F462634

General Info

Members Datasets Scaffolds Average Seq Length
551 254 1102 104

Family's Representative Sequence

Representative Sequence 3300031995|Ga0307409_101231780|Ga0307409_1012317802
Length 120
Sequence VRDRSHGLVVRQTEPVKELLDELDRWRSSGKRVAVARVVDIEGSGPREPGAAMAVSSDGEVVGSVSGGCVEGAVVTEALSVLAGDRKPGIVTFGYSDDEAFAVGLTCGGTIRLYIEELDW

Samples

Sample ID Description Type Environment
1 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
2 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
11 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
12 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
13 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
14 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
15 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
16 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
17 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
18 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
19 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
20 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
21 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
22 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
23 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
24 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
25 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
26 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
27 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
28 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
29 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
30 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
31 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
32 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
33 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
34 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
35 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
36 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
37 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
38 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
39 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
40 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
41 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
42 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
43 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
44 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
45 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
46 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
47 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
48 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
49 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
50 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
51 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
52 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
53 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
54 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
55 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
56 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
57 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
58 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
59 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
60 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
61 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
62 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
63 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
64 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
65 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
66 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
67 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
68 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
69 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
70 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
71 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
72 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
73 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
74 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
75 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
76 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
77 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
78 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
79 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
80 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
81 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
82 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
83 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
84 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
85 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
86 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
87 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
88 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
89 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
90 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
91 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
139 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
143 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
144 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
145 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
146 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
147 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
148 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
149 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
150 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
151 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
152 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
153 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
154 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
155 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
156 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
157 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
158 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
159 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
160 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
161 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
162 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
163 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
164 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
165 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
166 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
167 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
168 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
169 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
170 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
171 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
172 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
173 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
174 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
175 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
176 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
177 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
178 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
179 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
180 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
181 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
182 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
183 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
184 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
185 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
186 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
187 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
188 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
189 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
190 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
191 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
192 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
193 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
194 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
195 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
196 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
197 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
198 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
199 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
200 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
201 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
202 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
203 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
204 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
205 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
206 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
207 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
208 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
209 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
210 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
211 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
212 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
213 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
214 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
215 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
216 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
217 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
218 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
219 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
220 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
221 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
222 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
223 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
224 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
225 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
226 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
227 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
228 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
229 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
230 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
231 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
232 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
233 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
234 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
235 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
236 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
237 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
238 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
239 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
240 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
241 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
242 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
243 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
244 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
245 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
246 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
247 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
248 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
249 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
250 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
251 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
252 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
253 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
254 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.82
Metatranscriptomes 0.18
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.27
Nodule 0
Rhizoplane 13.79
Rhizosphere 79.85
Stem 0
Stem Tuber 0
Unclassified 1.45

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0307409_101231780 3300031995 Bacteria 772
2 JGI25407J50210_10011232 3300003373 Bacteria 2287
3 Ga0070683_100522593 3300005329 Bacteria 1134
4 Ga0070690_101402762 3300005330 Bacteria 562
5 Ga0070670_101203864 3300005331 Bacteria 692
6 Ga0068869_100274980 3300005334 Bacteria 1353
7 Ga0070682_100315506 3300005337 Bacteria 1152
8 Ga0070682_100483019 3300005337 Bacteria 956
9 Ga0068868_100304448 3300005338 Bacteria 1354
10 Ga0068868_100448292 3300005338 Bacteria 1122
11 Ga0068868_101297424 3300005338 Bacteria 676
12 Ga0070660_101805572 3300005339 Bacteria 521
13 Ga0070689_100227345 3300005340 Bacteria 1532
14 Ga0070689_100240350 3300005340 Bacteria 1491
15 Ga0070691_10872675 3300005341 Bacteria 553
16 Ga0070687_100237836 3300005343 Bacteria 1124
17 Ga0070669_100325042 3300005353 Bacteria 1243
18 Ga0070674_100005961 3300005356 Bacteria 7084
19 Ga0070688_100014501 3300005365 Bacteria 4467
20 Ga0070659_100628153 3300005366 Bacteria 925
21 Ga0070667_102146428 3300005367 Bacteria 526
22 Ga0070709_11334863 3300005434 Bacteria 579
23 Ga0070713_100448228 3300005436 Bacteria 1212
24 Ga0070701_10187927 3300005438 Bacteria 1214
25 Ga0070711_100912461 3300005439 Bacteria 750
26 Ga0070705_101848131 3300005440 Bacteria 513
27 Ga0070700_100103528 3300005441 Bacteria 1880
28 Ga0070694_101255314 3300005444 Bacteria 622
29 Ga0070694_101717590 3300005444 Bacteria 534
30 Ga0070694_101821633 3300005444 Bacteria 519
31 Ga0070708_100911539 3300005445 Bacteria 825
32 Ga0070678_100057665 3300005456 Bacteria 2846
33 Ga0070678_100603635 3300005456 Bacteria 980
34 Ga0070681_10415747 3300005458 Bacteria 1256
35 Ga0070681_10846653 3300005458 Bacteria 832
36 Ga0068867_100010625 3300005459 Bacteria 6495
37 Ga0068867_102344091 3300005459 Bacteria 508
38 Ga0070685_10473976 3300005466 Bacteria 881
39 Ga0070706_101233446 3300005467 Bacteria 687
40 Ga0070707_101392341 3300005468 Bacteria 668
41 Ga0070707_101863127 3300005468 Bacteria 569
42 Ga0070698_100047740 3300005471 Bacteria 4376
43 Ga0070699_100032897 3300005518 Bacteria 4479
44 Ga0070699_100325145 3300005518 Bacteria 1383
45 Ga0070679_100727821 3300005530 Bacteria 935
46 Ga0070684_102161773 3300005535 Bacteria 525
47 Ga0070686_100047681 3300005544 Bacteria 2710
48 Ga0070693_100600748 3300005547 Bacteria 794
49 Ga0070693_100890490 3300005547 Bacteria 666
50 Ga0070665_100649923 3300005548 Bacteria 1068
51 Ga0070665_101506815 3300005548 Bacteria 681
52 Ga0070665_102648092 3300005548 Bacteria 502
53 Ga0068855_100804504 3300005563 Bacteria 999
54 Ga0068854_100259519 3300005578 Bacteria 1391
55 Ga0068854_101711539 3300005578 Bacteria 575
56 Ga0070702_100114292 3300005615 Bacteria 1679
57 Ga0070702_101432569 3300005615 Bacteria 566
58 Ga0068859_100778698 3300005617 Bacteria 1045
59 Ga0068859_100786280 3300005617 Bacteria 1040
60 Ga0068859_101078294 3300005617 Bacteria 883
61 Ga0068859_101366611 3300005617 Bacteria 781
62 Ga0068859_102794405 3300005617 Bacteria 536
63 Ga0068864_100918529 3300005618 Bacteria 865
64 Ga0068864_101074511 3300005618 Bacteria 800
65 Ga0068864_102310287 3300005618 Bacteria 544
66 Ga0068861_100208123 3300005719 Bacteria 1646
67 Ga0068851_10209851 3300005834 Bacteria 1090
68 Ga0068851_10981545 3300005834 Bacteria 532
69 Ga0068863_100247827 3300005841 Bacteria 1720
70 Ga0068858_100062121 3300005842 Bacteria 3454
71 Ga0068858_100510918 3300005842 Bacteria 1161
72 Ga0068858_100742505 3300005842 Bacteria 956
73 Ga0068860_100362551 3300005843 Bacteria 1428
74 Ga0068860_100951745 3300005843 Bacteria 876
75 Ga0068862_100049395 3300005844 Bacteria 3593
76 Ga0068862_102428947 3300005844 Bacteria 536
77 Ga0081455_10003887 3300005937 Bacteria 17014
78 Ga0081455_10005618 3300005937 Bacteria 13700
79 Ga0081455_10453718 3300005937 Bacteria 875
80 Ga0075365_10383077 3300006038 Bacteria 992
81 Ga0075365_10563223 3300006038 Bacteria 806
82 Ga0075365_11187108 3300006038 Bacteria 537
83 Ga0075363_100013741 3300006048 Bacteria 3937
84 Ga0075363_100166992 3300006048 Bacteria 1248
85 Ga0075363_101017765 3300006048 Bacteria 511
86 Ga0075367_10321453 3300006178 Bacteria 975
87 Ga0097621_100055932 3300006237 Bacteria 3222
88 Ga0097621_101045663 3300006237 Bacteria 765
89 Ga0075370_10980393 3300006353 Bacteria 518
90 Ga0068871_100611141 3300006358 Bacteria 992
91 Ga0075428_100069171 3300006844 Bacteria 3861
92 Ga0075428_100143021 3300006844 Bacteria 2600
93 Ga0075428_100545516 3300006844 Bacteria 1239
94 Ga0075430_100040517 3300006846 Bacteria 3942
95 Ga0075430_100079319 3300006846 Bacteria 2751
96 Ga0075430_100079355 3300006846 Bacteria 2750
97 Ga0075430_100150651 3300006846 Bacteria 1937
98 Ga0075430_100157912 3300006846 Bacteria 1888
99 Ga0075430_100610398 3300006846 Bacteria 900
100 Ga0075431_100026483 3300006847 Bacteria 5948
101 Ga0075431_100051385 3300006847 Bacteria 4250
102 Ga0075431_100113912 3300006847 Bacteria 2791
103 Ga0075433_10009390 3300006852 Bacteria 7815
104 Ga0075434_100036559 3300006871 Bacteria 4858
105 Ga0075429_100039946 3300006880 Bacteria 4083
106 Ga0075429_101548158 3300006880 Bacteria 577
107 Ga0068865_100065583 3300006881 Bacteria 2559
108 Ga0068865_100068804 3300006881 Bacteria 2504
109 Ga0097620_100778826 3300006931 Bacteria 1045
110 Ga0097620_100786202 3300006931 Bacteria 1040
111 Ga0097620_101078396 3300006931 Bacteria 883
112 Ga0097620_101367114 3300006931 Bacteria 781
113 Ga0097620_102793373 3300006931 Bacteria 536
114 Ga0075435_100002655 3300007076 Bacteria 11923
115 Ga0111539_10103367 3300009094 Bacteria 3344
116 Ga0111539_10297005 3300009094 Bacteria 1880
117 Ga0111539_10703839 3300009094 Bacteria 1176
118 Ga0111539_11120789 3300009094 Bacteria 914
119 Ga0111539_11188056 3300009094 Bacteria 886
120 Ga0105245_10094115 3300009098 Bacteria 2761
121 Ga0105245_10329211 3300009098 Bacteria 1507
122 Ga0114129_10022785 3300009147 Bacteria 8879
123 Ga0114129_10143932 3300009147 Bacteria 3266
124 Ga0114129_10160196 3300009147 Bacteria 3075
125 Ga0114129_10580355 3300009147 Bacteria 1455
126 Ga0114129_11037519 3300009147 Bacteria 1030
127 Ga0105243_10045920 3300009148 Bacteria 3434
128 Ga0105243_11108578 3300009148 Bacteria 800
129 Ga0105243_12221865 3300009148 Unclassified 585
130 Ga0105243_12691467 3300009148 Bacteria 538
131 Ga0105241_11779394 3300009174 Bacteria 601
132 Ga0105241_12229973 3300009174 Bacteria 544
133 Ga0105242_10001872 3300009176 Bacteria 16540
134 Ga0105248_10772430 3300009177 Bacteria 1084
135 Ga0105248_11637949 3300009177 Bacteria 729
136 Ga0105237_11383476 3300009545 Bacteria 710
137 Ga0105237_12386238 3300009545 Bacteria 539
138 Ga0105249_10192344 3300009553 Bacteria 1992
139 Ga0105249_10227751 3300009553 Bacteria 1837
140 Ga0105249_10797563 3300009553 Bacteria 1008
141 Ga0105249_11467509 3300009553 Bacteria 754
142 Ga0105239_12297891 3300010375 Bacteria 627
143 Ga0105246_10488992 3300011119 Bacteria 1043
144 Ga0105246_12576546 3300011119 Bacteria 502
145 Ga0157371_11434837 3300013102 Bacteria 537
146 Ga0157369_10963515 3300013105 Bacteria 874
147 Ga0157378_10011793 3300013297 Bacteria 7652
148 Ga0157378_12157399 3300013297 Bacteria 608
149 Ga0157378_13246524 3300013297 Bacteria 505
150 Ga0163162_10723074 3300013306 Bacteria 1116
151 Ga0163162_11607437 3300013306 Bacteria 741
152 Ga0163162_12044160 3300013306 Bacteria 657
153 Ga0157372_11894919 3300013307 Bacteria 685
154 Ga0157375_10112234 3300013308 Bacteria 2826
155 Ga0157375_10279305 3300013308 Bacteria 1833
156 Ga0157375_10283092 3300013308 Bacteria 1821
157 Ga0157375_11706867 3300013308 Bacteria 746
158 Ga0157375_11806254 3300013308 Bacteria 725
159 Ga0163163_10154651 3300014325 Bacteria 2337
160 Ga0163163_10191734 3300014325 Bacteria 2092
161 Ga0163163_10243776 3300014325 Bacteria 1847
162 Ga0163163_11074188 3300014325 Bacteria 868
163 Ga0163163_11076291 3300014325 Bacteria 867
164 Ga0157380_10440608 3300014326 Bacteria 1248
165 Ga0157380_10563072 3300014326 Bacteria 1120
166 Ga0157380_13399643 3300014326 Bacteria 509
167 Ga0157377_11368411 3300014745 Bacteria 557
168 Ga0157377_11516716 3300014745 Bacteria 533
169 Ga0157379_10028993 3300014968 Bacteria 4922
170 Ga0157379_10256524 3300014968 Bacteria 1588
171 Ga0157379_11895417 3300014968 Bacteria 587
172 Ga0157376_10938666 3300014969 Bacteria 885
173 Ga0157376_12114840 3300014969 Bacteria 601
174 Ga0163161_10048679 3300017792 Bacteria 3062
175 Ga0163161_10706814 3300017792 Bacteria 840
176 Ga0206356_11394415 3300020070 Bacteria 593
177 Ga0213876_10027241 3300021384 Bacteria 3017
178 Ga0213876_10162338 3300021384 Bacteria 1189
179 Ga0207666_1005083 3300025271 Bacteria 1672
180 Ga0207656_10141867 3300025321 Bacteria 1133
181 Ga0207692_10031310 3300025898 Bacteria 2547
182 Ga0207692_10560212 3300025898 Bacteria 731
183 Ga0207642_10636768 3300025899 Bacteria 667
184 Ga0207710_10074408 3300025900 Bacteria 1564
185 Ga0207688_10121689 3300025901 Bacteria 1523
186 Ga0207645_10199271 3300025907 Bacteria 1317
187 Ga0207705_10678266 3300025909 Bacteria 801
188 Ga0207684_11084429 3300025910 Bacteria 667
189 Ga0207707_10128997 3300025912 Bacteria 2212
190 Ga0207707_10638124 3300025912 Bacteria 898
191 Ga0207663_10773345 3300025916 Bacteria 764
192 Ga0207663_11719253 3300025916 Bacteria 505
193 Ga0207662_10490824 3300025918 Bacteria 845
194 Ga0207662_11300853 3300025918 Bacteria 516
195 Ga0207652_10923848 3300025921 Bacteria 770
196 Ga0207652_11108841 3300025921 Bacteria 692
197 Ga0207681_10414796 3300025923 Bacteria 1090
198 Ga0207694_10644945 3300025924 Bacteria 892
199 Ga0207650_10515457 3300025925 Bacteria 1000
200 Ga0207650_11145802 3300025925 Bacteria 662
201 Ga0207659_11118454 3300025926 Bacteria 678
202 Ga0207687_10119227 3300025927 Bacteria 1971
203 Ga0207687_10331919 3300025927 Bacteria 1234
204 Ga0207687_10545388 3300025927 Bacteria 972
205 Ga0207687_11884944 3300025927 Bacteria 511
206 Ga0207700_10167904 3300025928 Bacteria 1828
207 Ga0207700_10170626 3300025928 Bacteria 1815
208 Ga0207664_10161651 3300025929 Bacteria 1910
209 Ga0207664_10376711 3300025929 Bacteria 1259
210 Ga0207690_11107377 3300025932 Bacteria 660
211 Ga0207686_10069089 3300025934 Bacteria 2265
212 Ga0207686_11171203 3300025934 Bacteria 628
213 Ga0207709_10942376 3300025935 Bacteria 703
214 Ga0207670_10724530 3300025936 Bacteria 825
215 Ga0207670_11674278 3300025936 Bacteria 541
216 Ga0207669_10145353 3300025937 Bacteria 1653
217 Ga0207704_10087142 3300025938 Bacteria 2038
218 Ga0207704_11980748 3300025938 Bacteria 501
219 Ga0207665_10930459 3300025939 Bacteria 690
220 Ga0207691_11427777 3300025940 Bacteria 568
221 Ga0207691_11547518 3300025940 Bacteria 541
222 Ga0207711_10060801 3300025941 Bacteria 3256
223 Ga0207689_10476816 3300025942 Bacteria 1044
224 Ga0207661_11976666 3300025944 Unclassified 529
225 Ga0207712_10124952 3300025961 Bacteria 1952
226 Ga0207668_11015163 3300025972 Bacteria 742
227 Ga0207668_11446675 3300025972 Bacteria 620
228 Ga0207640_12175747 3300025981 Bacteria 503
229 Ga0207658_10313976 3300025986 Bacteria 1355
230 Ga0207658_12114255 3300025986 Bacteria 512
231 Ga0207677_10819143 3300026023 Bacteria 834
232 Ga0207677_11429860 3300026023 Bacteria 637
233 Ga0207703_10027385 3300026035 Bacteria 4489
234 Ga0207703_10645576 3300026035 Bacteria 1004
235 Ga0207703_11695906 3300026035 Bacteria 608
236 Ga0207639_11942620 3300026041 Bacteria 549
237 Ga0207678_11304768 3300026067 Bacteria 642
238 Ga0207708_10482973 3300026075 Bacteria 1036
239 Ga0207702_10728106 3300026078 Bacteria 978
240 Ga0207641_10092551 3300026088 Bacteria 2648
241 Ga0207648_10001856 3300026089 Bacteria 23079
242 Ga0207648_10359391 3300026089 Bacteria 1314
243 Ga0207676_11433693 3300026095 Bacteria 687
244 Ga0207675_100022266 3300026118 Bacteria 5901
245 Ga0207675_101054317 3300026118 Bacteria 832
246 Ga0207683_10782449 3300026121 Bacteria 885
247 Ga0207683_11208336 3300026121 Bacteria 701
248 Ga0207698_10429596 3300026142 Bacteria 1270
249 Ga0207428_10204281 3300027907 Bacteria 1486
250 Ga0268266_10293677 3300028379 Bacteria 1514
251 Ga0268266_11137971 3300028379 Bacteria 755
252 Ga0268265_10348729 3300028380 Bacteria 1351
253 Ga0268265_10497311 3300028380 Bacteria 1148
254 Ga0268264_11034087 3300028381 Bacteria 829
255 Ga0268264_12283417 3300028381 Bacteria 548
256 Ga0307517_10155095 3300028786 Bacteria 1557
257 Ga0265327_10226906 3300031251 Bacteria 838
258 Ga0316575_10197931 3300031665 Bacteria 836
259 Ga0316575_10254010 3300031665 Bacteria 738
260 Ga0265314_10207806 3300031711 Bacteria 1152
261 Ga0316576_10006097 3300031727 Bacteria 7461
262 Ga0316576_10145931 3300031727 Bacteria 1782
263 Ga0316576_10184633 3300031727 Bacteria 1573
264 Ga0316576_11130290 3300031727 Bacteria 555
265 Ga0316578_10297102 3300031728 Bacteria 966
266 Ga0316578_10543314 3300031728 Bacteria 683
267 Ga0316577_10535633 3300031733 Bacteria 666
268 Ga0307409_100196669 3300031995 Bacteria 1800
269 Ga0307409_102358384 3300031995 Bacteria 561
270 Ga0307416_101512475 3300032002 Bacteria 777
271 Ga0373930_0026772 3300034816 Bacteria 1165
272 Ga0373926_0165707 3300035083 Bacteria 845
273 Ga0373932_0165906 3300035112 Bacteria 767
274 Ga0316574_0027683 3300035398 Bacteria 3415
275 Ga0316574_0072851 3300035398 Bacteria 2171
276 Ga0316574_0091644 3300035398 Bacteria 1938
277 Ga0316574_0297469 3300035398 Bacteria 1027
278 Ga0373931_0286296 3300035691 Bacteria 1013
279 Ga0373935_0461876 3300035692 Bacteria 918
280 Ga0373937_1654429 3300036401 Bacteria 587
281 Ga0316582_0872138 3300036647 Bacteria 616
282 Ga0316584_0027875 3300036712 Bacteria 4159
283 Ga0436365_0314718 3300039437 Bacteria 1472
284 Ga0436365_0358756 3300039437 Bacteria 7560
285 Ga0436365_0807260 3300039437 Bacteria 1617
286 Ga0436365_1133998 3300039437 Bacteria 2154
287 Ga0436365_1160606 3300039437 Bacteria 1913
288 Ga0436365_1600695 3300039437 Bacteria 569
289 Ga0436365_1613638 3300039437 Bacteria 5470
290 Ga0436360_0276818 3300039438 Bacteria 533
291 Ga0436363_0380129 3300039450 Bacteria 979
292 Ga0436363_0900687 3300039450 Bacteria 696
293 Ga0436362_1098241 3300039453 Bacteria 3770
294 Ga0436362_1174211 3300039453 Bacteria 593
295 Ga0451793_1914378 3300041452 Bacteria 796
296 Ga0451800_0935723 3300041459 Bacteria 737
297 Ga0451839_0898856 3300041496 Bacteria 538
298 Ga0451847_0251992 3300041503 Bacteria 541
299 Ga0451851_0880222 3300041507 Bacteria 618
300 Ga0451853_1260989 3300041512 Bacteria 1211
301 Ga0451853_1408945 3300041512 Bacteria 1305
302 Ga0450918_006283 3300042531 Bacteria 2121
303 Ga0466968_0211613 3300044735 Bacteria 911
304 Ga0466967_0677529 3300045976 Bacteria 1021
305 Ga0495603_0323225 3300046455 Bacteria 886
306 Ga0495603_0559872 3300046455 Unclassified 655
307 Ga0495603_0582159 3300046455 Bacteria 641
308 Ga0495629_0895034 3300046459 Bacteria 582
309 Ga0495641_0496769 3300046461 Bacteria 556
310 Ga0495651_0825641 3300046462 Bacteria 571
311 Ga0495584_0221069 3300046491 Bacteria 963
312 Ga0495608_0582094 3300046511 Bacteria 673
313 Ga0495608_0671702 3300046511 Bacteria 618
314 Ga0495628_0432601 3300046516 Bacteria 958
315 Ga0495628_0858147 3300046516 Bacteria 632
316 Ga0495630_0059194 3300046517 Bacteria 2874
317 Ga0495630_0713841 3300046517 Bacteria 767
318 Ga0495644_0358221 3300046523 Unclassified 575
319 Ga0495663_0319298 3300046525 Bacteria 562
320 Ga0495633_0440631 3300046558 Bacteria 589
321 Ga0495667_0241034 3300046559 Bacteria 1152
322 Ga0495588_0645896 3300046674 Bacteria 554
323 Ga0495657_0031514 3300046675 Bacteria 3706
324 Ga0495613_0721178 3300046689 Bacteria 655
325 Ga0495604_0058957 3300047317 Bacteria 2946
326 Ga0495604_0858678 3300047317 Bacteria 569
327 Ga0495674_0605120 3300047319 Bacteria 868
328 Ga0495676_0095999 3300047321 Bacteria 2205
329 Ga0495676_0770154 3300047321 Bacteria 620
330 Ga0495593_0304522 3300047673 Bacteria 797
331 Ga0495602_0257305 3300048088 Bacteria 1297
332 Ga0496100_0024417 3300048903 Bacteria 3687
333 Ga0496100_0176133 3300048903 Bacteria 1544
334 Ga0496100_0859270 3300048903 Bacteria 712
335 Ga0496101_0038966 3300048904 Bacteria 3377
336 Ga0496101_0085425 3300048904 Bacteria 2338
337 Ga0496101_0111125 3300048904 Bacteria 2063
338 Ga0496101_1548891 3300048904 Bacteria 515
339 Ga0496102_0065932 3300048905 Bacteria 3319
340 Ga0496102_0123122 3300048905 Bacteria 2423
341 Ga0496102_0166658 3300048905 Bacteria 2073
342 Ga0496102_0214993 3300048905 Bacteria 1812
343 Ga0496102_0334564 3300048905 Bacteria 1426
344 Ga0496102_0494599 3300048905 Bacteria 1145
345 Ga0496102_0510640 3300048905 Bacteria 1124
346 Ga0496102_1004927 3300048905 Bacteria 755
347 Ga0496102_1803431 3300048905 Bacteria 529
348 Ga0496103_0071310 3300048906 Bacteria 2174
349 Ga0496103_0205005 3300048906 Bacteria 1268
350 Ga0496103_0696411 3300048906 Bacteria 644
351 Ga0496104_0055665 3300048907 Bacteria 3740
352 Ga0496104_0066019 3300048907 Bacteria 3435
353 Ga0496104_0154862 3300048907 Bacteria 2200
354 Ga0496104_0214621 3300048907 Bacteria 1836
355 Ga0496104_0397812 3300048907 Bacteria 1290
356 Ga0496104_1535117 3300048907 Unclassified 569
357 Ga0496105_0018149 3300048908 Bacteria 5648
358 Ga0496105_0026210 3300048908 Bacteria 4753
359 Ga0496105_0159178 3300048908 Bacteria 1854
360 Ga0496105_0547953 3300048908 Bacteria 903
361 Ga0496105_0616799 3300048908 Bacteria 840
362 Ga0496105_0858290 3300048908 Bacteria 687
363 Ga0496106_0159814 3300048909 Bacteria 1782
364 Ga0496106_0338271 3300048909 Bacteria 1208
365 Ga0496107_0134158 3300048910 Bacteria 1829
366 Ga0496107_0197929 3300048910 Bacteria 1493
367 Ga0496108_0189430 3300048911 Bacteria 1783
368 Ga0496108_0213462 3300048911 Bacteria 1675
369 Ga0496108_0302346 3300048911 Bacteria 1394
370 Ga0496108_0375573 3300048911 Bacteria 1241
371 Ga0496108_1412086 3300048911 Unclassified 582
372 Ga0496109_0155413 3300048912 Bacteria 2142
373 Ga0496109_0229635 3300048912 Bacteria 1746
374 Ga0496109_0331834 3300048912 Bacteria 1436
375 Ga0496109_0384227 3300048912 Bacteria 1326
376 Ga0496109_0849742 3300048912 Bacteria 851
377 Ga0496109_1405649 3300048912 Bacteria 633
378 Ga0496110_0022032 3300048913 Bacteria 5404
379 Ga0496110_0028462 3300048913 Bacteria 4800
380 Ga0496110_0080750 3300048913 Bacteria 2898
381 Ga0496110_0208518 3300048913 Bacteria 1776
382 Ga0496110_0346296 3300048913 Bacteria 1354
383 Ga0496110_0445219 3300048913 Bacteria 1181
384 Ga0496110_0563379 3300048913 Bacteria 1035
385 Ga0496111_0012961 3300048914 Bacteria 5659
386 Ga0496111_0025925 3300048914 Bacteria 4137
387 Ga0496111_0923057 3300048914 Bacteria 628
388 Ga0496112_0024770 3300048915 Bacteria 5754
389 Ga0496112_0524306 3300048915 Bacteria 1119
390 Ga0496112_1419634 3300048915 Bacteria 609
391 Ga0496112_1584819 3300048915 Bacteria 568
392 Ga0496113_1569541 3300048916 Bacteria 507
393 Ga0496114_0026744 3300048917 Bacteria 4726
394 Ga0496114_0039295 3300048917 Bacteria 3915
395 Ga0496114_0094997 3300048917 Bacteria 2536
396 Ga0496114_0217255 3300048917 Bacteria 1678
397 Ga0496114_0250125 3300048917 Bacteria 1560
398 Ga0496114_0472147 3300048917 Bacteria 1110
399 Ga0496114_0834893 3300048917 Bacteria 801
400 Ga0496114_0885899 3300048917 Bacteria 773
401 Ga0496114_0921804 3300048917 Bacteria 755
402 Ga0496114_1283475 3300048917 Bacteria 619
403 Ga0496115_0002829 3300048918 Bacteria 12480
404 Ga0496115_0278279 3300048918 Bacteria 1374
405 Ga0496115_1054694 3300048918 Bacteria 618
406 Ga0501031_0041160 3300049568 Bacteria 3017
407 Ga0501031_0075744 3300049568 Bacteria 2191
408 Ga0501031_0248512 3300049568 Bacteria 1156
409 Ga0501031_0785266 3300049568 Bacteria 611
410 Ga0501034_1620670 3300049571 Bacteria 520
411 Ga0501036_0008752 3300049572 Bacteria 8307
412 Ga0501036_0067345 3300049572 Bacteria 3029
413 Ga0501036_0092876 3300049572 Bacteria 2550
414 Ga0501036_0252337 3300049572 Bacteria 1478
415 Ga0501036_0274613 3300049572 Bacteria 1411
416 Ga0501036_0660089 3300049572 Bacteria 865
417 Ga0501036_0907686 3300049572 Bacteria 723
418 Ga0501036_1371223 3300049572 Bacteria 574
419 Ga0501038_0075547 3300049574 Bacteria 2848
420 Ga0501038_0250783 3300049574 Bacteria 1402
421 Ga0501038_0835410 3300049574 Bacteria 683
422 Ga0501039_0152842 3300049575 Bacteria 1813
423 Ga0501039_0462843 3300049575 Bacteria 996
424 Ga0501039_0489101 3300049575 Bacteria 966
425 Ga0501040_0029963 3300049576 Bacteria 3673
426 Ga0501040_0081168 3300049576 Bacteria 2247
427 Ga0501040_0201005 3300049576 Bacteria 1415
428 Ga0501040_0495666 3300049576 Bacteria 880
429 Ga0501041_0022861 3300049577 Bacteria 3746
430 Ga0501041_0186702 3300049577 Bacteria 1298
431 Ga0501041_0250306 3300049577 Bacteria 1114
432 Ga0501042_0039541 3300049578 Bacteria 3352
433 Ga0501042_0113974 3300049578 Bacteria 1947
434 Ga0501042_0419987 3300049578 Bacteria 969
435 Ga0501043_0355796 3300049579 Bacteria 1112
436 Ga0501046_0221121 3300049580 Bacteria 1402
437 Ga0501048_0149572 3300049582 Bacteria 1651
438 Ga0501048_0168156 3300049582 Bacteria 1552
439 Ga0501048_0544567 3300049582 Bacteria 833
440 Ga0501048_1138149 3300049582 Bacteria 561
441 Ga0501068_0310510 3300049584 Bacteria 1010
442 Ga0501068_0404203 3300049584 Bacteria 881
443 Ga0501068_0928377 3300049584 Bacteria 573
444 Ga0501069_0212198 3300049585 Bacteria 1124
445 Ga0501069_0410575 3300049585 Bacteria 802
446 Ga0501070_1032911 3300049586 Bacteria 636
447 Ga0501071_0014916 3300049587 Bacteria 5324
448 Ga0501071_0047334 3300049587 Bacteria 3089
449 Ga0501071_0108273 3300049587 Bacteria 2053
450 Ga0501071_0137793 3300049587 Bacteria 1816
451 Ga0501071_0157494 3300049587 Bacteria 1696
452 Ga0501072_0003014 3300049588 Bacteria 12700
453 Ga0501072_0012644 3300049588 Bacteria 6454
454 Ga0501072_0289217 3300049588 Bacteria 1303
455 Ga0501072_0364087 3300049588 Unclassified 1148
456 Ga0501072_0753084 3300049588 Bacteria 764
457 Ga0501073_0090515 3300049589 Bacteria 2126
458 Ga0501074_0410913 3300049590 Bacteria 960
459 Ga0501074_1145619 3300049590 Bacteria 546
460 Ga0501074_1335204 3300049590 Bacteria 502
461 Ga0501075_0042298 3300049591 Bacteria 3416
462 Ga0501075_0071474 3300049591 Bacteria 2623
463 Ga0501075_0350055 3300049591 Bacteria 1126
464 Ga0501075_0704656 3300049591 Bacteria 769
465 Ga0501075_0920829 3300049591 Bacteria 664
466 Ga0501076_0013459 3300049592 Bacteria 6138
467 Ga0501076_0016786 3300049592 Bacteria 5556
468 Ga0501076_0038060 3300049592 Bacteria 3775
469 Ga0501076_0147997 3300049592 Bacteria 1910
470 Ga0501076_0224010 3300049592 Bacteria 1537
471 Ga0501076_1240974 3300049592 Unclassified 613
472 Ga0501079_0010268 3300049741 Bacteria 7111
473 Ga0501079_0312653 3300049741 Bacteria 1229
474 Ga0501079_0550765 3300049741 Bacteria 907
475 Ga0501079_1281296 3300049741 Bacteria 577
476 Ga0501080_0339866 3300049742 Bacteria 1357
477 Ga0501080_1366564 3300049742 Bacteria 605
478 Ga0501081_0022061 3300049743 Bacteria 4257
479 Ga0501081_0128251 3300049743 Bacteria 1811
480 Ga0501081_0795234 3300049743 Bacteria 712
481 Ga0501081_1120004 3300049743 Bacteria 596
482 Ga0501081_1157904 3300049743 Bacteria 586
483 Ga0501083_0426063 3300049744 Bacteria 863
484 Ga0501083_0621378 3300049744 Bacteria 703
485 Ga0501035_0175651 3300049822 Bacteria 1848
486 Ga0501035_1511427 3300049822 Bacteria 512
487 Ga0501044_1681889 3300049823 Bacteria 500
488 Ga0501045_0014183 3300049824 Bacteria 5645
489 Ga0501045_0034894 3300049824 Bacteria 3652
490 Ga0501045_0037134 3300049824 Bacteria 3541
491 Ga0501045_0105880 3300049824 Bacteria 2084
492 Ga0501045_0156892 3300049824 Bacteria 1693
493 Ga0501045_0329008 3300049824 Bacteria 1137
494 Ga0501045_0511087 3300049824 Bacteria 892
495 nmdc:mga03n38_19895_c1 3300050490 Bacteria 2676
496 nmdc:mga03n38_201852_c1 3300050490 Bacteria 1029
497 nmdc:mga0yw44_444097_c1 3300050492 Bacteria 879
498 nmdc:mga0yw44_530218_c1 3300050492 Bacteria 799
499 nmdc:mga0yw44_656283_c1 3300050492 Bacteria 713
500 nmdc:mga0yw44_770945_c1 3300050492 Bacteria 653
501 nmdc:mga06z11_357857_c1 3300050494 Bacteria 874
502 nmdc:mga06z11_824227_c1 3300050494 Bacteria 565
503 nmdc:mga05p37_1211594_c1 3300050507 Bacteria 779
504 nmdc:mga05p37_134666_c1 3300050507 Bacteria 3031
505 nmdc:mga05p37_350836_c1 3300050507 Bacteria 1737
506 nmdc:mga05p37_466762_c1 3300050507 Bacteria 1457
507 nmdc:mga05p37_608722_c1 3300050507 Bacteria 1232
508 nmdc:mga05p37_613784_c1 3300050507 Bacteria 1225
509 nmdc:mga05p37_673167_c1 3300050507 Bacteria 1155
510 nmdc:mga05p37_88808_c1 3300050507 Bacteria 3810
511 nmdc:mga09592_20918_c1 3300050508 Bacteria 5388
512 nmdc:mga0qj67_222626_c1 3300050509 Bacteria 1532
513 nmdc:mga0qj67_41604_c1 3300050509 Bacteria 3615
514 nmdc:mga0qj67_464612_c1 3300050509 Bacteria 1019
515 nmdc:mga0qj67_558695_c1 3300050509 Bacteria 918
516 nmdc:mga0qj67_7151_c1 3300050509 Bacteria 8235
517 nmdc:mga0qj67_84978_c1 3300050509 Bacteria 2538
518 nmdc:mga06r32_1865561_c1 3300050510 Bacteria 536
519 nmdc:mga06r32_2006973_c1 3300050510 Bacteria 512
520 nmdc:mga06r32_302277_c1 3300050510 Bacteria 1586
521 nmdc:mga06r32_425071_c1 3300050510 Bacteria 1310
522 nmdc:mga06r32_49790_c1 3300050510 Bacteria 4008
523 nmdc:mga06r32_586910_c1 3300050510 Bacteria 1086
524 nmdc:mga08y16_1084872_c1 3300050511 Bacteria 776
525 nmdc:mga08y16_1939273_c1 3300050511 Bacteria 539
526 nmdc:mga0n895_9349_c1 3300050512 Bacteria 8570
527 nmdc:mga0rr50_35692_c1 3300050513 Bacteria 3573
528 nmdc:mga0a205_37399_c1 3300050515 Bacteria 4668
529 Ga0495601_0058597 3300053077 Bacteria 2441
530 Ga0495601_0367476 3300053077 Bacteria 934
531 Ga0495601_0391168 3300053077 Bacteria 902
532 Ga0495612_0013692 3300053078 Bacteria 3267
533 Ga0495595_0244630 3300053084 Bacteria 898
534 Ga0495619_0064289 3300053085 Bacteria 2446
535 Ga0495619_1120976 3300053085 Bacteria 523
536 Ga0500628_134637 3300053129 Bacteria 681
537 Ga0500616_0000692 3300053153 Bacteria 39433
538 Ga0501084_0000020 3300054114 Bacteria 146335
539 Ga0501084_0014435 3300054114 Bacteria 6546
540 Ga0501084_0016280 3300054114 Bacteria 6175
541 Ga0501084_0279705 3300054114 Bacteria 1409
542 Ga0501084_0445200 3300054114 Bacteria 1095
543 Ga0501084_0830413 3300054114 Bacteria 778
544 Ga0501082_0013128 3300060353 Bacteria 7123
545 Ga0501082_0198438 3300060353 Bacteria 1746
546 Ga0501082_0201812 3300060353 Bacteria 1730
547 Ga0501082_1323425 3300060353 Bacteria 629
548 Ga0530510_0047914 3300061734 Bacteria 3088
549 Ga0530510_0158151 3300061734 Bacteria 1675
550 Ga0530510_0866875 3300061734 Bacteria 690
551 Ga0530510_0878880 3300061734 Bacteria 685
552 Ga0307409_101231780
553 JGI25407J50210_10011232
554 Ga0070683_100522593
555 Ga0070690_101402762
556 Ga0070670_101203864
557 Ga0068869_100274980
558 Ga0070682_100315506
559 Ga0070682_100483019
560 Ga0068868_100304448
561 Ga0068868_100448292
562 Ga0068868_101297424
563 Ga0070660_101805572
564 Ga0070689_100227345
565 Ga0070689_100240350
566 Ga0070691_10872675
567 Ga0070687_100237836
568 Ga0070669_100325042
569 Ga0070674_100005961
570 Ga0070688_100014501
571 Ga0070659_100628153
572 Ga0070667_102146428
573 Ga0070709_11334863
574 Ga0070713_100448228
575 Ga0070701_10187927
576 Ga0070711_100912461
577 Ga0070705_101848131
578 Ga0070700_100103528
579 Ga0070694_101255314
580 Ga0070694_101717590
581 Ga0070694_101821633
582 Ga0070708_100911539
583 Ga0070678_100057665
584 Ga0070678_100603635
585 Ga0070681_10415747
586 Ga0070681_10846653
587 Ga0068867_100010625
588 Ga0068867_102344091
589 Ga0070685_10473976
590 Ga0070706_101233446
591 Ga0070707_101392341
592 Ga0070707_101863127
593 Ga0070698_100047740
594 Ga0070699_100032897
595 Ga0070699_100325145
596 Ga0070679_100727821
597 Ga0070684_102161773
598 Ga0070686_100047681
599 Ga0070693_100600748
600 Ga0070693_100890490
601 Ga0070665_100649923
602 Ga0070665_101506815
603 Ga0070665_102648092
604 Ga0068855_100804504
605 Ga0068854_100259519
606 Ga0068854_101711539
607 Ga0070702_100114292
608 Ga0070702_101432569
609 Ga0068859_100778698
610 Ga0068859_100786280
611 Ga0068859_101078294
612 Ga0068859_101366611
613 Ga0068859_102794405
614 Ga0068864_100918529
615 Ga0068864_101074511
616 Ga0068864_102310287
617 Ga0068861_100208123
618 Ga0068851_10209851
619 Ga0068851_10981545
620 Ga0068863_100247827
621 Ga0068858_100062121
622 Ga0068858_100510918
623 Ga0068858_100742505
624 Ga0068860_100362551
625 Ga0068860_100951745
626 Ga0068862_100049395
627 Ga0068862_102428947
628 Ga0081455_10003887
629 Ga0081455_10005618
630 Ga0081455_10453718
631 Ga0075365_10383077
632 Ga0075365_10563223
633 Ga0075365_11187108
634 Ga0075363_100013741
635 Ga0075363_100166992
636 Ga0075363_101017765
637 Ga0075367_10321453
638 Ga0097621_100055932
639 Ga0097621_101045663
640 Ga0075370_10980393
641 Ga0068871_100611141
642 Ga0075428_100069171
643 Ga0075428_100143021
644 Ga0075428_100545516
645 Ga0075430_100040517
646 Ga0075430_100079319
647 Ga0075430_100079355
648 Ga0075430_100150651
649 Ga0075430_100157912
650 Ga0075430_100610398
651 Ga0075431_100026483
652 Ga0075431_100051385
653 Ga0075431_100113912
654 Ga0075433_10009390
655 Ga0075434_100036559
656 Ga0075429_100039946
657 Ga0075429_101548158
658 Ga0068865_100065583
659 Ga0068865_100068804
660 Ga0097620_100778826
661 Ga0097620_100786202
662 Ga0097620_101078396
663 Ga0097620_101367114
664 Ga0097620_102793373
665 Ga0075435_100002655
666 Ga0111539_10103367
667 Ga0111539_10297005
668 Ga0111539_10703839
669 Ga0111539_11120789
670 Ga0111539_11188056
671 Ga0105245_10094115
672 Ga0105245_10329211
673 Ga0114129_10022785
674 Ga0114129_10143932
675 Ga0114129_10160196
676 Ga0114129_10580355
677 Ga0114129_11037519
678 Ga0105243_10045920
679 Ga0105243_11108578
680 Ga0105243_12221865
681 Ga0105243_12691467
682 Ga0105241_11779394
683 Ga0105241_12229973
684 Ga0105242_10001872
685 Ga0105248_10772430
686 Ga0105248_11637949
687 Ga0105237_11383476
688 Ga0105237_12386238
689 Ga0105249_10192344
690 Ga0105249_10227751
691 Ga0105249_10797563
692 Ga0105249_11467509
693 Ga0105239_12297891
694 Ga0105246_10488992
695 Ga0105246_12576546
696 Ga0157371_11434837
697 Ga0157369_10963515
698 Ga0157378_10011793
699 Ga0157378_12157399
700 Ga0157378_13246524
701 Ga0163162_10723074
702 Ga0163162_11607437
703 Ga0163162_12044160
704 Ga0157372_11894919
705 Ga0157375_10112234
706 Ga0157375_10279305
707 Ga0157375_10283092
708 Ga0157375_11706867
709 Ga0157375_11806254
710 Ga0163163_10154651
711 Ga0163163_10191734
712 Ga0163163_10243776
713 Ga0163163_11074188
714 Ga0163163_11076291
715 Ga0157380_10440608
716 Ga0157380_10563072
717 Ga0157380_13399643
718 Ga0157377_11368411
719 Ga0157377_11516716
720 Ga0157379_10028993
721 Ga0157379_10256524
722 Ga0157379_11895417
723 Ga0157376_10938666
724 Ga0157376_12114840
725 Ga0163161_10048679
726 Ga0163161_10706814
727 Ga0206356_11394415
728 Ga0213876_10027241
729 Ga0213876_10162338
730 Ga0207666_1005083
731 Ga0207656_10141867
732 Ga0207692_10031310
733 Ga0207692_10560212
734 Ga0207642_10636768
735 Ga0207710_10074408
736 Ga0207688_10121689
737 Ga0207645_10199271
738 Ga0207705_10678266
739 Ga0207684_11084429
740 Ga0207707_10128997
741 Ga0207707_10638124
742 Ga0207663_10773345
743 Ga0207663_11719253
744 Ga0207662_10490824
745 Ga0207662_11300853
746 Ga0207652_10923848
747 Ga0207652_11108841
748 Ga0207681_10414796
749 Ga0207694_10644945
750 Ga0207650_10515457
751 Ga0207650_11145802
752 Ga0207659_11118454
753 Ga0207687_10119227
754 Ga0207687_10331919
755 Ga0207687_10545388
756 Ga0207687_11884944
757 Ga0207700_10167904
758 Ga0207700_10170626
759 Ga0207664_10161651
760 Ga0207664_10376711
761 Ga0207690_11107377
762 Ga0207686_10069089
763 Ga0207686_11171203
764 Ga0207709_10942376
765 Ga0207670_10724530
766 Ga0207670_11674278
767 Ga0207669_10145353
768 Ga0207704_10087142
769 Ga0207704_11980748
770 Ga0207665_10930459
771 Ga0207691_11427777
772 Ga0207691_11547518
773 Ga0207711_10060801
774 Ga0207689_10476816
775 Ga0207661_11976666
776 Ga0207712_10124952
777 Ga0207668_11015163
778 Ga0207668_11446675
779 Ga0207640_12175747
780 Ga0207658_10313976
781 Ga0207658_12114255
782 Ga0207677_10819143
783 Ga0207677_11429860
784 Ga0207703_10027385
785 Ga0207703_10645576
786 Ga0207703_11695906
787 Ga0207639_11942620
788 Ga0207678_11304768
789 Ga0207708_10482973
790 Ga0207702_10728106
791 Ga0207641_10092551
792 Ga0207648_10001856
793 Ga0207648_10359391
794 Ga0207676_11433693
795 Ga0207675_100022266
796 Ga0207675_101054317
797 Ga0207683_10782449
798 Ga0207683_11208336
799 Ga0207698_10429596
800 Ga0207428_10204281
801 Ga0268266_10293677
802 Ga0268266_11137971
803 Ga0268265_10348729
804 Ga0268265_10497311
805 Ga0268264_11034087
806 Ga0268264_12283417
807 Ga0307517_10155095
808 Ga0265327_10226906
809 Ga0316575_10197931
810 Ga0316575_10254010
811 Ga0265314_10207806
812 Ga0316576_10006097
813 Ga0316576_10145931
814 Ga0316576_10184633
815 Ga0316576_11130290
816 Ga0316578_10297102
817 Ga0316578_10543314
818 Ga0316577_10535633
819 Ga0307409_100196669
820 Ga0307409_102358384
821 Ga0307416_101512475
822 Ga0373930_0026772
823 Ga0373926_0165707
824 Ga0373932_0165906
825 Ga0316574_0027683
826 Ga0316574_0072851
827 Ga0316574_0091644
828 Ga0316574_0297469
829 Ga0373931_0286296
830 Ga0373935_0461876
831 Ga0373937_1654429
832 Ga0316582_0872138
833 Ga0316584_0027875
834 Ga0436365_0314718
835 Ga0436365_0358756
836 Ga0436365_0807260
837 Ga0436365_1133998
838 Ga0436365_1160606
839 Ga0436365_1600695
840 Ga0436365_1613638
841 Ga0436360_0276818
842 Ga0436363_0380129
843 Ga0436363_0900687
844 Ga0436362_1098241
845 Ga0436362_1174211
846 Ga0451793_1914378
847 Ga0451800_0935723
848 Ga0451839_0898856
849 Ga0451847_0251992
850 Ga0451851_0880222
851 Ga0451853_1260989
852 Ga0451853_1408945
853 Ga0450918_006283
854 Ga0466968_0211613
855 Ga0466967_0677529
856 Ga0495603_0323225
857 Ga0495603_0559872
858 Ga0495603_0582159
859 Ga0495629_0895034
860 Ga0495641_0496769
861 Ga0495651_0825641
862 Ga0495584_0221069
863 Ga0495608_0582094
864 Ga0495608_0671702
865 Ga0495628_0432601
866 Ga0495628_0858147
867 Ga0495630_0059194
868 Ga0495630_0713841
869 Ga0495644_0358221
870 Ga0495663_0319298
871 Ga0495633_0440631
872 Ga0495667_0241034
873 Ga0495588_0645896
874 Ga0495657_0031514
875 Ga0495613_0721178
876 Ga0495604_0058957
877 Ga0495604_0858678
878 Ga0495674_0605120
879 Ga0495676_0095999
880 Ga0495676_0770154
881 Ga0495593_0304522
882 Ga0495602_0257305
883 Ga0496100_0024417
884 Ga0496100_0176133
885 Ga0496100_0859270
886 Ga0496101_0038966
887 Ga0496101_0085425
888 Ga0496101_0111125
889 Ga0496101_1548891
890 Ga0496102_0065932
891 Ga0496102_0123122
892 Ga0496102_0166658
893 Ga0496102_0214993
894 Ga0496102_0334564
895 Ga0496102_0494599
896 Ga0496102_0510640
897 Ga0496102_1004927
898 Ga0496102_1803431
899 Ga0496103_0071310
900 Ga0496103_0205005
901 Ga0496103_0696411
902 Ga0496104_0055665
903 Ga0496104_0066019
904 Ga0496104_0154862
905 Ga0496104_0214621
906 Ga0496104_0397812
907 Ga0496104_1535117
908 Ga0496105_0018149
909 Ga0496105_0026210
910 Ga0496105_0159178
911 Ga0496105_0547953
912 Ga0496105_0616799
913 Ga0496105_0858290
914 Ga0496106_0159814
915 Ga0496106_0338271
916 Ga0496107_0134158
917 Ga0496107_0197929
918 Ga0496108_0189430
919 Ga0496108_0213462
920 Ga0496108_0302346
921 Ga0496108_0375573
922 Ga0496108_1412086
923 Ga0496109_0155413
924 Ga0496109_0229635
925 Ga0496109_0331834
926 Ga0496109_0384227
927 Ga0496109_0849742
928 Ga0496109_1405649
929 Ga0496110_0022032
930 Ga0496110_0028462
931 Ga0496110_0080750
932 Ga0496110_0208518
933 Ga0496110_0346296
934 Ga0496110_0445219
935 Ga0496110_0563379
936 Ga0496111_0012961
937 Ga0496111_0025925
938 Ga0496111_0923057
939 Ga0496112_0024770
940 Ga0496112_0524306
941 Ga0496112_1419634
942 Ga0496112_1584819
943 Ga0496113_1569541
944 Ga0496114_0026744
945 Ga0496114_0039295
946 Ga0496114_0094997
947 Ga0496114_0217255
948 Ga0496114_0250125
949 Ga0496114_0472147
950 Ga0496114_0834893
951 Ga0496114_0885899
952 Ga0496114_0921804
953 Ga0496114_1283475
954 Ga0496115_0002829
955 Ga0496115_0278279
956 Ga0496115_1054694
957 Ga0501031_0041160
958 Ga0501031_0075744
959 Ga0501031_0248512
960 Ga0501031_0785266
961 Ga0501034_1620670
962 Ga0501036_0008752
963 Ga0501036_0067345
964 Ga0501036_0092876
965 Ga0501036_0252337
966 Ga0501036_0274613
967 Ga0501036_0660089
968 Ga0501036_0907686
969 Ga0501036_1371223
970 Ga0501038_0075547
971 Ga0501038_0250783
972 Ga0501038_0835410
973 Ga0501039_0152842
974 Ga0501039_0462843
975 Ga0501039_0489101
976 Ga0501040_0029963
977 Ga0501040_0081168
978 Ga0501040_0201005
979 Ga0501040_0495666
980 Ga0501041_0022861
981 Ga0501041_0186702
982 Ga0501041_0250306
983 Ga0501042_0039541
984 Ga0501042_0113974
985 Ga0501042_0419987
986 Ga0501043_0355796
987 Ga0501046_0221121
988 Ga0501048_0149572
989 Ga0501048_0168156
990 Ga0501048_0544567
991 Ga0501048_1138149
992 Ga0501068_0310510
993 Ga0501068_0404203
994 Ga0501068_0928377
995 Ga0501069_0212198
996 Ga0501069_0410575
997 Ga0501070_1032911
998 Ga0501071_0014916
999 Ga0501071_0047334
1000 Ga0501071_0108273
1001 Ga0501071_0137793
1002 Ga0501071_0157494
1003 Ga0501072_0003014
1004 Ga0501072_0012644
1005 Ga0501072_0289217
1006 Ga0501072_0364087
1007 Ga0501072_0753084
1008 Ga0501073_0090515
1009 Ga0501074_0410913
1010 Ga0501074_1145619
1011 Ga0501074_1335204
1012 Ga0501075_0042298
1013 Ga0501075_0071474
1014 Ga0501075_0350055
1015 Ga0501075_0704656
1016 Ga0501075_0920829
1017 Ga0501076_0013459
1018 Ga0501076_0016786
1019 Ga0501076_0038060
1020 Ga0501076_0147997
1021 Ga0501076_0224010
1022 Ga0501076_1240974
1023 Ga0501079_0010268
1024 Ga0501079_0312653
1025 Ga0501079_0550765
1026 Ga0501079_1281296
1027 Ga0501080_0339866
1028 Ga0501080_1366564
1029 Ga0501081_0022061
1030 Ga0501081_0128251
1031 Ga0501081_0795234
1032 Ga0501081_1120004
1033 Ga0501081_1157904
1034 Ga0501083_0426063
1035 Ga0501083_0621378
1036 Ga0501035_0175651
1037 Ga0501035_1511427
1038 Ga0501044_1681889
1039 Ga0501045_0014183
1040 Ga0501045_0034894
1041 Ga0501045_0037134
1042 Ga0501045_0105880
1043 Ga0501045_0156892
1044 Ga0501045_0329008
1045 Ga0501045_0511087
1046 nmdc:mga03n38_19895_c1
1047 nmdc:mga03n38_201852_c1
1048 nmdc:mga0yw44_444097_c1
1049 nmdc:mga0yw44_530218_c1
1050 nmdc:mga0yw44_656283_c1
1051 nmdc:mga0yw44_770945_c1
1052 nmdc:mga06z11_357857_c1
1053 nmdc:mga06z11_824227_c1
1054 nmdc:mga05p37_1211594_c1
1055 nmdc:mga05p37_134666_c1
1056 nmdc:mga05p37_350836_c1
1057 nmdc:mga05p37_466762_c1
1058 nmdc:mga05p37_608722_c1
1059 nmdc:mga05p37_613784_c1
1060 nmdc:mga05p37_673167_c1
1061 nmdc:mga05p37_88808_c1
1062 nmdc:mga09592_20918_c1
1063 nmdc:mga0qj67_222626_c1
1064 nmdc:mga0qj67_41604_c1
1065 nmdc:mga0qj67_464612_c1
1066 nmdc:mga0qj67_558695_c1
1067 nmdc:mga0qj67_7151_c1
1068 nmdc:mga0qj67_84978_c1
1069 nmdc:mga06r32_1865561_c1
1070 nmdc:mga06r32_2006973_c1
1071 nmdc:mga06r32_302277_c1
1072 nmdc:mga06r32_425071_c1
1073 nmdc:mga06r32_49790_c1
1074 nmdc:mga06r32_586910_c1
1075 nmdc:mga08y16_1084872_c1
1076 nmdc:mga08y16_1939273_c1
1077 nmdc:mga0n895_9349_c1
1078 nmdc:mga0rr50_35692_c1
1079 nmdc:mga0a205_37399_c1
1080 Ga0495601_0058597
1081 Ga0495601_0367476
1082 Ga0495601_0391168
1083 Ga0495612_0013692
1084 Ga0495595_0244630
1085 Ga0495619_0064289
1086 Ga0495619_1120976
1087 Ga0500628_134637
1088 Ga0500616_0000692
1089 Ga0501084_0000020
1090 Ga0501084_0014435
1091 Ga0501084_0016280
1092 Ga0501084_0279705
1093 Ga0501084_0445200
1094 Ga0501084_0830413
1095 Ga0501082_0013128
1096 Ga0501082_0198438
1097 Ga0501082_0201812
1098 Ga0501082_1323425
1099 Ga0530510_0047914
1100 Ga0530510_0158151
1101 Ga0530510_0866875
1102 Ga0530510_0878880

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02625

XdhC_CoxI

XdhC and CoxI family

26

94

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
2we7-assembly1.cif.gz_A-2 crystal structure of mycobacterium tuberculosis rv0376c homologue from mycobacterium smegmatis 0.8888 2 102
2we8-assembly1.cif.gz_A-2 crystal structure of mycobacterium tuberculosis rv0376c homologue from mycobacterium smegmatis 0.86 2 102
3on5-assembly1.cif.gz_B crystal structure of a xanthine dehydrogenase (bh1974) from bacillus halodurans at 2.80 a resolution 0.8461 8 103
2we7-assembly2.cif.gz_B-3 crystal structure of mycobacterium tuberculosis rv0376c homologue from mycobacterium smegmatis 0.8301 2 102
2we8-assembly2.cif.gz_B-3 crystal structure of mycobacterium tuberculosis rv0376c homologue from mycobacterium smegmatis 0.8244 1 102
ID Description Score Start End Superfamily
af_O73878_199_258_2.60.40.1770 Mainly Beta;Sandwich;Immunoglobulin-like;ephrin a2 ectodomain 0.5263 18 48 2.60.40.1770
af_Q4DBH4_470_621_3.90.70.10 Alpha Beta;Alpha-Beta Complex;Cathepsin B; Chain A;Cysteine proteinases 0.5148 3 40 3.90.70.10
3a0sA00 Alpha Beta;2-Layer Sandwich;Beta-Lactamase;PAS domain 0.5041 57 98 3.30.450.20
1sh8B00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.491 18 102 3.10.129.10
af_A0A1D6N0L5_10_146_2.60.40.150 Mainly Beta;Sandwich;Immunoglobulin-like;C2 domain 0.4638 28 103 2.60.40.150
ID Description Score Start End GO Terms
AF-A0A7V4Y145-F1-model_v4 XdhC/CoxI family protein 0.9252 6 101
AF-A0A5R9IZM1-F1-model_v4 XdhC family protein 0.9171 10 104
AF-A0A2D7C4P5-F1-model_v4 XdhC/CoxI family protein 0.9169 2 103
AF-X1L1G6-F1-model_v4 XdhC- CoxI domain-containing protein 0.9168 10 102
AF-A0A6B0W5K4-F1-model_v4 XdhC family protein 0.9154 4 104

Map