ga0163162_10182868 3300013306 Bacteria 2222
241 Ga0163162_10363501 3300013306 Bacteria 1580
242 Ga0163162_10521299 3300013306 Bacteria 1318
243 Ga0157375_10023540 3300013308 Bacteria 5684
244 Ga0157375_10038793 3300013308 Bacteria 4576
245 Ga0157375_10113562 3300013308 Bacteria 2810
246 Ga0163163_10000313 3300014325 Bacteria 47673
247 Ga0163163_10103574 3300014325 Bacteria 2871
248 Ga0163163_10534637 3300014325 Bacteria 1235
249 Ga0157380_10007665 3300014326 Bacteria 7679
250 Ga0157380_10342129 3300014326 Bacteria 1396
251 Ga0157379_10042873 3300014968 Bacteria 4040
252 Ga0157379_10343989 3300014968 Unclassified 1364
253 Ga0157376_10005451 3300014969 Bacteria 8893
254 Ga0163161_10036462 3300017792 Plasmid 3521
255 Ga0163161_10322036 3300017792 Unclassified 1222
256 Ga0163161_10357550 3300017792 Unclassified 1162
257 Ga0163161_10476849 3300017792 Bacteria 1012
258 Ga0207697_10001597 3300025315 Bacteria 12234
259 Ga0207697_10064473 3300025315 Bacteria 1528
260 Ga0207697_10145543 3300025315 Bacteria 1029
261 Ga0207697_10193030 3300025315 Bacteria 894
262 Ga0207682_10003305 3300025893 Bacteria 7041
263 Ga0207682_10005479 3300025893 Bacteria 5168
264 Ga0207682_10008658 3300025893 Bacteria 4023
265 Ga0207682_10044937 3300025893 Unclassified 1812
266 Ga0207682_10149566 3300025893 Unclassified 1052
267 Ga0207682_10172608 3300025893 Bacteria 984
268 Ga0207688_10012630 3300025901 Bacteria 4596
269 Ga0207680_10005624 3300025903 Bacteria 5999
270 Ga0207680_10008998 3300025903 Bacteria 4930
271 Ga0207680_10018472 3300025903 Unclassified 3707
272 Ga0207680_10048610 3300025903 Plasmid 2521
273 Ga0207680_10185176 3300025903 Bacteria 1410
274 Ga0207647_10100557 3300025904 Bacteria 1716
275 Ga0207645_10040776 3300025907 Bacteria 2973
276 Ga0207645_10231740 3300025907 Unclassified 1219
277 Ga0207645_10240618 3300025907 Bacteria 1196
278 Ga0207643_10181368 3300025908 Bacteria 1274
279 Ga0207705_10000232 3300025909 Bacteria 55596
280 Ga0207705_10007885 3300025909 Bacteria 7817
281 Ga0207705_10011437 3300025909 Bacteria 6423
282 Ga0207705_10025491 3300025909 Bacteria 4220
283 Ga0207705_10248393 3300025909 Bacteria 1356
284 Ga0207657_10000026 3300025919 Bacteria 143118
285 Ga0207657_10098931 3300025919 Bacteria 2423
286 Ga0207649_10000318 3300025920 Bacteria 36532
287 Ga0207649_10009880 3300025920 Bacteria 5230
288 Ga0207649_10039868 3300025920 Bacteria 2850
289 Ga0207649_10079380 3300025920 Bacteria 2120
290 Ga0207652_10195677 3300025921 Unclassified 1819
291 Ga0207681_10012667 3300025923 Bacteria 5207
292 Ga0207681_10067152 3300025923 Bacteria 2485
293 Ga0207681_10177947 3300025923 Bacteria 1618
294 Ga0207694_10020260 3300025924 Bacteria 5029
295 Ga0207694_10070831 3300025924 Bacteria 2724
296 Ga0207694_10265548 3300025924 Bacteria 1407
297 Ga0207650_10007919 3300025925 Bacteria 7243
298 Ga0207650_10011936 3300025925 Bacteria 5988
299 Ga0207650_10012230 3300025925 Bacteria 5922
300 Ga0207650_10032913 3300025925 Bacteria 3752
301 Ga0207650_10047116 3300025925 Unclassified 3176
302 Ga0207650_10048689 3300025925 Bacteria 3127
303 Ga0207650_10074420 3300025925 Bacteria 2560
304 Ga0207650_10171288 3300025925 Bacteria 1726
305 Ga0207650_10175953 3300025925 Bacteria 1703
306 Ga0207659_10004196 3300025926 Bacteria 8707
307 Ga0207659_10007823 3300025926 Bacteria 6603
308 Ga0207659_10017557 3300025926 Bacteria 4675
309 Ga0207659_10041643 3300025926 Bacteria 3217
310 Ga0207659_10048484 3300025926 Bacteria 3009
311 Ga0207687_10318041 3300025927 Bacteria 1259
312 Ga0207644_10000453 3300025931 Bacteria 26500
313 Ga0207644_10002648 3300025931 Bacteria 11528
314 Ga0207644_10023476 3300025931 Bacteria 4224
315 Ga0207644_10039948 3300025931 Unclassified 3314
316 Ga0207644_10046900 3300025931 Bacteria 3081
317 Ga0207644_10067571 3300025931 Unclassified 2605
318 Ga0207644_10139802 3300025931 Bacteria 1863
319 Ga0207644_10141531 3300025931 Unclassified 1853
320 Ga0207644_10159306 3300025931 Unclassified 1753
321 Ga0207644_10198140 3300025931 Bacteria 1583
322 Ga0207644_10393594 3300025931 Bacteria 1131
323 Ga0207690_10000748 3300025932 Bacteria 20981
324 Ga0207690_10058395 3300025932 Bacteria 2610
325 Ga0207690_10367532 3300025932 Bacteria 1141
326 Ga0207706_10000031 3300025933 Bacteria 143109
327 Ga0207706_10000891 3300025933 Bacteria 30650
328 Ga0207706_10001491 3300025933 Bacteria 23257
329 Ga0207706_10001496 3300025933 Bacteria 23213
330 Ga0207706_10006408 3300025933 Bacteria 10935
331 Ga0207706_10006885 3300025933 Bacteria 10512
332 Ga0207706_10011822 3300025933 Bacteria 7949
333 Ga0207706_10014166 3300025933 Bacteria 7229
334 Ga0207706_10033966 3300025933 Unclassified 4539
335 Ga0207706_10037194 3300025933 Bacteria 4323
336 Ga0207706_10038104 3300025933 Bacteria 4265
337 Ga0207706_10053720 3300025933 Bacteria 3556
338 Ga0207706_10060539 3300025933 Bacteria 3334
339 Ga0207669_10007557 3300025937 Bacteria 5038
340 Ga0207669_10025587 3300025937 Unclassified 3193
341 Ga0207669_10053418 3300025937 Unclassified 2434
342 Ga0207669_10073095 3300025937 Unclassified 2162
343 Ga0207669_10815917 3300025937 Bacteria 774
344 Ga0207704_10126917 3300025938 Unclassified 1758
345 Ga0207704_10132652 3300025938 Bacteria 1728
346 Ga0207704_10137965 3300025938 Unclassified 1701
347 Ga0207704_10190152 3300025938 Bacteria 1493
348 Ga0207691_10002105 3300025940 Bacteria 19452
349 Ga0207691_10005491 3300025940 Bacteria 12245
350 Ga0207691_10015349 3300025940 Bacteria 7286
351 Ga0207691_10026329 3300025940 Bacteria 5459
352 Ga0207691_10028056 3300025940 Bacteria 5274
353 Ga0207691_10050646 3300025940 Plasmid 3801
354 Ga0207691_10072307 3300025940 Plasmid 3111
355 Ga0207691_10092969 3300025940 Bacteria 2701
356 Ga0207691_10128472 3300025940 Bacteria 2240
357 Ga0207711_10000689 3300025941 Bacteria 33281
358 Ga0207711_10002640 3300025941 Bacteria 15854
359 Ga0207711_10003270 3300025941 Bacteria 14100
360 Ga0207711_10009295 3300025941 Bacteria 8206
361 Ga0207711_10011496 3300025941 Bacteria 7359
362 Ga0207711_10013369 3300025941 Bacteria 6818
363 Ga0207711_10023669 3300025941 Bacteria 5142
364 Ga0207711_10088289 3300025941 Bacteria 2722
365 Ga0207711_10344876 3300025941 Archaea 1379
366 Ga0207711_10353701 3300025941 Bacteria 1360
367 Ga0207661_10001521 3300025944 Bacteria 15737
368 Ga0207661_10054836 3300025944 Plasmid 3195
369 Ga0207679_10001421 3300025945 Bacteria 15055
370 Ga0207679_10007871 3300025945 Bacteria 6771
371 Ga0207679_10016684 3300025945 Unclassified 4879
372 Ga0207679_10058719 3300025945 Bacteria 2852
373 Ga0207679_10160746 3300025945 Bacteria 1839
374 Ga0207679_10471022 3300025945 Bacteria 1117
375 Ga0207667_10043270 3300025949 Bacteria 4780
376 Ga0207667_10374428 3300025949 Bacteria 1451
377 Ga0207651_10000590 3300025960 Bacteria 15282
378 Ga0207651_10002715 3300025960 Bacteria 8482
379 Ga0207651_10066145 3300025960 Unclassified 2538
380 Ga0207651_10160845 3300025960 Bacteria 1760
381 Ga0207668_10084462 3300025972 Bacteria 2314
382 Ga0207668_10175564 3300025972 Unclassified 1685
383 Ga0207668_10316809 3300025972 Bacteria 1293
384 Ga0207640_10003303 3300025981 Bacteria 8699
385 Ga0207658_10010558 3300025986 Bacteria 6274
386 Ga0207658_10032143 3300025986 Bacteria 3732
387 Ga0207658_10047705 3300025986 Bacteria 3136
388 Ga0207658_10190472 3300025986 Bacteria 1704
389 Ga0207658_10285477 3300025986 Bacteria 1416
390 Ga0207658_10300387 3300025986 Bacteria 1383
391 Ga0207658_10330674 3300025986 Bacteria 1322
392 Ga0207658_10629067 3300025986 Unclassified 966
393 Ga0207677_10013600 3300026023 Bacteria 4722
394 Ga0207677_10085342 3300026023 Bacteria 2279
395 Ga0207677_10249645 3300026023 Bacteria 1440
396 Ga0207677_10273239 3300026023 Bacteria 1384
397 Ga0207703_10002789 3300026035 Bacteria 14936
398 Ga0207703_10017392 3300026035 Bacteria 5613
399 Ga0207639_10001610 3300026041 Bacteria 15192
400 Ga0207678_10006897 3300026067 Bacteria 10076
401 Ga0207678_10335245 3300026067 Bacteria 1303
402 Ga0207702_10000891 3300026078 Bacteria 30976
403 Ga0207702_10121585 3300026078 Bacteria 2338
404 Ga0207702_10413642 3300026078 Bacteria 1303
405 Ga0207641_10092531 3300026088 Unclassified 2648
406 Ga0207641_10103396 3300026088 Bacteria 2513
407 Ga0207641_10354932 3300026088 Unclassified 1398
408 Ga0207641_10758594 3300026088 Bacteria 958
409 Ga0207648_10013235 3300026089 Bacteria 7686
410 Ga0207648_10050063 3300026089 Bacteria 3654
411 Ga0207648_10300162 3300026089 Bacteria 1440
412 Ga0207676_10001039 3300026095 Bacteria 21255
413 Ga0207676_10001128 3300026095 Bacteria 20175
414 Ga0207676_10003906 3300026095 Bacteria 10528
415 Ga0207676_10026827 3300026095 Bacteria 4285
416 Ga0207676_10037492 3300026095 Bacteria 3695
417 Ga0207676_10086922 3300026095 Unclassified 2555
418 Ga0207676_10103468 3300026095 Bacteria 2366
419 Ga0207676_10164075 3300026095 Bacteria 1928
420 Ga0207676_10609600 3300026095 Unclassified 1049
421 Ga0207676_10696090 3300026095 Bacteria 984
422 Ga0207675_100054307 3300026118 Bacteria 3737
423 Ga0207675_100467170 3300026118 Unclassified 1252
424 Ga0207683_10003227 3300026121 Bacteria 14225
425 Ga0207683_10004016 3300026121 Bacteria 12730
426 Ga0207683_10006619 3300026121 Bacteria 9916
427 Ga0207683_10006799 3300026121 Bacteria 9793
428 Ga0207683_10019788 3300026121 Bacteria 5749
429 Ga0207683_10134835 3300026121 Bacteria 2222
430 Ga0207683_10418783 3300026121 Bacteria 1233
431 Ga0207698_10002067 3300026142 Bacteria 11838
432 Ga0207698_10020225 3300026142 Bacteria 4577
433 Ga0207698_10037621 3300026142 Bacteria 3566
434 Ga0207698_10058645 3300026142 Bacteria 2985
435 Ga0207698_10189860 3300026142 Bacteria 1829
436 Ga0268266_10011728 3300028379 Bacteria 7603
437 Ga0268266_10022196 3300028379 Bacteria 5410
438 Ga0268266_10039664 3300028379 Bacteria 4011
439 Ga0268266_10183319 3300028379 Bacteria 1907
440 Ga0268265_10526500 3300028380 Bacteria 1118
441 Ga0268264_10083683 3300028381 Bacteria 2734
442 Ga0268264_10236807 3300028381 Bacteria 1689
443 Ga0268264_10321923 3300028381 Bacteria 1462
444 Ga0307413_10086532 3300031824 Bacteria 2026
445 Ga0307413_10236230 3300031824 Bacteria 1346
446 Ga0307410_10014722 3300031852 Bacteria 4615
447 Ga0307410_10076155 3300031852 Bacteria 2341
448 Ga0307410_10215357 3300031852 Bacteria 1474
449 Ga0307406_10324984 3300031901 Bacteria 1192
450 Ga0307407_10030406 3300031903 Bacteria 2913
451 Ga0307409_100146556 3300031995 Bacteria 2042
452 Ga0307409_100201702 3300031995 Bacteria 1780
453 Ga0307416_100144690 3300032002 Bacteria 2168
454 Ga0307416_100369530 3300032002 Bacteria 1460
455 Ga0307414_10082046 3300032004 Unclassified 2363
456 Ga0307414_10126252 3300032004 Bacteria 1977
457 Ga0307414_10217378 3300032004 Bacteria 1566
458 Ga0373929_0016778 3300035085 Bacteria 1439
459 Ga0373951_0007328 3300035091 Bacteria 2507
460 Ga0373942_0143932 3300035207 Unclassified 761
461 Ga0373962_0018818 3300035242 Bacteria 1801
462 Ga0373931_0026279 3300035691 Unclassified 2962
463 Ga0373931_0119759 3300035691 Bacteria 1503
464 Ga0373935_0121817 3300035692 Bacteria 1744
465 Ga0373947_0066199 3300035725 Bacteria 2205
466 Ga0395899_0057960 3300037312 Bacteria 2857
467 Ga0395900_0021919 3300037418 Bacteria 6531
468 Ga0395898_0032922 3300037466 Bacteria 5174
469 Ga0395898_0034679 3300037466 Bacteria 5025
470 Ga0395898_0163626 3300037466 Bacteria 2128
471 Ga0395898_0260151 3300037466 Bacteria 1655
472 Ga0395905_0003103 3300037471 Bacteria 17941
473 Ga0395905_0023086 3300037471 Bacteria 5880
474 Ga0395905_0043111 3300037471 Bacteria 4233
475 Ga0395905_0178054 3300037471 Unclassified 1996
476 Ga0395901_0021139 3300038443 Bacteria 6666
477 Ga0395901_0306533 3300038443 Unclassified 1645
478 Ga0450907_012269 3300042146 Bacteria 1425
479 Ga0495584_0164255 3300046491 Bacteria 1129
480 Ga0495596_0025193 3300046500 Bacteria 2406
481 Ga0495663_0000665 3300046525 Bacteria 11898
482 Ga0495663_0026792 3300046525 Bacteria 1689
483 Ga0495642_0025621 3300046528 Bacteria 2338
484 Ga0495598_0015235 3300046537 Unclassified 1937
485 Ga0495598_0045265 3300046537 Bacteria 1303
486 Ga0495621_0000724 3300046539 Bacteria 8371
487 Ga0495621_0024503 3300046539 Unclassified 2016
488 Ga0495621_0034543 3300046539 Bacteria 1747
489 Ga0495621_0039311 3300046539 Bacteria 1654
490 Ga0495621_0067993 3300046539 Bacteria 1306
491 Ga0495656_0109045 3300046615 Bacteria 1292
492 Ga0495659_0008541 3300046664 Unclassified 3260
493 Ga0495669_0000504 3300046684 Bacteria 17817
494 Ga0495669_0002584 3300046684 Bacteria 7399
495 Ga0495669_0022068 3300046684 Unclassified 2765
496 Ga0495669_0034291 3300046684 Unclassified 2237
497 Ga0495669_0074301 3300046684 Bacteria 1554
498 Ga0495670_0039540 3300046691 Bacteria 2352
499 Ga0495670_0042009 3300046691 Bacteria 2281
500 Ga0495670_0051269 3300046691 Unclassified 2065
501 Ga0495670_0076630 3300046691 Unclassified 1699
502 Ga0495670_0131751 3300046691 Unclassified 1303
503 Ga0495670_0214850 3300046691 Unclassified 1021
504 Ga0495677_0001792 3300047445 Bacteria 8595
505 Ga0495677_0007258 3300047445 Bacteria 4146
506 Ga0495677_0069027 3300047445 Unclassified 1316
507 Ga0496100_0018120 3300048903 Bacteria 4171
508 Ga0496101_0035570 3300048904 Bacteria 3523
509 Ga0496102_0234833 3300048905 Bacteria 1729
510 Ga0496102_0345310 3300048905 Unclassified 1401
511 Ga0496103_0045774 3300048906 Bacteria 2700
512 Ga0496104_0070971 3300048907 Bacteria 3312
513 Ga0496104_0595490 3300048907 Bacteria 1016
514 Ga0496105_0040643 3300048908 Bacteria 3835
515 Ga0496105_0143709 3300048908 Bacteria 1963
516 Ga0496107_0007729 3300048910 Bacteria 7426
517 Ga0496107_0022488 3300048910 Bacteria 4456
518 Ga0496107_0280168 3300048910 Bacteria 1241
519 Ga0496108_0004989 3300048911 Bacteria 10723
520 Ga0496108_0009338 3300048911 Bacteria 7942
521 Ga0496108_0064184 3300048911 Unclassified 3093
522 Ga0496108_0226425 3300048911 Bacteria 1625
523 Ga0496109_0040506 3300048912 Bacteria 4220
524 Ga0496109_0233582 3300048912 Bacteria 1730
525 Ga0496109_0316113 3300048912 Bacteria 1473
526 Ga0496109_0333963 3300048912 Bacteria 1431
527 Ga0496109_0638954 3300048912 Bacteria 1001
528 Ga0496109_0952849 3300048912 Unclassified 796
529 Ga0496110_0004034 3300048913 Bacteria 11327
530 Ga0496110_0014480 3300048913 Bacteria 6551
531 Ga0496110_0024645 3300048913 Bacteria 5130
532 Ga0496110_0039208 3300048913 Bacteria 4125
533 Ga0496110_0060684 3300048913 Plasmid 3336
534 Ga0496111_0010033 3300048914 Bacteria 6337
535 Ga0496111_0018350 3300048914 Unclassified 4846
536 Ga0496111_0095697 3300048914 Bacteria 2179
537 Ga0496111_0327415 3300048914 Bacteria 1134
538 Ga0496112_0002602 3300048915 Bacteria 14575
539 Ga0496112_0010652 3300048915 Bacteria 8353
540 Ga0496112_0073475 3300048915 Bacteria 3380
541 Ga0496112_0085429 3300048915 Bacteria 3122
542 Ga0496112_0387860 3300048915 Unclassified 1337
543 Ga0496113_0000711 3300048916 Bacteria 17036
544 Ga0496113_0004944 3300048916 Bacteria 8256
545 Ga0496113_0020496 3300048916 Bacteria 4649
546 Ga0496113_0122410 3300048916 Bacteria 2035
547 Ga0496114_0020040 3300048917 Bacteria 5425
548 Ga0496114_0042353 3300048917 Bacteria 3774
549 Ga0496114_0144946 3300048917 Bacteria 2058
550 Ga0496115_0085153 3300048918 Bacteria 2578
551 Ga0501074_0161928 3300049590 Bacteria 1598
552 Ga0501268_010416 3300049765 Bacteria 1448
553 Ga0070670_100225885
554 MBSR1b_contig_13650625
555 JGI24740J21852_10023377
556 JGI24739J22299_10038743
557 JGI24737J22298_10000511
558 JGI24743J22301_10007117
559 JGI24743J22301_10028295
560 JGI24735J21928_10003475
561 JGI24738J21930_10000220
562 JGI24749J21850_1022516
563 Ga0065712_10072255
564 Ga0065712_10147727
565 Ga0065712_10174774
566 Ga0065715_10106951
567 Ga0065715_10129817
568 Ga0065715_10273265
569 Ga0070658_10000412
570 Ga0070658_10008373
571 Ga0070658_10011366
572 Ga0070658_10012480
573 Ga0070658_10291853
574 Ga0070658_10393230
575 Ga0070676_10032801
576 Ga0070676_10078058
577 Ga0070683_100000257
578 Ga0070683_100103268
579 Ga0070690_100005200
580 Ga0070690_100104916
581 Ga0070690_100204298
582 Ga0070690_100476983
583 Ga0070670_100000333
584 Ga0070670_100004559
585 Ga0070670_100007407
586 Ga0070670_100015371
587 Ga0070670_100051781
588 Ga0070670_100097942
589 Ga0070670_100103185
590 Ga0070670_100209140
591 Ga0070670_100215367
592 Ga0070677_10005759
593 Ga0070677_10011976
594 Ga0070677_10012935
595 Ga0070677_10016424
596 Ga0070677_10020479
597 Ga0070677_10061680
598 Ga0070666_10000365
599 Ga0070666_10001819
600 Ga0070666_10010713
601 Ga0070682_100039532
602 Ga0068868_100041440
603 Ga0068868_100071340
604 Ga0068868_100156723
605 Ga0068868_100293491
606 Ga0070660_100001417
607 Ga0070660_100073142
608 Ga0070687_100278161
609 Ga0070661_100000125
610 Ga0070661_100007119
611 Ga0070661_100037652
612 Ga0070669_100019706
613 Ga0070669_100073712
614 Ga0070675_100001409
615 Ga0070675_100001589
616 Ga0070675_100065691
617 Ga0070675_100315909
618 Ga0070675_100326387
619 Ga0070675_100353503
620 Ga0070671_100002925
621 Ga0070671_100006582
622 Ga0070671_100009040
623 Ga0070671_100123073
624 Ga0070671_100143822
625 Ga0070671_100146041
626 Ga0070671_100158523
627 Ga0070671_100183251
628 Ga0070671_100183254
629 Ga0070671_100271652
630 Ga0070671_100427967
631 Ga0070674_100014681
632 Ga0070674_100099234
633 Ga0070674_100121109
634 Ga0070674_100201900
635 Ga0070674_100240572
636 Ga0070674_100241541
637 Ga0070674_100380425
638 Ga0070673_100000300
639 Ga0070673_100001334
640 Ga0070673_100003471
641 Ga0070673_100028847
642 Ga0070673_100081222
643 Ga0070673_100092868
644 Ga0070659_100051301
645 Ga0070659_100121840
646 Ga0070659_100192807
647 Ga0070659_100297011
648 Ga0070659_100339957
649 Ga0070667_100002894
650 Ga0070667_100003218
651 Ga0070667_100009246
652 Ga0070667_100016957
653 Ga0070667_100017216
654 Ga0070667_100038294
655 Ga0070667_100304621
656 Ga0070663_100000749
657 Ga0070663_100308313
658 Ga0070678_100014611
659 Ga0070678_100069650
660 Ga0070678_100225681
661 Ga0070678_100508455
662 Ga0070662_100000010
663 Ga0070662_100003663
664 Ga0070662_100004001
665 Ga0070662_100005803
666 Ga0070662_100021913
667 Ga0070662_100024117
668 Ga0070662_100031808
669 Ga0070662_100061813
670 Ga0070662_100089993
671 Ga0070662_100155850
672 Ga0070662_100222793
673 Ga0070662_100225097
674 Ga0070662_100363349
675 Ga0068867_100010098
676 Ga0068867_100012655
677 Ga0068867_100308877
678 Ga0068867_100590381
679 Ga0070685_10205018
680 Ga0070679_100067647
681 Ga0070684_100032798
682 Ga0070684_100130185
683 Ga0068853_100227723
684 Ga0070672_100001602
685 Ga0070672_100043868
686 Ga0070672_100066683
687 Ga0070672_100100483
688 Ga0070672_100268055
689 Ga0070686_100020605
690 Ga0070696_100161441
691 Ga0070693_100002007
692 Ga0070665_100006777
693 Ga0070665_100031815
694 Ga0070665_100092977
695 Ga0068855_100007260
696 Ga0070664_100002041
697 Ga0070664_100004556
698 Ga0070664_100021707
699 Ga0070664_100129627
700 Ga0070664_100268954
701 Ga0070664_100441270
702 Ga0068857_100464815
703 Ga0068854_100149037
704 Ga0068856_100000442
705 Ga0068856_100215407
706 Ga0068856_100475648
707 Ga0068856_100633663
708 Ga0068856_100668551
709 Ga0070702_100150224
710 Ga0068852_100000241
711 Ga0068852_100002928
712 Ga0068852_100026422
713 Ga0068852_100047770
714 Ga0068852_100149597
715 Ga0068852_100285605
716 Ga0068859_100050423
717 Ga0068859_100123289
718 Ga0068859_100554564
719 Ga0068864_100002110
720 Ga0068864_100020430
721 Ga0068864_100024886
722 Ga0068864_100032885
723 Ga0068864_100118156
724 Ga0068864_100122817
725 Ga0068866_10353500
726 Ga0068861_100384907
727 Ga0068851_10084441
728 Ga0068851_10291822
729 Ga0068870_10082883
730 Ga0068870_10298367
731 Ga0068863_100021441
732 Ga0068863_100062752
733 Ga0068863_100119418
734 Ga0068863_100351098
735 Ga0068863_100491381
736 Ga0068858_100000950
737 Ga0068858_100034078
738 Ga0068860_100056720
739 Ga0068860_100107734
740 Ga0068860_100115459
741 Ga0097621_100016446
742 Ga0097621_100034946
743 Ga0097621_100053265
744 Ga0097621_100227302
745 Ga0068871_100008629
746 Ga0068871_100059804
747 Ga0068871_100208327
748 Ga0068871_100348595
749 Ga0068865_100008543
750 Ga0097620_100050422
751 Ga0097620_100123284
752 Ga0097620_100554566
753 Ga0105240_10084998
754 Ga0111539_10288255
755 Ga0105245_10397267
756 Ga0105242_10106226
757 Ga0105248_10000334
758 Ga0105248_10021126
759 Ga0105248_10024377
760 Ga0105248_10031402
761 Ga0105248_10060033
762 Ga0105248_10063007
763 Ga0105248_10130116
764 Ga0105248_10241563
765 Ga0105248_10296280
766 Ga0105248_10401182
767 Ga0105248_10542109
768 Ga0105238_10004646
769 Ga0105238_10224900
770 Ga0105238_10455958
771 Ga0105238_10517659
772 Ga0105249_10043083
773 Ga0105249_10299443
774 Ga0105239_10101525
775 Ga0157373_10012884
776 Ga0157373_10059374
777 Ga0157373_10139683
778 Ga0157371_10000972
779 Ga0157371_10247618
780 Ga0157370_10435540
781 Ga0157369_10013845
782 Ga0157369_10100714
783 Ga0157369_10407500
784 Ga0157374_10005506
785 Ga0157374_10071963
786 Ga0157374_10090451
787 Ga0157374_10148201
788 Ga0157378_10064306
789 Ga0163162_10008188
790 Ga0163162_10041634
791 Ga0163162_10072304
792 Ga0163162_10182868
793 Ga0163162_10363501
794 Ga0163162_10521299
795 Ga0157375_10023540
796 Ga0157375_10038793
797 Ga0157375_10113562
798 Ga0163163_10000313
799 Ga0163163_10103574
800 Ga0163163_10534637
801 Ga0157380_10007665
802 Ga0157380_10342129
803 Ga0157379_10042873
804 Ga0157379_10343989
805 Ga0157376_10005451
806 Ga0163161_10036462
807 Ga0163161_10322036
808 Ga0163161_10357550
809 Ga0163161_10476849
810 Ga0207697_10001597
811 Ga0207697_10064473
812 Ga0207697_10145543
813 Ga0207697_10193030
814 Ga0207682_10003305
815 Ga0207682_10005479
816 Ga0207682_10008658
817 Ga0207682_10044937
818 Ga0207682_10149566
819 Ga0207682_10172608
820 Ga0207688_10012630
821 Ga0207680_10005624
822 Ga0207680_10008998
823 Ga0207680_10018472
824 Ga0207680_10048610
825 Ga0207680_10185176
826 Ga0207647_10100557
827 Ga0207645_10040776
828 Ga0207645_10231740
829 Ga0207645_10240618
830 Ga0207643_10181368
831 Ga0207705_10000232
832 Ga0207705_10007885
833 Ga0207705_10011437
834 Ga0207705_10025491
835 Ga0207705_10248393
836 Ga0207657_10000026
837 Ga0207657_10098931
838 Ga0207649_10000318
839 Ga0207649_10009880
840 Ga0207649_10039868
841 Ga0207649_10079380
842 Ga0207652_10195677
843 Ga0207681_10012667
844 Ga0207681_10067152
845 Ga0207681_10177947
846 Ga0207694_10020260
847 Ga0207694_10070831
848 Ga0207694_10265548
849 Ga0207650_10007919
850 Ga0207650_10011936
851 Ga0207650_10012230
852 Ga0207650_10032913
853 Ga0207650_10047116
854 Ga0207650_10048689
855 Ga0207650_10074420
856 Ga0207650_10171288
857 Ga0207650_10175953
858 Ga0207659_10004196
859 Ga0207659_10007823
860 Ga0207659_10017557
861 Ga0207659_10041643
862 Ga0207659_10048484
863 Ga0207687_10318041
864 Ga0207644_10000453
865 Ga0207644_10002648
866 Ga0207644_10023476
867 Ga0207644_10039948
868 Ga0207644_10046900
869 Ga0207644_10067571
870 Ga0207644_10139802
871 Ga0207644_10141531
872 Ga0207644_10159306
873 Ga0207644_10198140
874 Ga0207644_10393594
875 Ga0207690_10000748
876 Ga0207690_10058395
877 Ga0207690_10367532
878 Ga0207706_10000031
879 Ga0207706_10000891
880 Ga0207706_10001491
881 Ga0207706_10001496
882 Ga0207706_10006408
883 Ga0207706_10006885
884 Ga0207706_10011822
885 Ga0207706_10014166
886 Ga0207706_10033966
887 Ga0207706_10037194
888 Ga0207706_10038104
889 Ga0207706_10053720
890 Ga0207706_10060539
891 Ga0207669_10007557
892 Ga0207669_10025587
893 Ga0207669_10053418
894 Ga0207669_10073095
895 Ga0207669_10815917
896 Ga0207704_10126917
897 Ga0207704_10132652
898 Ga0207704_10137965
899 Ga0207704_10190152
900 Ga0207691_10002105
901 Ga0207691_10005491
902 Ga0207691_10015349
903 Ga0207691_10026329
904 Ga0207691_10028056
905 Ga0207691_10050646
906 Ga0207691_10072307
907 Ga0207691_10092969
908 Ga0207691_10128472
909 Ga0207711_10000689
910 Ga0207711_10002640
911 Ga0207711_10003270
912 Ga0207711_10009295
913 Ga0207711_10011496
914 Ga0207711_10013369
915 Ga0207711_10023669
916 Ga0207711_10088289
917 Ga0207711_10344876
918 Ga0207711_10353701
919 Ga0207661_10001521
920 Ga0207661_10054836
921 Ga0207679_10001421
922 Ga0207679_10007871
923 Ga0207679_10016684
924 Ga0207679_10058719
925 Ga0207679_10160746
926 Ga0207679_10471022
927 Ga0207667_10043270
928 Ga0207667_10374428
929 Ga0207651_10000590
930 Ga0207651_10002715
931 Ga0207651_10066145
932 Ga0207651_10160845
933 Ga0207668_10084462
934 Ga0207668_10175564
935 Ga0207668_10316809
936 Ga0207640_10003303
937 Ga0207658_10010558
938 Ga0207658_10032143
939 Ga0207658_10047705
940 Ga0207658_10190472
941 Ga0207658_10285477
942 Ga0207658_10300387
943 Ga0207658_10330674
944 Ga0207658_10629067
945 Ga0207677_10013600
946 Ga0207677_10085342
947 Ga0207677_10249645
948 Ga0207677_10273239
949 Ga0207703_10002789
950 Ga0207703_10017392
951 Ga0207639_10001610
952 Ga0207678_10006897
953 Ga0207678_10335245
954 Ga0207702_10000891
955 Ga0207702_10121585
956 Ga0207702_10413642
957 Ga0207641_10092531
958 Ga0207641_10103396
959 Ga0207641_10354932
960 Ga0207641_10758594
961 Ga0207648_10013235
962 Ga0207648_10050063
963 Ga0207648_10300162
964 Ga0207676_10001039
965 Ga0207676_10001128
966 Ga0207676_10003906
967 Ga0207676_10026827
968 Ga0207676_10037492
969 Ga0207676_10086922
970 Ga0207676_10103468
971 Ga0207676_10164075
972 Ga0207676_10609600
973 Ga0207676_10696090
974 Ga0207675_100054307
975 Ga0207675_100467170
976 Ga0207683_10003227
977 Ga0207683_10004016
978 Ga0207683_10006619
979 Ga0207683_10006799
980 Ga0207683_10019788
981 Ga0207683_10134835
982 Ga0207683_10418783
983 Ga0207698_10002067
984 Ga0207698_10020225
985 Ga0207698_10037621
986 Ga0207698_10058645
987 Ga0207698_10189860
988 Ga0268266_10011728
989 Ga0268266_10022196
990 Ga0268266_10039664
991 Ga0268266_10183319
992 Ga0268265_10526500
993 Ga0268264_10083683
994 Ga0268264_10236807
995 Ga0268264_10321923
996 Ga0307413_10086532
997 Ga0307413_10236230
998 Ga0307410_10014722
999 Ga0307410_10076155
1000 Ga0307410_10215357
1001 Ga0307406_10324984
1002 Ga0307407_10030406
1003 Ga0307409_100146556
1004 Ga0307409_100201702
1005 Ga0307416_100144690
1006 Ga0307416_100369530
1007 Ga0307414_10082046
1008 Ga0307414_10126252
1009 Ga0307414_10217378
1010 Ga0373929_0016778
1011 Ga0373951_0007328
1012 Ga0373942_0143932
1013 Ga0373962_0018818
1014 Ga0373931_0026279
1015 Ga0373931_0119759
1016 Ga0373935_0121817
1017 Ga0373947_0066199
1018 Ga0395899_0057960
1019 Ga0395900_0021919
1020 Ga0395898_0032922
1021 Ga0395898_0034679
1022 Ga0395898_0163626
1023 Ga0395898_0260151
1024 Ga0395905_0003103
1025 Ga0395905_0023086
1026 Ga0395905_0043111
1027 Ga0395905_0178054
1028 Ga0395901_0021139
1029 Ga0395901_0306533
1030 Ga0450907_012269
1031 Ga0495584_0164255
1032 Ga0495596_0025193
1033 Ga0495663_0000665
1034 Ga0495663_0026792
1035 Ga0495642_0025621
1036 Ga0495598_0015235
1037 Ga0495598_0045265
1038 Ga0495621_0000724
1039 Ga0495621_0024503
1040 Ga0495621_0034543
1041 Ga0495621_0039311
1042 Ga0495621_0067993
1043 Ga0495656_0109045
1044 Ga0495659_0008541
1045 Ga0495669_0000504
1046 Ga0495669_0002584
1047 Ga0495669_0022068
1048 Ga0495669_0034291
1049 Ga0495669_0074301
1050 Ga0495670_0039540
1051 Ga0495670_0042009
1052 Ga0495670_0051269
1053 Ga0495670_0076630
1054 Ga0495670_0131751
1055 Ga0495670_0214850
1056 Ga0495677_0001792
1057 Ga0495677_0007258
1058 Ga0495677_0069027
1059 Ga0496100_0018120
1060 Ga0496101_0035570
1061 Ga0496102_0234833
1062 Ga0496102_0345310
1063 Ga0496103_0045774
1064 Ga0496104_0070971
1065 Ga0496104_0595490
1066 Ga0496105_0040643
1067 Ga0496105_0143709
1068 Ga0496107_0007729
1069 Ga0496107_0022488
1070 Ga0496107_0280168
1071 Ga0496108_0004989
1072 Ga0496108_0009338
1073 Ga0496108_0064184
1074 Ga0496108_0226425
1075 Ga0496109_0040506
1076 Ga0496109_0233582
1077 Ga0496109_0316113
1078 Ga0496109_0333963
1079 Ga0496109_0638954
1080 Ga0496109_0952849
1081 Ga0496110_0004034
1082 Ga0496110_0014480
1083 Ga0496110_0024645
1084 Ga0496110_0039208
1085 Ga0496110_0060684
1086 Ga0496111_0010033
1087 Ga0496111_0018350
1088 Ga0496111_0095697
1089 Ga0496111_0327415
1090 Ga0496112_0002602
1091 Ga0496112_0010652
1092 Ga0496112_0073475
1093 Ga0496112_0085429
1094 Ga0496112_0387860
1095 Ga0496113_0000711
1096 Ga0496113_0004944
1097 Ga0496113_0020496
1098 Ga0496113_0122410
1099 Ga0496114_0020040
1100 Ga0496114_0042353
1101 Ga0496114_0144946
1102 Ga0496115_0085153
1103 Ga0501074_0161928
1104 Ga0501268_010416

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF09865

DUF2092

Predicted periplasmic protein (DUF2092)

75

286

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
4mxt-assembly1.cif.gz_A-2 crystal structure of an outer-membrane lipoprotein carrier protein (bacuni_04723) from bacteroides uniformis atcc 8492 at 1.40 a resolution 0.7656 20 228
8esf-assembly2.cif.gz_B crystal structure of human nischarin px and lrr domains with engineered mutations 0.7519 146 180
8esf-assembly1.cif.gz_A crystal structure of human nischarin px and lrr domains with engineered mutations 0.7499 147 177
4mxt-assembly1.cif.gz_A-2 crystal structure of an outer-membrane lipoprotein carrier protein (bacuni_04723) from bacteroides uniformis atcc 8492 at 1.40 a resolution 0.7365 20 228
2yzy-assembly1.cif.gz_A crystal structure of uncharacterized conserved protein from thermus thermophilus hb8 0.6902 18 228
ID Description Score Start End Superfamily
af_Q55A08_605_716_3.30.1520.10 Alpha Beta;2-Layer Sandwich;PX Domain;Phox-like domain 0.7703 146 177 3.30.1520.10
4mxtA00 Mainly Beta;Clam;outer membrane lipoprotein receptor (LolB), chain A;Lipoprotein localisation LolA/LolB/LppX 0.7581 20 228 2.50.20.10
4mxtA00 Mainly Beta;Clam;outer membrane lipoprotein receptor (LolB), chain A;Lipoprotein localisation LolA/LolB/LppX 0.7328 20 228 2.50.20.10
af_Q58100_22_207_2.50.20.10 Mainly Beta;Clam;outer membrane lipoprotein receptor (LolB), chain A;Lipoprotein localisation LolA/LolB/LppX 0.7291 20 228 2.50.20.10
af_Q4DW43_4_102_3.30.1520.10 Alpha Beta;2-Layer Sandwich;PX Domain;Phox-like domain 0.7144 147 177 3.30.1520.10
ID Description Score Start End GO Terms
AF-A0A1G0NAA4-F1-model_v4 DUF2092 domain-containing protein 0.9087 15 228
AF-A0A1I4SH43-F1-model_v4 DUF2092 domain-containing protein 0.9079 27 228
AF-A0A3D8VEB2-F1-model_v4 DUF2092 domain-containing protein 0.9069 5 228 GO:0015031
AF-A0A432FU07-F1-model_v4 DUF2092 domain-containing protein 0.9057 18 228 GO:0015031
AF-A0A1B2EPY2-F1-model_v4 DUF2092 domain-containing protein 0.9027 17 228

Map