F462688

General Info

Members Datasets Scaffolds Average Seq Length
552 268 1104 136

Family's Representative Sequence

Representative Sequence 3300005330|Ga0070690_101096980|Ga0070690_1010969802
Length 119
Sequence MRVQDGMSSIVLTVGPNHTLREAARLMSARKVGAAVVLDPESPGPGILTERDVLRSLAECEHPGDELVSASPDWSLEQAAEAMIEHGFRHLLVVDGGELVGILSMRDIVRCWAVDRVAS

Samples

Sample ID Description Type Environment
1 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
2 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
9 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
10 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
11 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
12 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
13 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
14 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
15 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
16 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
17 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
18 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
19 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
20 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
21 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
22 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
23 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
24 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
25 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
26 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
27 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
28 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
29 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
30 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
31 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
32 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
33 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
34 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
35 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
36 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
37 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
38 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
39 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
40 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
41 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
42 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
43 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
44 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
45 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
46 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
47 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
48 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
49 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
50 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
51 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
52 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
53 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
54 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
55 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
56 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
57 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
58 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
59 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
60 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
61 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
62 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
63 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
64 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
65 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
66 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
67 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
68 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
69 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
70 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
71 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
72 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
73 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
74 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
75 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
76 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
77 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
78 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
79 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
80 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
81 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
82 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
83 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
84 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
85 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
86 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
87 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
88 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
126 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
127 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
128 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
129 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
130 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
131 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
132 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
133 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
134 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
135 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
136 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
137 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
138 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
139 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
140 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
141 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
142 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
143 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
144 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
145 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
146 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
147 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
148 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
149 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
150 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
151 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
152 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
153 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
154 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
155 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
156 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
157 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
158 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
159 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
160 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
161 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
162 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
163 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
164 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
165 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
166 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
167 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
168 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
169 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
170 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
171 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
172 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
173 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
174 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
175 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
176 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
177 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
178 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
179 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
180 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
181 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
182 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
183 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
184 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
185 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
186 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
187 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
188 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
189 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
190 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
191 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
192 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
193 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
194 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
195 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
196 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
197 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
198 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
199 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
200 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
201 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
202 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
203 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
204 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
205 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
206 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
207 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
208 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
209 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
210 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
211 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
212 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
213 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
214 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
215 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
216 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
217 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
218 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
219 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
220 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
221 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
222 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
223 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
224 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
225 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
226 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
227 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
228 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
229 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
230 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
231 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
232 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
233 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
234 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
235 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
236 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
237 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
238 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
239 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
240 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
241 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
242 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
243 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
244 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
245 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
246 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
247 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
248 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
249 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
250 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
251 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
252 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
253 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
254 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
255 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
256 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
257 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
258 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
259 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
260 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
261 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
262 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
263 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
264 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
265 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
266 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
267 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
268 8056447290 Streptomyces huiliensis SCA2-4 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.01
Metatranscriptomes 1.81
Isolates 0.18

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.25
Nodule 0
Rhizoplane 8.7
Rhizosphere 84.42
Stem 0
Stem Tuber 0
Unclassified 14.49

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070690_101096980 3300005330 Unclassified 631
2 Ga0058862_12777495 3300004803 Bacteria 888
3 Ga0070658_10124721 3300005327 Bacteria 2143
4 Ga0070683_100197133 3300005329 Bacteria 1912
5 Ga0070690_100628517 3300005330 Bacteria 818
6 Ga0068869_101010707 3300005334 Bacteria 724
7 Ga0070682_100115284 3300005337 Bacteria 1796
8 Ga0070682_100147536 3300005337 Bacteria 1610
9 Ga0070682_100237695 3300005337 Bacteria 1306
10 Ga0068868_100027502 3300005338 Bacteria 4340
11 Ga0068868_101799002 3300005338 Bacteria 579
12 Ga0070660_100069021 3300005339 Bacteria 2755
13 Ga0070691_10084549 3300005341 Bacteria 1558
14 Ga0070675_100315467 3300005354 Bacteria 1380
15 Ga0070671_100819939 3300005355 Bacteria 811
16 Ga0070671_101160743 3300005355 Unclassified 679
17 Ga0070688_100165165 3300005365 Bacteria 1524
18 Ga0070659_100004418 3300005366 Bacteria 10040
19 Ga0070709_10096047 3300005434 Bacteria 1964
20 Ga0070714_100295534 3300005435 Bacteria 1508
21 Ga0070714_100343097 3300005435 Bacteria 1401
22 Ga0070714_100627461 3300005435 Bacteria 1033
23 Ga0070714_100651846 3300005435 Bacteria 1014
24 Ga0070714_101253997 3300005435 Bacteria 723
25 Ga0070713_100143863 3300005436 Bacteria 2115
26 Ga0070713_100306907 3300005436 Unclassified 1462
27 Ga0070713_100572265 3300005436 Bacteria 1071
28 Ga0070713_101468648 3300005436 Bacteria 661
29 Ga0070710_10094288 3300005437 Bacteria 1771
30 Ga0070710_10298616 3300005437 Bacteria 1050
31 Ga0070710_10331896 3300005437 Bacteria 1001
32 Ga0070701_10167176 3300005438 Bacteria 1278
33 Ga0070711_100007211 3300005439 Bacteria 6752
34 Ga0070711_100062770 3300005439 Bacteria 2591
35 Ga0070711_100102498 3300005439 Bacteria 2084
36 Ga0070705_100134320 3300005440 Bacteria 1619
37 Ga0070705_101421679 3300005440 Bacteria 579
38 Ga0070694_100122897 3300005444 Unclassified 1865
39 Ga0070694_100360449 3300005444 Unclassified 1129
40 Ga0070663_100150699 3300005455 Bacteria 1783
41 Ga0070663_101297331 3300005455 Bacteria 642
42 Ga0070663_101511814 3300005455 Bacteria 597
43 Ga0070678_100015680 3300005456 Bacteria 4824
44 Ga0070681_10204088 3300005458 Bacteria 1894
45 Ga0070707_100003271 3300005468 Bacteria 15345
46 Ga0070707_100372092 3300005468 Bacteria 1388
47 Ga0070707_101090619 3300005468 Bacteria 764
48 Ga0070699_100359139 3300005518 Bacteria 1313
49 Ga0070679_100040864 3300005530 Bacteria 4615
50 Ga0070684_100008541 3300005535 Bacteria 8016
51 Ga0068853_101514780 3300005539 Bacteria 649
52 Ga0068853_101823740 3300005539 Bacteria 590
53 Ga0070672_101154111 3300005543 Bacteria 689
54 Ga0070686_100451681 3300005544 Bacteria 988
55 Ga0070695_100185202 3300005545 Unclassified 1478
56 Ga0070696_100329145 3300005546 Bacteria 1178
57 Ga0070696_100511678 3300005546 Unclassified 957
58 Ga0070704_100011433 3300005549 Bacteria 5441
59 Ga0070704_100857996 3300005549 Bacteria 814
60 Ga0070704_100891353 3300005549 Unclassified 800
61 Ga0070704_101648248 3300005549 Bacteria 592
62 Ga0070664_100262886 3300005564 Bacteria 1553
63 Ga0068857_100277650 3300005577 Bacteria 1540
64 Ga0068856_100008876 3300005614 Bacteria 9780
65 Ga0068856_100049247 3300005614 Bacteria 4152
66 Ga0068856_100073565 3300005614 Bacteria 3383
67 Ga0070702_100182223 3300005615 Bacteria 1375
68 Ga0068852_100018872 3300005616 Bacteria 5444
69 Ga0068859_101359355 3300005617 Bacteria 783
70 Ga0068863_100048749 3300005841 Bacteria 4016
71 Ga0068858_100000046 3300005842 Bacteria 127519
72 Ga0068858_100458607 3300005842 Bacteria 1229
73 Ga0068862_101413397 3300005844 Bacteria 699
74 Ga0081455_10056790 3300005937 Bacteria 3321
75 Ga0081455_10282388 3300005937 Bacteria 1199
76 Ga0081538_10000690 3300005981 Bacteria 37077
77 Ga0081538_10009481 3300005981 Bacteria 8122
78 Ga0081538_10026534 3300005981 Bacteria 4048
79 Ga0070717_10169806 3300006028 Bacteria 1896
80 Ga0070717_10443364 3300006028 Bacteria 1169
81 Ga0070717_10805669 3300006028 Bacteria 854
82 Ga0075365_10000128 3300006038 Bacteria 23114
83 Ga0075365_10001848 3300006038 Bacteria 9932
84 Ga0075365_10047246 3300006038 Bacteria 2829
85 Ga0075365_10440790 3300006038 Bacteria 920
86 Ga0075365_10496200 3300006038 Bacteria 863
87 Ga0075365_11064546 3300006038 Bacteria 570
88 Ga0075363_100057529 3300006048 Unclassified 2087
89 Ga0075363_100155360 3300006048 Archaea 1293
90 Ga0075364_10039754 3300006051 Bacteria 3050
91 Ga0075364_10231283 3300006051 Bacteria 1255
92 Ga0075364_10268462 3300006051 Bacteria 1160
93 Ga0075364_10395003 3300006051 Bacteria 943
94 Ga0075364_11007575 3300006051 Bacteria 566
95 Ga0070715_10298665 3300006163 Bacteria 861
96 Ga0070716_100067422 3300006173 Bacteria 2090
97 Ga0070712_100001384 3300006175 Bacteria 14716
98 Ga0070712_100056040 3300006175 Bacteria 2763
99 Ga0070712_100070145 3300006175 Bacteria 2502
100 Ga0075367_10143918 3300006178 Bacteria 1477
101 Ga0075428_100027561 3300006844 Bacteria 6285
102 Ga0075430_100054606 3300006846 Bacteria 3361
103 Ga0075430_101287302 3300006846 Unclassified 601
104 Ga0075431_100003746 3300006847 Bacteria 14770
105 Ga0075431_100069572 3300006847 Bacteria 3631
106 Ga0075431_100492843 3300006847 Bacteria 1217
107 Ga0075433_10020200 3300006852 Bacteria 5565
108 Ga0075434_100001338 3300006871 Bacteria 20649
109 Ga0075434_100016614 3300006871 Bacteria 7078
110 Ga0075434_100067971 3300006871 Bacteria 3549
111 Ga0068865_100069444 3300006881 Bacteria 2493
112 Ga0068865_100428555 3300006881 Bacteria 1089
113 Ga0068865_100922268 3300006881 Bacteria 761
114 Ga0075436_100673960 3300006914 Unclassified 765
115 Ga0097620_101359280 3300006931 Bacteria 783
116 Ga0075435_100548013 3300007076 Bacteria 1001
117 Ga0099794_10303344 3300007265 Bacteria 827
118 Ga0105240_10201427 3300009093 Bacteria 2332
119 Ga0111539_10002884 3300009094 Bacteria 22831
120 Ga0105245_10018317 3300009098 Bacteria 6122
121 Ga0105245_10349280 3300009098 Bacteria 1465
122 Ga0105245_11240784 3300009098 Bacteria 794
123 Ga0105245_11678772 3300009098 Bacteria 687
124 Ga0105245_12253569 3300009098 Unclassified 598
125 Ga0105245_12446492 3300009098 Bacteria 576
126 Ga0114129_10078816 3300009147 Bacteria 4581
127 Ga0114129_10181463 3300009147 Bacteria 2863
128 Ga0114129_10581613 3300009147 Unclassified 1453
129 Ga0114129_11183836 3300009147 Bacteria 953
130 Ga0114129_11313390 3300009147 Bacteria 896
131 Ga0105243_10149682 3300009148 Bacteria 2001
132 Ga0105242_10283843 3300009176 Bacteria 1505
133 Ga0105237_10116351 3300009545 Bacteria 2667
134 Ga0105238_10104340 3300009551 Bacteria 2816
135 Ga0105238_10885793 3300009551 Bacteria 911
136 Ga0105249_10100675 3300009553 Bacteria 2717
137 Ga0105239_10130926 3300010375 Bacteria 2790
138 Ga0105239_10589881 3300010375 Bacteria 1267
139 Ga0157371_10077563 3300013102 Bacteria 2352
140 Ga0157370_10050275 3300013104 Bacteria 3985
141 Ga0157370_10126005 3300013104 Bacteria 2390
142 Ga0157372_10025959 3300013307 Bacteria 6372
143 Ga0157372_10589258 3300013307 Bacteria 1296
144 Ga0157372_11335380 3300013307 Bacteria 827
145 Ga0157375_10035152 3300013308 Bacteria 4780
146 Ga0163163_12330925 3300014325 Bacteria 594
147 Ga0157379_10707052 3300014968 Bacteria 946
148 Ga0157376_10078125 3300014969 Bacteria 2833
149 Ga0157376_10506528 3300014969 Bacteria 1187
150 Ga0197907_11420944 3300020069 Bacteria 531
151 Ga0206356_11253831 3300020070 Bacteria 1211
152 Ga0206355_1449106 3300020076 Bacteria 1105
153 Ga0206350_11048019 3300020080 Bacteria 620
154 Ga0206353_10004111 3300020082 Bacteria 1005
155 Ga0206353_10697506 3300020082 Bacteria 546
156 Ga0213875_10124255 3300021388 Unclassified 1206
157 Ga0224712_10324007 3300022467 Bacteria 724
158 Ga0224712_10538207 3300022467 Bacteria 567
159 Ga0224712_10547489 3300022467 Bacteria 562
160 Ga0207692_10048801 3300025898 Bacteria 2133
161 Ga0207692_10087507 3300025898 Bacteria 1681
162 Ga0207688_10047010 3300025901 Bacteria 2410
163 Ga0207685_10233205 3300025905 Bacteria 882
164 Ga0207699_10004441 3300025906 Bacteria 6708
165 Ga0207699_10092368 3300025906 Unclassified 1902
166 Ga0207699_10460713 3300025906 Bacteria 913
167 Ga0207684_10032127 3300025910 Bacteria 4464
168 Ga0207707_10005672 3300025912 Bacteria 10924
169 Ga0207671_10249034 3300025914 Bacteria 1397
170 Ga0207693_10010727 3300025915 Bacteria 7437
171 Ga0207693_10030361 3300025915 Bacteria 4268
172 Ga0207663_10024584 3300025916 Bacteria 3470
173 Ga0207663_10117848 3300025916 Bacteria 1813
174 Ga0207660_10172860 3300025917 Bacteria 1673
175 Ga0207657_10086169 3300025919 Bacteria 2630
176 Ga0207652_10011637 3300025921 Bacteria 7098
177 Ga0207646_10000652 3300025922 Bacteria 44795
178 Ga0207646_10625070 3300025922 Bacteria 966
179 Ga0207694_10188508 3300025924 Bacteria 1675
180 Ga0207659_10616713 3300025926 Bacteria 925
181 Ga0207687_10115837 3300025927 Bacteria 1997
182 Ga0207687_10182820 3300025927 Bacteria 1625
183 Ga0207700_10005604 3300025928 Bacteria 7536
184 Ga0207700_10040328 3300025928 Bacteria 3407
185 Ga0207700_10055336 3300025928 Bacteria 2982
186 Ga0207700_10116267 3300025928 Bacteria 2161
187 Ga0207664_10116165 3300025929 Bacteria 2232
188 Ga0207664_10720940 3300025929 Bacteria 897
189 Ga0207664_11092470 3300025929 Bacteria 713
190 Ga0207664_11929786 3300025929 Bacteria 513
191 Ga0207644_10485594 3300025931 Bacteria 1018
192 Ga0207709_10855059 3300025935 Bacteria 737
193 Ga0207704_10051301 3300025938 Bacteria 2494
194 Ga0207665_10062619 3300025939 Bacteria 2525
195 Ga0207665_10790634 3300025939 Bacteria 749
196 Ga0207679_10346982 3300025945 Bacteria 1293
197 Ga0207712_10200923 3300025961 Bacteria 1581
198 Ga0207712_11780244 3300025961 Unclassified 552
199 Ga0207640_10038140 3300025981 Bacteria 3030
200 Ga0207658_11033293 3300025986 Bacteria 750
201 Ga0207677_10019097 3300026023 Bacteria 4131
202 Ga0207703_10000042 3300026035 Bacteria 161459
203 Ga0207703_10769243 3300026035 Bacteria 918
204 Ga0207639_11486632 3300026041 Bacteria 636
205 Ga0207678_10118785 3300026067 Bacteria 2256
206 Ga0207678_10674669 3300026067 Bacteria 909
207 Ga0207702_10032834 3300026078 Bacteria 4333
208 Ga0207702_10046999 3300026078 Bacteria 3635
209 Ga0207702_10142547 3300026078 Bacteria 2170
210 Ga0207641_10574247 3300026088 Bacteria 1102
211 Ga0207676_10615465 3300026095 Bacteria 1045
212 Ga0207674_10162097 3300026116 Bacteria 2190
213 Ga0207683_10029507 3300026121 Bacteria 4750
214 Ga0207683_10080282 3300026121 Bacteria 2893
215 Ga0207698_10005648 3300026142 Bacteria 7744
216 Ga0209588_1236579 3300027671 Bacteria 561
217 Ga0207428_10042902 3300027907 Bacteria 3657
218 Ga0307409_101886279 3300031995 Unclassified 627
219 Ga0307415_100167041 3300032126 Bacteria 1712
220 Ga0373930_0018662 3300034816 Bacteria 1336
221 Ga0373958_0114857 3300034819 Bacteria 645
222 Ga0373928_0107176 3300035084 Bacteria 735
223 Ga0373949_0010795 3300035090 Bacteria 2006
224 Ga0373932_0242055 3300035112 Bacteria 655
225 Ga0373936_0007172 3300035113 Bacteria 4196
226 Ga0373939_0332874 3300035114 Bacteria 613
227 Ga0373941_0073103 3300035115 Bacteria 1142
228 Ga0373953_0020310 3300035117 Bacteria 2481
229 Ga0373953_0058876 3300035117 Bacteria 1567
230 Ga0373953_0097877 3300035117 Bacteria 1232
231 Ga0373954_0026055 3300035118 Bacteria 2677
232 Ga0373954_0150529 3300035118 Bacteria 1137
233 Ga0373956_0042993 3300035119 Bacteria 2010
234 Ga0373957_0005301 3300035120 Bacteria 3990
235 Ga0373957_0037057 3300035120 Bacteria 1820
236 Ga0373946_0298634 3300035171 Bacteria 796
237 Ga0373955_0043170 3300035172 Bacteria 2425
238 Ga0373955_0132183 3300035172 Bacteria 1457
239 Ga0373961_0231428 3300035241 Bacteria 662
240 Ga0373962_0086033 3300035242 Bacteria 961
241 Ga0373924_0068536 3300035410 Bacteria 1493
242 Ga0373924_0103818 3300035410 Bacteria 1224
243 Ga0373931_0187153 3300035691 Bacteria 1229
244 Ga0373931_0606751 3300035691 Bacteria 716
245 Ga0373935_0017223 3300035692 Bacteria 4380
246 Ga0373935_1157116 3300035692 Bacteria 576
247 Ga0373933_0004437 3300035724 Bacteria 7701
248 Ga0373933_0011260 3300035724 Bacteria 4924
249 Ga0373937_0027938 3300036401 Bacteria 5103
250 Ga0373937_0370194 3300036401 Unclassified 1358
251 Ga0373937_0452324 3300036401 Bacteria 1219
252 Ga0316582_0048250 3300036647 Bacteria 2692
253 Ga0316584_0313279 3300036712 Bacteria 1134
254 Ga0373925_0056606 3300037068 Bacteria 2937
255 Ga0395899_0074698 3300037312 Bacteria 2476
256 Ga0395900_0008759 3300037418 Bacteria 10394
257 Ga0395900_0188523 3300037418 Archaea 2093
258 Ga0395900_0264100 3300037418 Bacteria 1718
259 Ga0395898_0002615 3300037466 Bacteria 20964
260 Ga0395898_0076711 3300037466 Archaea 3227
261 Ga0395898_1065560 3300037466 Unclassified 743
262 Ga0395905_0158297 3300037471 Unclassified 2129
263 Ga0395905_0347596 3300037471 Bacteria 1375
264 Ga0395905_1251706 3300037471 Bacteria 646
265 Ga0436364_0412787 3300037853 Bacteria 9323
266 Ga0436364_0768656 3300037853 Bacteria 2774
267 Ga0436364_1400270 3300037853 Bacteria 1507
268 Ga0395901_0008822 3300038443 Bacteria 10204
269 Ga0395901_0016213 3300038443 Bacteria 7590
270 Ga0395901_0203125 3300038443 Unclassified 2077
271 Ga0395901_0395781 3300038443 Bacteria 1420
272 Ga0436365_0876033 3300039437 Bacteria 4762
273 Ga0436365_1475849 3300039437 Unclassified 582
274 Ga0436363_0269141 3300039450 Bacteria 1605
275 Ga0436363_0537393 3300039450 Bacteria 944
276 Ga0436362_0240820 3300039453 Bacteria 849
277 Ga0436362_0323744 3300039453 Bacteria 2004
278 Ga0451853_3325620 3300041512 Unclassified 1327
279 Ga0466966_0822342 3300044684 Unclassified 560
280 Ga0466961_0570727 3300044693 Bacteria 681
281 Ga0466963_0394769 3300044694 Bacteria 975
282 Ga0466963_1155197 3300044694 Bacteria 544
283 Ga0466964_0226067 3300044706 Bacteria 911
284 Ga0466971_0339858 3300044719 Unclassified 725
285 Ga0466968_0014770 3300044735 Bacteria 3090
286 Ga0466968_0115319 3300044735 Bacteria 1211
287 Ga0466968_0482469 3300044735 Bacteria 616
288 Ga0466968_0592715 3300044735 Bacteria 559
289 Ga0466970_0541286 3300044765 Bacteria 672
290 Ga0466957_0123712 3300044842 Bacteria 1651
291 Ga0466957_0144805 3300044842 Unclassified 1533
292 Ga0466957_0405129 3300044842 Bacteria 933
293 Ga0466960_0190020 3300044901 Unclassified 1117
294 Ga0466959_0008290 3300045049 Bacteria 7340
295 Ga0466959_0167778 3300045049 Bacteria 1541
296 Ga0466959_0171802 3300045049 Bacteria 1520
297 Ga0466959_0354702 3300045049 Unclassified 1000
298 Ga0466959_0709051 3300045049 Unclassified 674
299 Ga0466959_1019038 3300045049 Unclassified 551
300 Ga0466958_0159391 3300045836 Bacteria 1425
301 Ga0466958_0227305 3300045836 Unclassified 1191
302 Ga0466958_0280823 3300045836 Bacteria 1067
303 Ga0466958_0348078 3300045836 Bacteria 954
304 Ga0466958_0818028 3300045836 Unclassified 607
305 Ga0466967_0087716 3300045976 Bacteria 2822
306 Ga0466967_0147327 3300045976 Unclassified 2197
307 Ga0466967_0687228 3300045976 Unclassified 1013
308 Ga0495592_0188871 3300046454 Bacteria 1397
309 Ga0495592_0207113 3300046454 Bacteria 1319
310 Ga0495592_0286616 3300046454 Bacteria 1075
311 Ga0495592_0595968 3300046454 Bacteria 674
312 Ga0495603_0099533 3300046455 Bacteria 1698
313 Ga0495629_0003669 3300046459 Bacteria 11601
314 Ga0495629_0184121 3300046459 Bacteria 1447
315 Ga0495629_0233103 3300046459 Bacteria 1269
316 Ga0495641_0036475 3300046461 Bacteria 2310
317 Ga0495641_0533257 3300046461 Bacteria 536
318 Ga0495651_0043758 3300046462 Bacteria 3472
319 Ga0495651_0062558 3300046462 Bacteria 2847
320 Ga0495651_0184174 3300046462 Bacteria 1475
321 Ga0495653_0108979 3300046463 Bacteria 1993
322 Ga0495653_0148529 3300046463 Unclassified 1640
323 Ga0495653_0152723 3300046463 Bacteria 1611
324 Ga0495653_0340892 3300046463 Bacteria 966
325 Ga0495582_0006221 3300046473 Bacteria 6648
326 Ga0495639_0011797 3300046475 Bacteria 3769
327 Ga0495662_0007675 3300046476 Bacteria 5317
328 Ga0495664_0003420 3300046477 Bacteria 8628
329 Ga0495664_0048207 3300046477 Bacteria 2529
330 Ga0495608_0058606 3300046511 Bacteria 2538
331 Ga0495608_0089177 3300046511 Bacteria 1996
332 Ga0495618_0013261 3300046514 Bacteria 5015
333 Ga0495618_0114856 3300046514 Bacteria 1724
334 Ga0495618_0252611 3300046514 Bacteria 1106
335 Ga0495628_0170375 3300046516 Unclassified 1651
336 Ga0495628_0181470 3300046516 Bacteria 1592
337 Ga0495628_0183075 3300046516 Bacteria 1584
338 Ga0495628_0195539 3300046516 Bacteria 1526
339 Ga0495628_0494256 3300046516 Bacteria 884
340 Ga0495628_0516214 3300046516 Bacteria 861
341 Ga0495628_0862874 3300046516 Bacteria 630
342 Ga0495630_0202398 3300046517 Bacteria 1515
343 Ga0495630_0386469 3300046517 Bacteria 1072
344 Ga0495652_0093398 3300046529 Bacteria 2456
345 Ga0495652_0398644 3300046529 Unclassified 975
346 Ga0495652_0826091 3300046529 Unclassified 615
347 Ga0495640_0009144 3300046533 Bacteria 7734
348 Ga0495640_0165254 3300046533 Unclassified 1416
349 Ga0495640_0374893 3300046533 Unclassified 876
350 Ga0495586_0007353 3300046535 Bacteria 5877
351 Ga0495587_0039223 3300046536 Bacteria 2836
352 Ga0495587_0049789 3300046536 Bacteria 2479
353 Ga0495587_0100746 3300046536 Bacteria 1664
354 Ga0495587_0188649 3300046536 Bacteria 1168
355 Ga0495645_0022271 3300046543 Bacteria 4583
356 Ga0495645_0027804 3300046543 Bacteria 4109
357 Ga0495645_0186789 3300046543 Bacteria 1416
358 Ga0495645_0429019 3300046543 Unclassified 837
359 Ga0495667_0016826 3300046559 Bacteria 4937
360 Ga0495667_0154581 3300046559 Bacteria 1476
361 Ga0495668_0523729 3300046616 Unclassified 654
362 Ga0495668_0743462 3300046616 Bacteria 543
363 Ga0495634_0013575 3300046642 Bacteria 5883
364 Ga0495634_0562938 3300046642 Bacteria 664
365 Ga0495635_0155147 3300046663 Bacteria 1558
366 Ga0495635_0252739 3300046663 Unclassified 1188
367 Ga0495635_0299225 3300046663 Unclassified 1079
368 Ga0495635_0315123 3300046663 Bacteria 1047
369 Ga0495635_0602513 3300046663 Bacteria 717
370 Ga0495657_0016719 3300046675 Bacteria 5338
371 Ga0495657_0027201 3300046675 Bacteria 4039
372 Ga0495623_0046800 3300046679 Bacteria 2745
373 Ga0495623_0064824 3300046679 Bacteria 2285
374 Ga0495646_0107415 3300046680 Unclassified 1592
375 Ga0495646_0469454 3300046680 Bacteria 648
376 Ga0495647_0429234 3300046681 Unclassified 610
377 Ga0495658_0012712 3300046683 Bacteria 4272
378 Ga0495613_0064749 3300046689 Bacteria 2673
379 Ga0495613_0128145 3300046689 Bacteria 1818
380 Ga0495613_0915024 3300046689 Unclassified 567
381 Ga0495600_0003363 3300046809 Bacteria 9407
382 Ga0495600_0065759 3300046809 Bacteria 2371
383 Ga0495600_0389033 3300046809 Bacteria 869
384 Ga0495581_0011657 3300047315 Bacteria 5086
385 Ga0495581_0088024 3300047315 Unclassified 1801
386 Ga0495581_0917033 3300047315 Unclassified 500
387 Ga0495604_0175884 3300047317 Bacteria 1501
388 Ga0495604_0204292 3300047317 Bacteria 1368
389 Ga0495604_0324933 3300047317 Bacteria 1027
390 Ga0495604_0521155 3300047317 Bacteria 769
391 Ga0495674_0076977 3300047319 Bacteria 2869
392 Ga0495674_0158116 3300047319 Bacteria 1897
393 Ga0495674_0551350 3300047319 Bacteria 917
394 Ga0495672_0038175 3300047320 Bacteria 2932
395 Ga0495676_0136052 3300047321 Unclassified 1767
396 Ga0495680_0019244 3300047322 Bacteria 5772
397 Ga0495680_0029266 3300047322 Bacteria 4510
398 Ga0495680_0071235 3300047322 Bacteria 2647
399 Ga0495680_0146841 3300047322 Unclassified 1722
400 Ga0495675_0024628 3300047444 Bacteria 3838
401 Ga0495675_0058336 3300047444 Bacteria 2447
402 Ga0495675_0131845 3300047444 Unclassified 1553
403 Ga0495684_0093707 3300047471 Bacteria 2274
404 Ga0495684_0123317 3300047471 Bacteria 1950
405 Ga0495684_0402142 3300047471 Bacteria 961
406 Ga0495684_0478374 3300047471 Bacteria 860
407 Ga0495686_0030298 3300047472 Bacteria 3514
408 Ga0495593_0001218 3300047673 Bacteria 15044
409 Ga0495593_0476172 3300047673 Bacteria 625
410 Ga0495602_0060601 3300048088 Bacteria 3296
411 Ga0495602_0167708 3300048088 Bacteria 1707
412 Ga0495602_0284868 3300048088 Bacteria 1215
413 Ga0495602_0353172 3300048088 Bacteria 1060
414 Ga0495614_0032502 3300048089 Bacteria 2246
415 Ga0495614_0110841 3300048089 Bacteria 1205
416 Ga0496100_0023737 3300048903 Bacteria 3731
417 Ga0496100_0114740 3300048903 Bacteria 1877
418 Ga0496101_0043376 3300048904 Bacteria 3215
419 Ga0496101_0303281 3300048904 Bacteria 1251
420 Ga0496101_0386864 3300048904 Bacteria 1101
421 Ga0496102_0017585 3300048905 Bacteria 6264
422 Ga0496102_0177900 3300048905 Unclassified 2004
423 Ga0496102_0437109 3300048905 Unclassified 1228
424 Ga0496102_0671468 3300048905 Bacteria 959
425 Ga0496103_0004699 3300048906 Bacteria 8266
426 Ga0496104_0001843 3300048907 Bacteria 18340
427 Ga0496104_0112682 3300048907 Bacteria 2608
428 Ga0496104_0134571 3300048907 Bacteria 2374
429 Ga0496104_0575722 3300048907 Bacteria 1036
430 Ga0496105_0008094 3300048908 Bacteria 8174
431 Ga0496105_0016454 3300048908 Bacteria 5906
432 Ga0496105_0043142 3300048908 Bacteria 3720
433 Ga0496106_0002691 3300048909 Bacteria 13197
434 Ga0496106_0102366 3300048909 Bacteria 2222
435 Ga0496106_0879442 3300048909 Bacteria 708
436 Ga0496107_0011873 3300048910 Bacteria 6086
437 Ga0496107_0177942 3300048910 Unclassified 1579
438 Ga0496107_0864132 3300048910 Unclassified 660
439 Ga0496108_0001876 3300048911 Bacteria 16829
440 Ga0496108_0067118 3300048911 Bacteria 3025
441 Ga0496108_0190107 3300048911 Bacteria 1779
442 Ga0496108_0543119 3300048911 Unclassified 1014
443 Ga0496109_0000378 3300048912 Bacteria 40469
444 Ga0496109_0018949 3300048912 Bacteria 6059
445 Ga0496109_0031639 3300048912 Bacteria 4751
446 Ga0496110_0016107 3300048913 Bacteria 6234
447 Ga0496110_0021583 3300048913 Bacteria 5456
448 Ga0496111_0009378 3300048914 Bacteria 6527
449 Ga0496111_1153590 3300048914 Bacteria 551
450 Ga0496112_0039571 3300048915 Bacteria 4608
451 Ga0496112_0043165 3300048915 Bacteria 4414
452 Ga0496112_0653251 3300048915 Bacteria 981
453 Ga0496112_1214771 3300048915 Bacteria 670
454 Ga0496113_0026767 3300048916 Bacteria 4127
455 Ga0496113_0074040 3300048916 Bacteria 2596
456 Ga0496113_0080009 3300048916 Bacteria 2502
457 Ga0496113_1171644 3300048916 Bacteria 601
458 Ga0496114_0028624 3300048917 Bacteria 4573
459 Ga0496114_0178105 3300048917 Bacteria 1856
460 Ga0496114_0217486 3300048917 Bacteria 1677
461 Ga0496115_0011132 3300048918 Bacteria 6740
462 Ga0496115_0195274 3300048918 Bacteria 1672
463 Ga0496115_0294079 3300048918 Bacteria 1331
464 Ga0501036_0262584 3300049572 Unclassified 1446
465 Ga0501036_0444172 3300049572 Unclassified 1081
466 Ga0501039_0379617 3300049575 Unclassified 1110
467 Ga0501039_0667759 3300049575 Bacteria 813
468 Ga0501040_0049610 3300049576 Bacteria 2870
469 Ga0501040_0262340 3300049576 Unclassified 1233
470 Ga0501041_0300379 3300049577 Unclassified 1012
471 Ga0501041_0433797 3300049577 Bacteria 834
472 Ga0501042_0141382 3300049578 Unclassified 1736
473 Ga0501042_0165829 3300049578 Bacteria 1594
474 Ga0501048_0264284 3300049582 Bacteria 1223
475 Ga0501067_0167404 3300049583 Unclassified 1224
476 Ga0501068_0243837 3300049584 Bacteria 1144
477 Ga0501070_1391907 3300049586 Unclassified 533
478 Ga0501072_0199943 3300049588 Bacteria 1593
479 Ga0501072_0427977 3300049588 Unclassified 1049
480 Ga0501072_1188247 3300049588 Bacteria 593
481 Ga0501074_0108480 3300049590 Bacteria 1987
482 Ga0501074_0348328 3300049590 Unclassified 1051
483 Ga0501074_0525104 3300049590 Bacteria 838
484 Ga0501075_0291453 3300049591 Bacteria 1243
485 Ga0501076_0029725 3300049592 Bacteria 4251
486 Ga0501076_0248474 3300049592 Unclassified 1455
487 Ga0501076_0707993 3300049592 Unclassified 831
488 Ga0501076_1346126 3300049592 Bacteria 587
489 Ga0501077_0127694 3300049593 Unclassified 1612
490 Ga0501077_0423030 3300049593 Bacteria 852
491 Ga0501079_0031373 3300049741 Bacteria 4084
492 Ga0501079_0111079 3300049741 Bacteria 2130
493 Ga0501079_0529803 3300049741 Bacteria 926
494 Ga0501079_1485402 3300049741 Bacteria 533
495 Ga0501081_0308937 3300049743 Unclassified 1161
496 Ga0501045_0066255 3300049824 Bacteria 2652
497 Ga0501045_0078817 3300049824 Bacteria 2429
498 Ga0501045_0090111 3300049824 Unclassified 2266
499 Ga0501045_0273366 3300049824 Bacteria 1258
500 nmdc:mga03n38_31474_c1 3300050490 Unclassified 2239
501 nmdc:mga00v17_115585_c1 3300050491 Bacteria 1705
502 nmdc:mga00v17_147786_c1 3300050491 Bacteria 1509
503 nmdc:mga00v17_28401_c1 3300050491 Bacteria 3276
504 nmdc:mga00v17_402258_c1 3300050491 Bacteria 890
505 nmdc:mga00v17_425756_c1 3300050491 Bacteria 862
506 nmdc:mga00v17_455312_c1 3300050491 Unclassified 830
507 nmdc:mga00v17_840325_c1 3300050491 Bacteria 584
508 nmdc:mga00v17_84430_c1 3300050491 Bacteria 1988
509 nmdc:mga0yw44_146291_c1 3300050492 Bacteria 1539
510 nmdc:mga0yw44_176793_c1 3300050492 Bacteria 1403
511 nmdc:mga0yw44_203585_c1 3300050492 Unclassified 1308
512 nmdc:mga0yw44_35692_c1 3300050492 Bacteria 2924
513 nmdc:mga0yw44_50314_c1 3300050492 Bacteria 2519
514 nmdc:mga0yw44_686729_c1 3300050492 Bacteria 696
515 nmdc:mga05p37_182879_c1 3300050507 Unclassified 2549
516 nmdc:mga05p37_200328_c1 3300050507 Bacteria 2418
517 nmdc:mga05p37_474312_c1 3300050507 Bacteria 1443
518 nmdc:mga05p37_76388_c1 3300050507 Bacteria 4124
519 nmdc:mga0qj67_64517_c1 3300050509 Bacteria 2913
520 nmdc:mga0qj67_684730_c1 3300050509 Bacteria 816
521 nmdc:mga06r32_35648_c1 3300050510 Bacteria 4695
522 nmdc:mga06r32_65994_c1 3300050510 Bacteria 3492
523 nmdc:mga06r32_948720_c1 3300050510 Bacteria 815
524 nmdc:mga08y16_126377_c1 3300050511 Bacteria 2660
525 nmdc:mga08y16_294588_c1 3300050511 Bacteria 1673
526 nmdc:mga0n895_673159_c1 3300050512 Bacteria 1032
527 nmdc:mga0n895_695438_c1 3300050512 Unclassified 1013
528 nmdc:mga0n895_7787_c1 3300050512 Bacteria 9230
529 nmdc:mga0rr50_1404212_c1 3300050513 Unclassified 591
530 nmdc:mga0rr50_1921_c1 3300050513 Bacteria 11546
531 nmdc:mga08x19_409408_c1 3300050514 Bacteria 952
532 nmdc:mga0a205_538651_c1 3300050515 Unclassified 1023
533 nmdc:mga0a205_55222_c1 3300050515 Bacteria 3836
534 Ga0495601_0017946 3300053077 Bacteria 4302
535 Ga0495601_0402777 3300053077 Unclassified 887
536 Ga0495601_0938745 3300053077 Bacteria 545
537 Ga0495612_0079310 3300053078 Bacteria 1378
538 Ga0495612_0216649 3300053078 Bacteria 847
539 Ga0495595_0004215 3300053084 Bacteria 5781
540 Ga0495595_0246871 3300053084 Bacteria 893
541 Ga0495619_0000001 3300053085 Bacteria 586054
542 Ga0495619_0113211 3300053085 Bacteria 1855
543 Ga0501084_0076570 3300054114 Bacteria 2804
544 Ga0501084_0600213 3300054114 Bacteria 930
545 Ga0501082_0181494 3300060353 Bacteria 1831
546 Ga0501082_0986860 3300060353 Bacteria 736
547 Ga0466962_0330129 3300061719 Bacteria 757
548 Ga0530510_0051429 3300061734 Bacteria 2977
549 Ga0530510_0177435 3300061734 Bacteria 1579
550 Ga0530510_0467641 3300061734 Bacteria 954
551 Ga0530510_0537092 3300061734 Bacteria 888
552 8056452143 8056447290 Bacteria 7680491
553 Ga0070690_101096980
554 Ga0058862_12777495
555 Ga0070658_10124721
556 Ga0070683_100197133
557 Ga0070690_100628517
558 Ga0068869_101010707
559 Ga0070682_100115284
560 Ga0070682_100147536
561 Ga0070682_100237695
562 Ga0068868_100027502
563 Ga0068868_101799002
564 Ga0070660_100069021
565 Ga0070691_10084549
566 Ga0070675_100315467
567 Ga0070671_100819939
568 Ga0070671_101160743
569 Ga0070688_100165165
570 Ga0070659_100004418
571 Ga0070709_10096047
572 Ga0070714_100295534
573 Ga0070714_100343097
574 Ga0070714_100627461
575 Ga0070714_100651846
576 Ga0070714_101253997
577 Ga0070713_100143863
578 Ga0070713_100306907
579 Ga0070713_100572265
580 Ga0070713_101468648
581 Ga0070710_10094288
582 Ga0070710_10298616
583 Ga0070710_10331896
584 Ga0070701_10167176
585 Ga0070711_100007211
586 Ga0070711_100062770
587 Ga0070711_100102498
588 Ga0070705_100134320
589 Ga0070705_101421679
590 Ga0070694_100122897
591 Ga0070694_100360449
592 Ga0070663_100150699
593 Ga0070663_101297331
594 Ga0070663_101511814
595 Ga0070678_100015680
596 Ga0070681_10204088
597 Ga0070707_100003271
598 Ga0070707_100372092
599 Ga0070707_101090619
600 Ga0070699_100359139
601 Ga0070679_100040864
602 Ga0070684_100008541
603 Ga0068853_101514780
604 Ga0068853_101823740
605 Ga0070672_101154111
606 Ga0070686_100451681
607 Ga0070695_100185202
608 Ga0070696_100329145
609 Ga0070696_100511678
610 Ga0070704_100011433
611 Ga0070704_100857996
612 Ga0070704_100891353
613 Ga0070704_101648248
614 Ga0070664_100262886
615 Ga0068857_100277650
616 Ga0068856_100008876
617 Ga0068856_100049247
618 Ga0068856_100073565
619 Ga0070702_100182223
620 Ga0068852_100018872
621 Ga0068859_101359355
622 Ga0068863_100048749
623 Ga0068858_100000046
624 Ga0068858_100458607
625 Ga0068862_101413397
626 Ga0081455_10056790
627 Ga0081455_10282388
628 Ga0081538_10000690
629 Ga0081538_10009481
630 Ga0081538_10026534
631 Ga0070717_10169806
632 Ga0070717_10443364
633 Ga0070717_10805669
634 Ga0075365_10000128
635 Ga0075365_10001848
636 Ga0075365_10047246
637 Ga0075365_10440790
638 Ga0075365_10496200
639 Ga0075365_11064546
640 Ga0075363_100057529
641 Ga0075363_100155360
642 Ga0075364_10039754
643 Ga0075364_10231283
644 Ga0075364_10268462
645 Ga0075364_10395003
646 Ga0075364_11007575
647 Ga0070715_10298665
648 Ga0070716_100067422
649 Ga0070712_100001384
650 Ga0070712_100056040
651 Ga0070712_100070145
652 Ga0075367_10143918
653 Ga0075428_100027561
654 Ga0075430_100054606
655 Ga0075430_101287302
656 Ga0075431_100003746
657 Ga0075431_100069572
658 Ga0075431_100492843
659 Ga0075433_10020200
660 Ga0075434_100001338
661 Ga0075434_100016614
662 Ga0075434_100067971
663 Ga0068865_100069444
664 Ga0068865_100428555
665 Ga0068865_100922268
666 Ga0075436_100673960
667 Ga0097620_101359280
668 Ga0075435_100548013
669 Ga0099794_10303344
670 Ga0105240_10201427
671 Ga0111539_10002884
672 Ga0105245_10018317
673 Ga0105245_10349280
674 Ga0105245_11240784
675 Ga0105245_11678772
676 Ga0105245_12253569
677 Ga0105245_12446492
678 Ga0114129_10078816
679 Ga0114129_10181463
680 Ga0114129_10581613
681 Ga0114129_11183836
682 Ga0114129_11313390
683 Ga0105243_10149682
684 Ga0105242_10283843
685 Ga0105237_10116351
686 Ga0105238_10104340
687 Ga0105238_10885793
688 Ga0105249_10100675
689 Ga0105239_10130926
690 Ga0105239_10589881
691 Ga0157371_10077563
692 Ga0157370_10050275
693 Ga0157370_10126005
694 Ga0157372_10025959
695 Ga0157372_10589258
696 Ga0157372_11335380
697 Ga0157375_10035152
698 Ga0163163_12330925
699 Ga0157379_10707052
700 Ga0157376_10078125
701 Ga0157376_10506528
702 Ga0197907_11420944
703 Ga0206356_11253831
704 Ga0206355_1449106
705 Ga0206350_11048019
706 Ga0206353_10004111
707 Ga0206353_10697506
708 Ga0213875_10124255
709 Ga0224712_10324007
710 Ga0224712_10538207
711 Ga0224712_10547489
712 Ga0207692_10048801
713 Ga0207692_10087507
714 Ga0207688_10047010
715 Ga0207685_10233205
716 Ga0207699_10004441
717 Ga0207699_10092368
718 Ga0207699_10460713
719 Ga0207684_10032127
720 Ga0207707_10005672
721 Ga0207671_10249034
722 Ga0207693_10010727
723 Ga0207693_10030361
724 Ga0207663_10024584
725 Ga0207663_10117848
726 Ga0207660_10172860
727 Ga0207657_10086169
728 Ga0207652_10011637
729 Ga0207646_10000652
730 Ga0207646_10625070
731 Ga0207694_10188508
732 Ga0207659_10616713
733 Ga0207687_10115837
734 Ga0207687_10182820
735 Ga0207700_10005604
736 Ga0207700_10040328
737 Ga0207700_10055336
738 Ga0207700_10116267
739 Ga0207664_10116165
740 Ga0207664_10720940
741 Ga0207664_11092470
742 Ga0207664_11929786
743 Ga0207644_10485594
744 Ga0207709_10855059
745 Ga0207704_10051301
746 Ga0207665_10062619
747 Ga0207665_10790634
748 Ga0207679_10346982
749 Ga0207712_10200923
750 Ga0207712_11780244
751 Ga0207640_10038140
752 Ga0207658_11033293
753 Ga0207677_10019097
754 Ga0207703_10000042
755 Ga0207703_10769243
756 Ga0207639_11486632
757 Ga0207678_10118785
758 Ga0207678_10674669
759 Ga0207702_10032834
760 Ga0207702_10046999
761 Ga0207702_10142547
762 Ga0207641_10574247
763 Ga0207676_10615465
764 Ga0207674_10162097
765 Ga0207683_10029507
766 Ga0207683_10080282
767 Ga0207698_10005648
768 Ga0209588_1236579
769 Ga0207428_10042902
770 Ga0307409_101886279
771 Ga0307415_100167041
772 Ga0373930_0018662
773 Ga0373958_0114857
774 Ga0373928_0107176
775 Ga0373949_0010795
776 Ga0373932_0242055
777 Ga0373936_0007172
778 Ga0373939_0332874
779 Ga0373941_0073103
780 Ga0373953_0020310
781 Ga0373953_0058876
782 Ga0373953_0097877
783 Ga0373954_0026055
784 Ga0373954_0150529
785 Ga0373956_0042993
786 Ga0373957_0005301
787 Ga0373957_0037057
788 Ga0373946_0298634
789 Ga0373955_0043170
790 Ga0373955_0132183
791 Ga0373961_0231428
792 Ga0373962_0086033
793 Ga0373924_0068536
794 Ga0373924_0103818
795 Ga0373931_0187153
796 Ga0373931_0606751
797 Ga0373935_0017223
798 Ga0373935_1157116
799 Ga0373933_0004437
800 Ga0373933_0011260
801 Ga0373937_0027938
802 Ga0373937_0370194
803 Ga0373937_0452324
804 Ga0316582_0048250
805 Ga0316584_0313279
806 Ga0373925_0056606
807 Ga0395899_0074698
808 Ga0395900_0008759
809 Ga0395900_0188523
810 Ga0395900_0264100
811 Ga0395898_0002615
812 Ga0395898_0076711
813 Ga0395898_1065560
814 Ga0395905_0158297
815 Ga0395905_0347596
816 Ga0395905_1251706
817 Ga0436364_0412787
818 Ga0436364_0768656
819 Ga0436364_1400270
820 Ga0395901_0008822
821 Ga0395901_0016213
822 Ga0395901_0203125
823 Ga0395901_0395781
824 Ga0436365_0876033
825 Ga0436365_1475849
826 Ga0436363_0269141
827 Ga0436363_0537393
828 Ga0436362_0240820
829 Ga0436362_0323744
830 Ga0451853_3325620
831 Ga0466966_0822342
832 Ga0466961_0570727
833 Ga0466963_0394769
834 Ga0466963_1155197
835 Ga0466964_0226067
836 Ga0466971_0339858
837 Ga0466968_0014770
838 Ga0466968_0115319
839 Ga0466968_0482469
840 Ga0466968_0592715
841 Ga0466970_0541286
842 Ga0466957_0123712
843 Ga0466957_0144805
844 Ga0466957_0405129
845 Ga0466960_0190020
846 Ga0466959_0008290
847 Ga0466959_0167778
848 Ga0466959_0171802
849 Ga0466959_0354702
850 Ga0466959_0709051
851 Ga0466959_1019038
852 Ga0466958_0159391
853 Ga0466958_0227305
854 Ga0466958_0280823
855 Ga0466958_0348078
856 Ga0466958_0818028
857 Ga0466967_0087716
858 Ga0466967_0147327
859 Ga0466967_0687228
860 Ga0495592_0188871
861 Ga0495592_0207113
862 Ga0495592_0286616
863 Ga0495592_0595968
864 Ga0495603_0099533
865 Ga0495629_0003669
866 Ga0495629_0184121
867 Ga0495629_0233103
868 Ga0495641_0036475
869 Ga0495641_0533257
870 Ga0495651_0043758
871 Ga0495651_0062558
872 Ga0495651_0184174
873 Ga0495653_0108979
874 Ga0495653_0148529
875 Ga0495653_0152723
876 Ga0495653_0340892
877 Ga0495582_0006221
878 Ga0495639_0011797
879 Ga0495662_0007675
880 Ga0495664_0003420
881 Ga0495664_0048207
882 Ga0495608_0058606
883 Ga0495608_0089177
884 Ga0495618_0013261
885 Ga0495618_0114856
886 Ga0495618_0252611
887 Ga0495628_0170375
888 Ga0495628_0181470
889 Ga0495628_0183075
890 Ga0495628_0195539
891 Ga0495628_0494256
892 Ga0495628_0516214
893 Ga0495628_0862874
894 Ga0495630_0202398
895 Ga0495630_0386469
896 Ga0495652_0093398
897 Ga0495652_0398644
898 Ga0495652_0826091
899 Ga0495640_0009144
900 Ga0495640_0165254
901 Ga0495640_0374893
902 Ga0495586_0007353
903 Ga0495587_0039223
904 Ga0495587_0049789
905 Ga0495587_0100746
906 Ga0495587_0188649
907 Ga0495645_0022271
908 Ga0495645_0027804
909 Ga0495645_0186789
910 Ga0495645_0429019
911 Ga0495667_0016826
912 Ga0495667_0154581
913 Ga0495668_0523729
914 Ga0495668_0743462
915 Ga0495634_0013575
916 Ga0495634_0562938
917 Ga0495635_0155147
918 Ga0495635_0252739
919 Ga0495635_0299225
920 Ga0495635_0315123
921 Ga0495635_0602513
922 Ga0495657_0016719
923 Ga0495657_0027201
924 Ga0495623_0046800
925 Ga0495623_0064824
926 Ga0495646_0107415
927 Ga0495646_0469454
928 Ga0495647_0429234
929 Ga0495658_0012712
930 Ga0495613_0064749
931 Ga0495613_0128145
932 Ga0495613_0915024
933 Ga0495600_0003363
934 Ga0495600_0065759
935 Ga0495600_0389033
936 Ga0495581_0011657
937 Ga0495581_0088024
938 Ga0495581_0917033
939 Ga0495604_0175884
940 Ga0495604_0204292
941 Ga0495604_0324933
942 Ga0495604_0521155
943 Ga0495674_0076977
944 Ga0495674_0158116
945 Ga0495674_0551350
946 Ga0495672_0038175
947 Ga0495676_0136052
948 Ga0495680_0019244
949 Ga0495680_0029266
950 Ga0495680_0071235
951 Ga0495680_0146841
952 Ga0495675_0024628
953 Ga0495675_0058336
954 Ga0495675_0131845
955 Ga0495684_0093707
956 Ga0495684_0123317
957 Ga0495684_0402142
958 Ga0495684_0478374
959 Ga0495686_0030298
960 Ga0495593_0001218
961 Ga0495593_0476172
962 Ga0495602_0060601
963 Ga0495602_0167708
964 Ga0495602_0284868
965 Ga0495602_0353172
966 Ga0495614_0032502
967 Ga0495614_0110841
968 Ga0496100_0023737
969 Ga0496100_0114740
970 Ga0496101_0043376
971 Ga0496101_0303281
972 Ga0496101_0386864
973 Ga0496102_0017585
974 Ga0496102_0177900
975 Ga0496102_0437109
976 Ga0496102_0671468
977 Ga0496103_0004699
978 Ga0496104_0001843
979 Ga0496104_0112682
980 Ga0496104_0134571
981 Ga0496104_0575722
982 Ga0496105_0008094
983 Ga0496105_0016454
984 Ga0496105_0043142
985 Ga0496106_0002691
986 Ga0496106_0102366
987 Ga0496106_0879442
988 Ga0496107_0011873
989 Ga0496107_0177942
990 Ga0496107_0864132
991 Ga0496108_0001876
992 Ga0496108_0067118
993 Ga0496108_0190107
994 Ga0496108_0543119
995 Ga0496109_0000378
996 Ga0496109_0018949
997 Ga0496109_0031639
998 Ga0496110_0016107
999 Ga0496110_0021583
1000 Ga0496111_0009378
1001 Ga0496111_1153590
1002 Ga0496112_0039571
1003 Ga0496112_0043165
1004 Ga0496112_0653251
1005 Ga0496112_1214771
1006 Ga0496113_0026767
1007 Ga0496113_0074040
1008 Ga0496113_0080009
1009 Ga0496113_1171644
1010 Ga0496114_0028624
1011 Ga0496114_0178105
1012 Ga0496114_0217486
1013 Ga0496115_0011132
1014 Ga0496115_0195274
1015 Ga0496115_0294079
1016 Ga0501036_0262584
1017 Ga0501036_0444172
1018 Ga0501039_0379617
1019 Ga0501039_0667759
1020 Ga0501040_0049610
1021 Ga0501040_0262340
1022 Ga0501041_0300379
1023 Ga0501041_0433797
1024 Ga0501042_0141382
1025 Ga0501042_0165829
1026 Ga0501048_0264284
1027 Ga0501067_0167404
1028 Ga0501068_0243837
1029 Ga0501070_1391907
1030 Ga0501072_0199943
1031 Ga0501072_0427977
1032 Ga0501072_1188247
1033 Ga0501074_0108480
1034 Ga0501074_0348328
1035 Ga0501074_0525104
1036 Ga0501075_0291453
1037 Ga0501076_0029725
1038 Ga0501076_0248474
1039 Ga0501076_0707993
1040 Ga0501076_1346126
1041 Ga0501077_0127694
1042 Ga0501077_0423030
1043 Ga0501079_0031373
1044 Ga0501079_0111079
1045 Ga0501079_0529803
1046 Ga0501079_1485402
1047 Ga0501081_0308937
1048 Ga0501045_0066255
1049 Ga0501045_0078817
1050 Ga0501045_0090111
1051 Ga0501045_0273366
1052 nmdc:mga03n38_31474_c1
1053 nmdc:mga00v17_115585_c1
1054 nmdc:mga00v17_147786_c1
1055 nmdc:mga00v17_28401_c1
1056 nmdc:mga00v17_402258_c1
1057 nmdc:mga00v17_425756_c1
1058 nmdc:mga00v17_455312_c1
1059 nmdc:mga00v17_840325_c1
1060 nmdc:mga00v17_84430_c1
1061 nmdc:mga0yw44_146291_c1
1062 nmdc:mga0yw44_176793_c1
1063 nmdc:mga0yw44_203585_c1
1064 nmdc:mga0yw44_35692_c1
1065 nmdc:mga0yw44_50314_c1
1066 nmdc:mga0yw44_686729_c1
1067 nmdc:mga05p37_182879_c1
1068 nmdc:mga05p37_200328_c1
1069 nmdc:mga05p37_474312_c1
1070 nmdc:mga05p37_76388_c1
1071 nmdc:mga0qj67_64517_c1
1072 nmdc:mga0qj67_684730_c1
1073 nmdc:mga06r32_35648_c1
1074 nmdc:mga06r32_65994_c1
1075 nmdc:mga06r32_948720_c1
1076 nmdc:mga08y16_126377_c1
1077 nmdc:mga08y16_294588_c1
1078 nmdc:mga0n895_673159_c1
1079 nmdc:mga0n895_695438_c1
1080 nmdc:mga0n895_7787_c1
1081 nmdc:mga0rr50_1404212_c1
1082 nmdc:mga0rr50_1921_c1
1083 nmdc:mga08x19_409408_c1
1084 nmdc:mga0a205_538651_c1
1085 nmdc:mga0a205_55222_c1
1086 Ga0495601_0017946
1087 Ga0495601_0402777
1088 Ga0495601_0938745
1089 Ga0495612_0079310
1090 Ga0495612_0216649
1091 Ga0495595_0004215
1092 Ga0495595_0246871
1093 Ga0495619_0000001
1094 Ga0495619_0113211
1095 Ga0501084_0076570
1096 Ga0501084_0600213
1097 Ga0501082_0181494
1098 Ga0501082_0986860
1099 Ga0466962_0330129
1100 Ga0530510_0051429
1101 Ga0530510_0177435
1102 Ga0530510_0467641
1103 Ga0530510_0537092
1104 8056452143

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00571

CBS

CBS domain

61

113

0.93

PF00571

CBS

CBS domain

3

59

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
2rc3-assembly2.cif.gz_B crystal structure of cbs domain, ne2398 0.9178 8 122
1pvm-assembly1.cif.gz_A crystal structure of a conserved cbs domain protein ta0289 of unknown function from thermoplasma acidophilum 0.9061 1 119
3fhm-assembly2.cif.gz_B crystal structure of the cbs-domain containing protein atu1752 from agrobacterium tumefaciens 0.904 1 120
5npl-assembly1.cif.gz_A crystal structure of hexameric cbs-cp12 protein from bloom-forming cyanobacteria, yb-derivative at 2.8 a resolution 0.9 1 118
2rc3-assembly1.cif.gz_D crystal structure of cbs domain, ne2398 0.8961 8 122
ID Description Score Start End Superfamily
af_K7KHU5_50_204_3.10.580.10 Alpha Beta;Roll;CBS-domain;CBS-domain 0.9296 9 125 3.10.580.10
af_Q54FT9_77_228_3.10.580.10 Alpha Beta;Roll;CBS-domain;CBS-domain 0.9259 9 125 3.10.580.10
af_Q75K17_104_256_3.10.580.10 Alpha Beta;Roll;CBS-domain;CBS-domain 0.9217 2 125 3.10.580.10
af_Q5A3N2_197_353_3.10.580.10 Alpha Beta;Roll;CBS-domain;CBS-domain 0.9168 1 123 3.10.580.10
af_P71737_1_141_3.10.580.10 Alpha Beta;Roll;CBS-domain;CBS-domain 0.914 1 124 3.10.580.10
ID Description Score Start End GO Terms
AF-A0A7Y5P1B8-F1-model_v4 deleted 0.9921 1 125
AF-A0A7K2YH85-F1-model_v4 CBS domain-containing protein 0.992 1 125
AF-A0A166QCH7-F1-model_v4 CBS domain-containing protein 0.9885 1 125
AF-A0A7Y6A768-F1-model_v4 CBS domain-containing protein 0.9881 1 125
AF-A0A1C6UYX1-F1-model_v4 CBS domain-containing protein 0.9863 1 125

Map