F462497

General Info

Members Datasets Scaffolds Average Seq Length
550 311 1100 248

Family's Representative Sequence

Representative Sequence 3300014325|Ga0163163_10117813|Ga0163163_101178132
Length 300
Sequence VLVEERLAVARAQDRELAVGERHHLLDEIHRASGYAPLAAGIRRAAGRLGRVLGLPDDIEACLFDLDGVLTKTAEVHAAAWKSMFDGYLRRRADRTGEPFVAFDAGADYDEYVDGKPRYDGVRSFLASRGIHLPDGTPDDDPGTETIDGLGNRKNDLVLELIARDGVDAYEGSVRYVRAARDAGLRRAVVSSSSNCRDVLEAAGILDLFEEIVDGVVATREGLKGKPAPDTFLAGARRLGVDPARAAVFEDAVAGVEAGRAGGFGCVVGVDRVGHADALRAHGADLVVRDLAELLDGAGA

Samples

Sample ID Description Type Environment
1 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
2 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
14 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
15 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
16 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
17 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
18 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
19 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
20 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
21 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
22 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
23 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
24 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
25 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
26 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
27 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
28 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
29 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
30 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
31 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
32 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
33 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
34 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
35 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
36 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
37 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
38 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
39 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
40 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
41 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
42 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
43 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
44 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
45 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
46 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
47 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
48 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
49 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
50 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
51 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
52 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
53 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
54 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
55 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
56 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
57 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
58 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
59 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
60 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
61 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
62 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
63 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
64 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
65 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
66 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
67 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
68 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
69 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
70 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
71 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
72 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
73 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
74 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
75 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
76 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
77 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
78 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
79 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
80 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
81 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
82 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
83 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
84 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
85 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
86 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
87 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
88 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
89 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
90 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
91 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
92 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
93 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
94 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
95 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
96 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
97 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
98 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
99 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
100 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
101 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
102 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
151 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
154 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
155 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
156 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
157 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
158 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
159 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
160 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
161 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
162 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
163 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
164 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
165 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
166 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
167 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
168 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
169 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
170 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
171 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
172 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
173 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
174 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
175 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
176 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
177 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
178 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
179 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
180 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
181 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
182 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
183 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
184 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
185 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
186 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
187 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
188 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
189 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
190 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
191 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
192 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
193 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
194 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
195 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
196 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
197 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
198 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
199 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
200 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
201 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
202 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
203 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
204 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
205 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
206 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
207 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
208 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
209 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
210 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
211 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
212 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
213 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
214 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
215 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
216 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
217 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
218 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
219 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
220 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
221 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
222 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
223 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
224 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
225 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
226 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
227 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
228 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
229 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
230 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
231 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
232 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
233 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
234 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
235 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
236 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
237 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
238 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
239 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
240 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
241 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
242 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
243 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
244 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
245 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
246 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
247 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
248 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
249 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
250 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
251 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
252 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
253 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
254 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
255 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
256 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
257 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
258 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
259 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
260 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
261 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
262 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
263 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
264 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
265 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
266 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
267 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
268 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
269 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
270 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
271 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
272 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
273 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
274 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
275 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
276 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
277 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
278 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
279 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
280 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
281 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
282 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
283 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
284 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
285 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
286 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
287 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
288 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
289 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
290 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
291 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
292 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
293 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
294 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
295 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
296 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
297 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
298 2643221601 Kitasatospora sp. Root187 Isolate Unclassified
299 2643221631 Kitasatospora sp. Root107 Isolate Unclassified
300 2791355406 Streptomyces rhizosphaericus NRRL B-24304 Isolate Unclassified
301 2818991472 Kitasatospora viridis DSM 44826 Isolate Rhizosphere
302 2837268691 Jiangella endophytica KE2-3 Isolate Rhizosphere
303 2891395885 Microbispora catharanthi CR1-09 Isolate Unclassified
304 2891554331 Microbispora sp. CL1-1 Isolate Unclassified
305 2912715099 Streptomyces sp. Z423-1 Isolate Rhizosphere
306 8025530807 Streptomyces sp. 4R-3d Isolate Unclassified
307 8047893842 Streptomyces cangkringensis DSM 41769 Isolate Rhizosphere
308 8048127548 Streptomyces samsunensis DSM 42010 Isolate Rhizosphere
309 8048369669 Streptomyces indonesiensis DSM 41759 Isolate Rhizoplane
310 8048379754 Streptomyces asiaticus DSM 41761 Isolate Rhizosphere
311 8055172936 Sphaerisporangium perillae NEAU-ZS1 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 96.91
Metatranscriptomes 0.55
Isolates 2.55

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 6.91
Rhizosphere 90.18
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0163163_10117813 3300014325 Bacteria 2688
2 JGI25407J50210_10010822 3300003373 Bacteria 2326
3 Ga0070658_10080161 3300005327 Bacteria 2681
4 Ga0070683_100070734 3300005329 Bacteria 3255
5 Ga0070690_100074496 3300005330 Bacteria 2211
6 Ga0070670_100095983 3300005331 Bacteria 2550
7 Ga0068869_100006577 3300005334 Bacteria 7374
8 Ga0070666_10221127 3300005335 Bacteria 1336
9 Ga0070680_100018412 3300005336 Bacteria 5518
10 Ga0070680_100119015 3300005336 Bacteria 2203
11 Ga0070680_100139256 3300005336 Bacteria 2034
12 Ga0070682_100005835 3300005337 Bacteria 6877
13 Ga0070682_100013867 3300005337 Bacteria 4647
14 Ga0068868_100004884 3300005338 Bacteria 9410
15 Ga0068868_100024864 3300005338 Bacteria 4548
16 Ga0070660_100203196 3300005339 Bacteria 1607
17 Ga0070689_100018502 3300005340 Bacteria 5134
18 Ga0070689_100244776 3300005340 Bacteria 1478
19 Ga0070691_10003766 3300005341 Bacteria 6855
20 Ga0070691_10050195 3300005341 Bacteria 1990
21 Ga0070661_100027044 3300005344 Bacteria 4129
22 Ga0070661_100601988 3300005344 Bacteria 889
23 Ga0070692_10022500 3300005345 Bacteria 3079
24 Ga0070671_100018515 3300005355 Bacteria 5658
25 Ga0070688_100117747 3300005365 Bacteria 1775
26 Ga0070659_100102747 3300005366 Bacteria 2301
27 Ga0070659_100599069 3300005366 Bacteria 947
28 Ga0070714_100064727 3300005435 Bacteria 3148
29 Ga0070714_100391797 3300005435 Bacteria 1311
30 Ga0070714_100729917 3300005435 Bacteria 957
31 Ga0070713_100014145 3300005436 Bacteria 5913
32 Ga0070713_100357968 3300005436 Bacteria 1355
33 Ga0070710_10003864 3300005437 Bacteria 7090
34 Ga0070710_10020977 3300005437 Bacteria 3398
35 Ga0070710_10162109 3300005437 Bacteria 1387
36 Ga0070711_100007143 3300005439 Bacteria 6778
37 Ga0070711_100203991 3300005439 Bacteria 1527
38 Ga0070705_100009983 3300005440 Bacteria 4739
39 Ga0070705_100066424 3300005440 Bacteria 2162
40 Ga0070705_100105660 3300005440 Bacteria 1788
41 Ga0070700_100133084 3300005441 Bacteria 1680
42 Ga0070708_100005813 3300005445 Bacteria 9792
43 Ga0070708_100110006 3300005445 Bacteria 2532
44 Ga0070708_100196955 3300005445 Bacteria 1885
45 Ga0070663_100005762 3300005455 Bacteria 7390
46 Ga0070678_100013722 3300005456 Bacteria 5091
47 Ga0070678_100123044 3300005456 Bacteria 2049
48 Ga0070681_10012788 3300005458 Bacteria 8331
49 Ga0070681_10042947 3300005458 Bacteria 4530
50 Ga0070681_10066849 3300005458 Bacteria 3563
51 Ga0068867_100212092 3300005459 Bacteria 1556
52 Ga0070685_10008932 3300005466 Bacteria 5170
53 Ga0070706_100005602 3300005467 Bacteria 11950
54 Ga0070706_100347273 3300005467 Bacteria 1383
55 Ga0070707_100064883 3300005468 Bacteria 3507
56 Ga0070707_100195501 3300005468 Bacteria 1972
57 Ga0070707_100740996 3300005468 Bacteria 946
58 Ga0070698_100055868 3300005471 Bacteria 4001
59 Ga0070699_100027567 3300005518 Bacteria 4899
60 Ga0070699_100130945 3300005518 Bacteria 2211
61 Ga0070679_100041106 3300005530 Bacteria 4603
62 Ga0070679_100563244 3300005530 Bacteria 1083
63 Ga0070684_100024015 3300005535 Bacteria 5109
64 Ga0070697_100120154 3300005536 Bacteria 2197
65 Ga0068853_100056916 3300005539 Bacteria 3373
66 Ga0070696_100060262 3300005546 Bacteria 2654
67 Ga0070696_100102252 3300005546 Bacteria 2055
68 Ga0070696_100445165 3300005546 Bacteria 1021
69 Ga0070693_100000306 3300005547 Bacteria 22765
70 Ga0070693_100085217 3300005547 Bacteria 1893
71 Ga0070665_100332871 3300005548 Bacteria 1523
72 Ga0070704_100094493 3300005549 Bacteria 2237
73 Ga0070704_100630308 3300005549 Bacteria 945
74 Ga0068855_100066948 3300005563 Bacteria 4187
75 Ga0068855_100100171 3300005563 Bacteria 3336
76 Ga0068857_100173899 3300005577 Bacteria 1958
77 Ga0068854_100117981 3300005578 Bacteria 2010
78 Ga0068856_100029467 3300005614 Bacteria 5361
79 Ga0068856_100029559 3300005614 Bacteria 5353
80 Ga0068856_100094756 3300005614 Bacteria 2972
81 Ga0068856_100096928 3300005614 Bacteria 2938
82 Ga0068856_100144842 3300005614 Bacteria 2383
83 Ga0070702_100007509 3300005615 Bacteria 5223
84 Ga0070702_100103769 3300005615 Bacteria 1749
85 Ga0068852_100030241 3300005616 Bacteria 4456
86 Ga0068852_100274228 3300005616 Bacteria 1624
87 Ga0068852_100482037 3300005616 Bacteria 1233
88 Ga0068859_100020428 3300005617 Bacteria 6647
89 Ga0068859_100793209 3300005617 Bacteria 1035
90 Ga0068864_100034550 3300005618 Bacteria 4301
91 Ga0068864_100195559 3300005618 Bacteria 1855
92 Ga0068864_100213679 3300005618 Bacteria 1777
93 Ga0068864_100247582 3300005618 Bacteria 1653
94 Ga0068866_10105762 3300005718 Bacteria 1561
95 Ga0068861_100111046 3300005719 Bacteria 2196
96 Ga0068851_10009485 3300005834 Bacteria 4528
97 Ga0068870_10002514 3300005840 Bacteria 7656
98 Ga0068863_100003223 3300005841 Bacteria 16160
99 Ga0068863_100262261 3300005841 Bacteria 1671
100 Ga0068858_100433977 3300005842 Bacteria 1264
101 Ga0068860_100029995 3300005843 Bacteria 5230
102 Ga0068860_100107141 3300005843 Bacteria 2670
103 Ga0081455_10010186 3300005937 Bacteria 9570
104 Ga0081455_10042340 3300005937 Bacteria 3996
105 Ga0081538_10000068 3300005981 Bacteria 97659
106 Ga0081538_10000170 3300005981 Bacteria 69585
107 Ga0081538_10042005 3300005981 Bacteria 2892
108 Ga0081538_10087612 3300005981 Bacteria 1624
109 Ga0070717_10001051 3300006028 Bacteria 18527
110 Ga0070717_10253337 3300006028 Bacteria 1556
111 Ga0070717_10519234 3300006028 Bacteria 1077
112 Ga0070715_10042110 3300006163 Bacteria 1918
113 Ga0070712_100001049 3300006175 Bacteria 16689
114 Ga0070712_100069697 3300006175 Bacteria 2509
115 Ga0097621_100110798 3300006237 Bacteria 2319
116 Ga0097621_100448984 3300006237 Bacteria 1161
117 Ga0068871_100004996 3300006358 Bacteria 9268
118 Ga0068871_100015891 3300006358 Bacteria 5651
119 Ga0075428_100004816 3300006844 Bacteria 14970
120 Ga0075430_100004876 3300006846 Bacteria 11292
121 Ga0075431_100003839 3300006847 Bacteria 14608
122 Ga0075431_100323929 3300006847 Bacteria 1553
123 Ga0075431_100762704 3300006847 Bacteria 942
124 Ga0075431_100805381 3300006847 Bacteria 912
125 Ga0075433_10010897 3300006852 Bacteria 7313
126 Ga0075433_10032104 3300006852 Bacteria 4495
127 Ga0075433_10154465 3300006852 Bacteria 2042
128 Ga0075434_100005314 3300006871 Bacteria 11712
129 Ga0075434_100011008 3300006871 Bacteria 8509
130 Ga0075434_100231934 3300006871 Bacteria 1865
131 Ga0075434_100361808 3300006871 Bacteria 1472
132 Ga0068865_100221061 3300006881 Bacteria 1481
133 Ga0075436_100010760 3300006914 Bacteria 6275
134 Ga0075436_100077017 3300006914 Bacteria 2310
135 Ga0097620_100020425 3300006931 Bacteria 6647
136 Ga0097620_100793379 3300006931 Bacteria 1035
137 Ga0075435_100003771 3300007076 Bacteria 10333
138 Ga0075435_100094727 3300007076 Bacteria 2468
139 Ga0105251_10048749 3300009011 Bacteria 2029
140 Ga0111539_10048677 3300009094 Bacteria 5060
141 Ga0111539_10067799 3300009094 Bacteria 4213
142 Ga0111539_10152519 3300009094 Bacteria 2704
143 Ga0105245_10498412 3300009098 Bacteria 1234
144 Ga0105245_10732316 3300009098 Bacteria 1024
145 Ga0114129_10016178 3300009147 Bacteria 10615
146 Ga0114129_10099444 3300009147 Bacteria 4026
147 Ga0114129_10632621 3300009147 Bacteria 1383
148 Ga0114129_10990211 3300009147 Bacteria 1059
149 Ga0105241_10033351 3300009174 Bacteria 3865
150 Ga0105242_10336156 3300009176 Bacteria 1390
151 Ga0105248_10444551 3300009177 Bacteria 1461
152 Ga0105237_10058707 3300009545 Bacteria 3850
153 Ga0105238_10020827 3300009551 Bacteria 6679
154 Ga0105238_10078134 3300009551 Bacteria 3300
155 Ga0105239_10161927 3300010375 Bacteria 2500
156 Ga0105239_10337410 3300010375 Bacteria 1701
157 Ga0105239_10656383 3300010375 Bacteria 1198
158 Ga0105246_10039447 3300011119 Bacteria 3181
159 Ga0157373_10318518 3300013100 Bacteria 1106
160 Ga0157370_10181277 3300013104 Bacteria 1957
161 Ga0157369_10132753 3300013105 Bacteria 2638
162 Ga0157374_10019428 3300013296 Bacteria 6013
163 Ga0157374_10075842 3300013296 Bacteria 3178
164 Ga0163162_10077014 3300013306 Bacteria 3398
165 Ga0157372_10022192 3300013307 Bacteria 6867
166 Ga0157372_10505522 3300013307 Bacteria 1409
167 Ga0157372_10828152 3300013307 Bacteria 1075
168 Ga0157372_10852402 3300013307 Bacteria 1058
169 Ga0157372_10910279 3300013307 Bacteria 1020
170 Ga0157375_10092258 3300013308 Bacteria 3092
171 Ga0157375_10094840 3300013308 Bacteria 3053
172 Ga0163163_10031608 3300014325 Bacteria 5110
173 Ga0163163_10233919 3300014325 Bacteria 1887
174 Ga0163163_10632358 3300014325 Bacteria 1134
175 Ga0157380_10056292 3300014326 Bacteria 3127
176 Ga0157380_10269478 3300014326 Bacteria 1551
177 Ga0157380_11222771 3300014326 Bacteria 796
178 Ga0182008_10031644 3300014497 Bacteria 2662
179 Ga0157377_10028676 3300014745 Bacteria 2998
180 Ga0157377_10398312 3300014745 Bacteria 937
181 Ga0157379_10002352 3300014968 Bacteria 15781
182 Ga0157379_10039388 3300014968 Bacteria 4217
183 Ga0157379_10326627 3300014968 Bacteria 1401
184 Ga0157376_10017375 3300014969 Bacteria 5486
185 Ga0206354_11116139 3300020081 Bacteria 1066
186 Ga0206353_10695326 3300020082 Bacteria 4235
187 Ga0206353_11570503 3300020082 Bacteria 1399
188 Ga0213875_10000628 3300021388 Bacteria 28179
189 Ga0213871_10071413 3300021441 Bacteria 982
190 Ga0207692_10016813 3300025898 Bacteria 3248
191 Ga0207692_10068679 3300025898 Bacteria 1859
192 Ga0207710_10011296 3300025900 Bacteria 3760
193 Ga0207688_10008601 3300025901 Bacteria 5557
194 Ga0207680_10052984 3300025903 Bacteria 2434
195 Ga0207685_10084824 3300025905 Bacteria 1320
196 Ga0207699_10020979 3300025906 Bacteria 3512
197 Ga0207699_10024277 3300025906 Bacteria 3313
198 Ga0207699_10053522 3300025906 Bacteria 2393
199 Ga0207645_10100451 3300025907 Bacteria 1866
200 Ga0207643_10001058 3300025908 Bacteria 16263
201 Ga0207643_10035461 3300025908 Bacteria 2798
202 Ga0207705_10001017 3300025909 Bacteria 22738
203 Ga0207705_10003565 3300025909 Bacteria 11852
204 Ga0207705_10325148 3300025909 Bacteria 1182
205 Ga0207684_10065107 3300025910 Bacteria 3095
206 Ga0207684_10109225 3300025910 Bacteria 2367
207 Ga0207654_10122400 3300025911 Bacteria 1636
208 Ga0207707_10097036 3300025912 Bacteria 2575
209 Ga0207707_10111241 3300025912 Bacteria 2394
210 Ga0207707_10403689 3300025912 Bacteria 1173
211 Ga0207693_10069100 3300025915 Bacteria 2765
212 Ga0207693_10089164 3300025915 Bacteria 2417
213 Ga0207693_10353814 3300025915 Bacteria 1149
214 Ga0207663_10017351 3300025916 Bacteria 4009
215 Ga0207663_10096656 3300025916 Bacteria 1973
216 Ga0207663_10131989 3300025916 Bacteria 1727
217 Ga0207663_10230056 3300025916 Bacteria 1354
218 Ga0207660_10024112 3300025917 Bacteria 4115
219 Ga0207660_10033405 3300025917 Bacteria 3559
220 Ga0207657_10134874 3300025919 Bacteria 2021
221 Ga0207649_10003680 3300025920 Bacteria 8365
222 Ga0207652_10050945 3300025921 Bacteria 3548
223 Ga0207646_10004857 3300025922 Bacteria 14401
224 Ga0207646_10005524 3300025922 Bacteria 13291
225 Ga0207646_10138615 3300025922 Bacteria 2190
226 Ga0207646_10347337 3300025922 Bacteria 1341
227 Ga0207694_10026388 3300025924 Bacteria 4418
228 Ga0207650_10003121 3300025925 Bacteria 11414
229 Ga0207659_10090821 3300025926 Bacteria 2280
230 Ga0207687_10025056 3300025927 Bacteria 3991
231 Ga0207687_10081498 3300025927 Bacteria 2339
232 Ga0207700_10041490 3300025928 Bacteria 3367
233 Ga0207700_10243973 3300025928 Bacteria 1532
234 Ga0207700_10358748 3300025928 Bacteria 1271
235 Ga0207664_10083341 3300025929 Bacteria 2606
236 Ga0207664_10206681 3300025929 Bacteria 1697
237 Ga0207644_10138813 3300025931 Bacteria 1869
238 Ga0207706_10065737 3300025933 Bacteria 3193
239 Ga0207686_10054553 3300025934 Bacteria 2504
240 Ga0207709_10226824 3300025935 Bacteria 1351
241 Ga0207691_10524830 3300025940 Bacteria 1005
242 Ga0207711_10308055 3300025941 Bacteria 1462
243 Ga0207689_10011323 3300025942 Bacteria 7652
244 Ga0207661_10004511 3300025944 Bacteria 9756
245 Ga0207661_10055852 3300025944 Bacteria 3168
246 Ga0207661_10283394 3300025944 Bacteria 1481
247 Ga0207679_10004746 3300025945 Bacteria 8464
248 Ga0207679_10093059 3300025945 Bacteria 2336
249 Ga0207679_10351160 3300025945 Bacteria 1286
250 Ga0207679_10524791 3300025945 Bacteria 1059
251 Ga0207679_10593042 3300025945 Bacteria 998
252 Ga0207667_10066851 3300025949 Bacteria 3746
253 Ga0207667_10225738 3300025949 Bacteria 1919
254 Ga0207651_10084385 3300025960 Bacteria 2300
255 Ga0207677_10007176 3300026023 Bacteria 6138
256 Ga0207677_10018299 3300026023 Bacteria 4201
257 Ga0207703_10036186 3300026035 Bacteria 3927
258 Ga0207703_10107269 3300026035 Bacteria 2377
259 Ga0207703_10263933 3300026035 Bacteria 1557
260 Ga0207639_10094440 3300026041 Bacteria 2401
261 Ga0207678_10000891 3300026067 Bacteria 27453
262 Ga0207708_10125490 3300026075 Bacteria 2003
263 Ga0207708_10210941 3300026075 Bacteria 1552
264 Ga0207702_10000901 3300026078 Bacteria 30858
265 Ga0207702_10021361 3300026078 Bacteria 5358
266 Ga0207702_10030182 3300026078 Bacteria 4517
267 Ga0207702_10205331 3300026078 Bacteria 1829
268 Ga0207702_10836395 3300026078 Bacteria 911
269 Ga0207641_10017212 3300026088 Bacteria 5914
270 Ga0207641_10084024 3300026088 Bacteria 2770
271 Ga0207641_10170913 3300026088 Bacteria 1984
272 Ga0207648_10035876 3300026089 Bacteria 4369
273 Ga0207676_10000683 3300026095 Bacteria 26944
274 Ga0207674_10137081 3300026116 Bacteria 2408
275 Ga0207675_100057509 3300026118 Bacteria 3628
276 Ga0207683_10003187 3300026121 Bacteria 14313
277 Ga0207683_10026078 3300026121 Bacteria 5047
278 Ga0207683_10158496 3300026121 Bacteria 2045
279 Ga0207428_10032481 3300027907 Bacteria 4293
280 Ga0268266_10088490 3300028379 Bacteria 2710
281 Ga0268266_10290182 3300028379 Bacteria 1523
282 Ga0268264_10024573 3300028381 Bacteria 4919
283 Ga0268264_10084861 3300028381 Bacteria 2716
284 Ga0307508_10011504 3300031616 Bacteria 8083
285 Ga0307516_10112486 3300031730 Bacteria 2522
286 Ga0307416_100156860 3300032002 Bacteria 2097
287 Ga0307416_101394070 3300032002 Bacteria 807
288 Ga0307414_10133387 3300032004 Bacteria 1932
289 Ga0307414_10799779 3300032004 Bacteria 860
290 Ga0307415_100140710 3300032126 Bacteria 1843
291 Ga0307415_100182913 3300032126 Bacteria 1646
292 Ga0307415_100529214 3300032126 Bacteria 1036
293 Ga0373948_0004775 3300034817 Bacteria 2162
294 Ga0373958_0026897 3300034819 Bacteria 1104
295 Ga0373959_0038436 3300034820 Bacteria 995
296 Ga0373938_0018277 3300034957 Bacteria 1389
297 Ga0373926_0050070 3300035083 Bacteria 1505
298 Ga0373928_0007972 3300035084 Bacteria 2050
299 Ga0373929_0010831 3300035085 Bacteria 1710
300 Ga0373934_0001105 3300035086 Bacteria 9781
301 Ga0373949_0012949 3300035090 Bacteria 1848
302 Ga0373941_0004784 3300035115 Bacteria 3150
303 Ga0373953_0002361 3300035117 Bacteria 5690
304 Ga0373954_0062403 3300035118 Bacteria 1761
305 Ga0373956_0032820 3300035119 Bacteria 2280
306 Ga0373957_0009640 3300035120 Bacteria 3165
307 Ga0373943_0145643 3300035170 Bacteria 1280
308 Ga0373955_0048212 3300035172 Bacteria 2309
309 Ga0373955_0122813 3300035172 Bacteria 1511
310 Ga0373961_0009091 3300035241 Bacteria 2426
311 Ga0373924_0025682 3300035410 Bacteria 2329
312 Ga0373924_0045137 3300035410 Bacteria 1812
313 Ga0373933_0041395 3300035724 Bacteria 2719
314 Ga0373933_0059124 3300035724 Bacteria 2308
315 Ga0373947_0290587 3300035725 Bacteria 1088
316 Ga0373947_0329232 3300035725 Bacteria 1022
317 Ga0373937_0001190 3300036401 Bacteria 21823
318 Ga0373937_0071070 3300036401 Bacteria 3210
319 Ga0395899_0030325 3300037312 Bacteria 4068
320 Ga0395900_0035688 3300037418 Bacteria 5122
321 Ga0395900_0067887 3300037418 Bacteria 3663
322 Ga0395898_0008360 3300037466 Bacteria 10941
323 Ga0395898_0056170 3300037466 Bacteria 3838
324 Ga0395905_0006775 3300037471 Bacteria 11478
325 Ga0395905_0021427 3300037471 Bacteria 6111
326 Ga0436364_0433954 3300037853 Bacteria 9412
327 Ga0436364_0978060 3300037853 Bacteria 16954
328 Ga0395901_0005233 3300038443 Bacteria 13097
329 Ga0436365_1302682 3300039437 Bacteria 26309
330 Ga0436360_1196668 3300039438 Bacteria 1003
331 Ga0436363_0704632 3300039450 Bacteria 2735
332 Ga0436363_0908061 3300039450 Bacteria 2912
333 Ga0436363_1541826 3300039450 Bacteria 894
334 Ga0439448_0017804 3300042005 Bacteria 2173
335 Ga0439450_036685 3300042008 Bacteria 1123
336 Ga0439455_0046485 3300042012 Bacteria 1125
337 Ga0439463_030005 3300042016 Bacteria 1370
338 Ga0439434_0123895 3300042435 Bacteria 844
339 Ga0439459_0001945 3300042438 Bacteria 3135
340 Ga0439464_0017089 3300042439 Bacteria 1964
341 Ga0439460_0013761 3300042461 Bacteria 2121
342 Ga0466969_0003834 3300044656 Bacteria 7981
343 Ga0466966_0013499 3300044684 Bacteria 5408
344 Ga0466966_0050324 3300044684 Bacteria 2651
345 Ga0466961_0290543 3300044693 Bacteria 1000
346 Ga0466963_0071705 3300044694 Bacteria 2332
347 Ga0466963_0102585 3300044694 Bacteria 1959
348 Ga0466963_0190637 3300044694 Bacteria 1432
349 Ga0466963_0307155 3300044694 Bacteria 1116
350 Ga0466968_0016414 3300044735 Bacteria 2949
351 Ga0466968_0047661 3300044735 Bacteria 1823
352 Ga0466957_0220625 3300044842 Bacteria 1252
353 Ga0466960_0245608 3300044901 Bacteria 993
354 Ga0466959_0009292 3300045049 Bacteria 6987
355 Ga0466959_0356398 3300045049 Bacteria 997
356 Ga0466958_0082426 3300045836 Bacteria 1981
357 Ga0466958_0268923 3300045836 Bacteria 1092
358 Ga0466967_0069187 3300045976 Bacteria 3154
359 Ga0466967_0124246 3300045976 Bacteria 2389
360 Ga0466967_0434337 3300045976 Bacteria 1281
361 Ga0466967_0473482 3300045976 Bacteria 1226
362 Ga0495592_0002851 3300046454 Bacteria 12277
363 Ga0495592_0005189 3300046454 Bacteria 9605
364 Ga0495629_0011947 3300046459 Bacteria 6297
365 Ga0495651_0000097 3300046462 Bacteria 64676
366 Ga0495651_0072746 3300046462 Bacteria 2610
367 Ga0495653_0003612 3300046463 Bacteria 12475
368 Ga0495653_0065394 3300046463 Bacteria 2737
369 Ga0495653_0179824 3300046463 Bacteria 1453
370 Ga0495580_0333068 3300046472 Bacteria 1030
371 Ga0495582_0115666 3300046473 Bacteria 1508
372 Ga0495639_0194074 3300046475 Bacteria 992
373 Ga0495662_0022581 3300046476 Bacteria 3038
374 Ga0495662_0054163 3300046476 Bacteria 1937
375 Ga0495664_0198331 3300046477 Bacteria 1216
376 Ga0495584_0122715 3300046491 Bacteria 1316
377 Ga0495608_0001079 3300046511 Bacteria 19249
378 Ga0495608_0042576 3300046511 Bacteria 3036
379 Ga0495618_0001738 3300046514 Bacteria 14457
380 Ga0495618_0057911 3300046514 Bacteria 2454
381 Ga0495628_0001325 3300046516 Bacteria 22701
382 Ga0495628_0052437 3300046516 Bacteria 3222
383 Ga0495630_0012943 3300046517 Bacteria 6060
384 Ga0495652_0001520 3300046529 Bacteria 25446
385 Ga0495652_0319194 3300046529 Bacteria 1123
386 Ga0495640_0031662 3300046533 Bacteria 3772
387 Ga0495587_0000886 3300046536 Bacteria 19796
388 Ga0495587_0004508 3300046536 Bacteria 9157
389 Ga0495587_0066369 3300046536 Bacteria 2105
390 Ga0495587_0188056 3300046536 Bacteria 1170
391 Ga0495645_0000054 3300046543 Bacteria 84855
392 Ga0495667_0068859 3300046559 Bacteria 2310
393 Ga0495667_0166759 3300046559 Bacteria 1416
394 Ga0495634_0020038 3300046642 Bacteria 4745
395 Ga0495634_0105646 3300046642 Bacteria 1815
396 Ga0495635_0036941 3300046663 Bacteria 3382
397 Ga0495635_0191704 3300046663 Bacteria 1387
398 Ga0495635_0258834 3300046663 Bacteria 1172
399 Ga0495588_0049349 3300046674 Bacteria 2164
400 Ga0495657_0009152 3300046675 Bacteria 7523
401 Ga0495599_0000344 3300046678 Bacteria 27562
402 Ga0495599_0029928 3300046678 Bacteria 3416
403 Ga0495623_0000648 3300046679 Bacteria 23078
404 Ga0495623_0006424 3300046679 Bacteria 7645
405 Ga0495623_0023708 3300046679 Bacteria 3958
406 Ga0495646_0002610 3300046680 Bacteria 11117
407 Ga0495646_0023341 3300046680 Bacteria 3895
408 Ga0495600_0024581 3300046809 Bacteria 3879
409 Ga0495600_0041451 3300046809 Bacteria 3000
410 Ga0495600_0252986 3300046809 Bacteria 1120
411 Ga0495604_0000085 3300047317 Bacteria 81234
412 Ga0495604_0011089 3300047317 Bacteria 7153
413 Ga0495604_0012713 3300047317 Bacteria 6698
414 Ga0495604_0019462 3300047317 Bacteria 5433
415 Ga0495674_0186936 3300047319 Bacteria 1723
416 Ga0495674_0226869 3300047319 Bacteria 1542
417 Ga0495680_0002327 3300047322 Bacteria 19482
418 Ga0495680_0003888 3300047322 Bacteria 14454
419 Ga0495680_0011912 3300047322 Bacteria 7673
420 Ga0495675_0000041 3300047444 Bacteria 86087
421 Ga0495685_039107 3300047447 Bacteria 1624
422 Ga0495593_0041623 3300047673 Bacteria 2469
423 Ga0495593_0086095 3300047673 Bacteria 1621
424 Ga0495602_0004638 3300048088 Bacteria 14343
425 Ga0495602_0074190 3300048088 Bacteria 2892
426 Ga0496100_0208030 3300048903 Bacteria 1430
427 Ga0496101_0135156 3300048904 Bacteria 1876
428 Ga0496101_0265519 3300048904 Bacteria 1339
429 Ga0496102_0019332 3300048905 Bacteria 6000
430 Ga0496102_0607928 3300048905 Bacteria 1016
431 Ga0496104_0028734 3300048907 Bacteria 5154
432 Ga0496104_0037518 3300048907 Bacteria 4532
433 Ga0496104_0493593 3300048907 Bacteria 1135
434 Ga0496104_0522308 3300048907 Bacteria 1098
435 Ga0496105_0016078 3300048908 Bacteria 5969
436 Ga0496105_0087795 3300048908 Bacteria 2569
437 Ga0496106_0029958 3300048909 Bacteria 4057
438 Ga0496107_0012106 3300048910 Bacteria 6017
439 Ga0496108_0003437 3300048911 Bacteria 12700
440 Ga0496108_0004350 3300048911 Bacteria 11388
441 Ga0496108_0021673 3300048911 Bacteria 5282
442 Ga0496108_0376360 3300048911 Bacteria 1240
443 Ga0496109_0016940 3300048912 Bacteria 6379
444 Ga0496109_0036847 3300048912 Bacteria 4416
445 Ga0496109_0054801 3300048912 Bacteria 3636
446 Ga0496110_0016417 3300048913 Bacteria 6181
447 Ga0496110_0025324 3300048913 Bacteria 5069
448 Ga0496111_0001418 3300048914 Bacteria 13642
449 Ga0496111_0104508 3300048914 Bacteria 2083
450 Ga0496111_0129230 3300048914 Bacteria 1869
451 Ga0496112_0000666 3300048915 Bacteria 23915
452 Ga0496112_0068577 3300048915 Bacteria 3502
453 Ga0496112_0102600 3300048915 Bacteria 2830
454 Ga0496113_0007559 3300048916 Bacteria 7006
455 Ga0496113_0018994 3300048916 Bacteria 4800
456 Ga0496113_0111932 3300048916 Bacteria 2126
457 Ga0496114_0071901 3300048917 Bacteria 2908
458 Ga0496114_0195063 3300048917 Bacteria 1772
459 Ga0496115_0160869 3300048918 Bacteria 1855
460 Ga0496115_0214336 3300048918 Bacteria 1590
461 Ga0496115_0263675 3300048918 Bacteria 1416
462 Ga0496115_0553200 3300048918 Bacteria 919
463 Ga0501032_0002020 3300049569 Bacteria 15999
464 Ga0501033_0042158 3300049570 Bacteria 3402
465 Ga0501034_0001710 3300049571 Bacteria 28246
466 Ga0501034_0071863 3300049571 Bacteria 3469
467 Ga0501036_0066725 3300049572 Bacteria 3044
468 Ga0501037_0002748 3300049573 Bacteria 12733
469 Ga0501038_0002968 3300049574 Bacteria 15811
470 Ga0501038_0016782 3300049574 Bacteria 6630
471 Ga0501039_0046637 3300049575 Bacteria 3348
472 Ga0501039_0055362 3300049575 Bacteria 3071
473 Ga0501040_0043197 3300049576 Bacteria 3071
474 Ga0501041_0000956 3300049577 Bacteria 15712
475 Ga0501042_0021537 3300049578 Bacteria 4494
476 Ga0501043_0004488 3300049579 Bacteria 11336
477 Ga0501043_0068675 3300049579 Bacteria 2783
478 Ga0501046_0004028 3300049580 Bacteria 13408
479 Ga0501046_0076370 3300049580 Bacteria 2595
480 Ga0501047_0000550 3300049581 Bacteria 40442
481 Ga0501047_0005893 3300049581 Bacteria 11530
482 Ga0501047_0081819 3300049581 Bacteria 3104
483 Ga0501047_0214672 3300049581 Bacteria 1781
484 Ga0501048_0017060 3300049582 Bacteria 5351
485 Ga0501067_0001163 3300049583 Bacteria 14290
486 Ga0501068_0003502 3300049584 Bacteria 8471
487 Ga0501070_0025729 3300049586 Bacteria 4936
488 Ga0501071_0003463 3300049587 Bacteria 9859
489 Ga0501072_0001572 3300049588 Bacteria 17049
490 Ga0501074_0006093 3300049590 Bacteria 8706
491 Ga0501074_0041627 3300049590 Bacteria 3326
492 Ga0501076_0006629 3300049592 Bacteria 8399
493 Ga0501076_0128516 3300049592 Bacteria 2054
494 Ga0501077_0040296 3300049593 Bacteria 2976
495 Ga0501079_0135298 3300049741 Bacteria 1919
496 Ga0501080_0069525 3300049742 Bacteria 3274
497 Ga0501083_0003860 3300049744 Bacteria 10527
498 Ga0501035_0000285 3300049822 Bacteria 60115
499 Ga0501044_0001295 3300049823 Bacteria 29563
500 Ga0501045_0030615 3300049824 Bacteria 3895
501 nmdc:mga05p37_12097_c1 3300050507 Bacteria 10300
502 nmdc:mga05p37_191178_c1 3300050507 Bacteria 2485
503 nmdc:mga05p37_490557_c1 3300050507 Bacteria 1412
504 nmdc:mga0qj67_3662_c1 3300050509 Bacteria 11094
505 nmdc:mga06r32_13999_c1 3300050510 Bacteria 7274
506 nmdc:mga06r32_707666_c1 3300050510 Bacteria 973
507 nmdc:mga06r32_720811_c1 3300050510 Bacteria 962
508 nmdc:mga08y16_18973_c1 3300050511 Bacteria 7243
509 nmdc:mga08y16_495783_c1 3300050511 Bacteria 1241
510 nmdc:mga08y16_95895_c1 3300050511 Bacteria 3089
511 nmdc:mga0n895_15620_c1 3300050512 Bacteria 6932
512 nmdc:mga0n895_3095_c1 3300050512 Bacteria 13246
513 nmdc:mga0n895_35674_c1 3300050512 Bacteria 4796
514 nmdc:mga0n895_365519_c1 3300050512 Bacteria 1461
515 nmdc:mga0n895_68820_c1 3300050512 Bacteria 3507
516 nmdc:mga0rr50_512140_c1 3300050513 Bacteria 1021
517 nmdc:mga0rr50_7408_c1 3300050513 Bacteria 6766
518 nmdc:mga08x19_124560_c1 3300050514 Bacteria 1730
519 nmdc:mga0a205_25509_c1 3300050515 Bacteria 5632
520 nmdc:mga0a205_369999_c1 3300050515 Bacteria 1299
521 nmdc:mga0a205_73233_c1 3300050515 Bacteria 3310
522 nmdc:mga0a205_86464_c2 3300050515 Bacteria 1254
523 Ga0495601_0000385 3300053077 Bacteria 23352
524 Ga0495601_0159791 3300053077 Bacteria 1472
525 Ga0495612_0096589 3300053078 Bacteria 1255
526 Ga0495595_0005018 3300053084 Bacteria 5344
527 Ga0495595_0034544 3300053084 Bacteria 2287
528 Ga0495595_0037885 3300053084 Bacteria 2194
529 Ga0495619_0024438 3300053085 Bacteria 3876
530 Ga0495619_0025668 3300053085 Bacteria 3786
531 Ga0495619_0041146 3300053085 Bacteria 3022
532 Ga0495619_0104135 3300053085 Bacteria 1933
533 Ga0501084_0011789 3300054114 Bacteria 7235
534 Ga0501082_0002627 3300060353 Bacteria 15696
535 Ga0530510_0039620 3300061734 Bacteria 3402
536 Ga0530510_0073371 3300061734 Bacteria 2484
537 2644019356 2643221601 Bacteria 7493239
538 2644175256 2643221631 Bacteria 8168043
539 2793980927 2791355406 Bacteria 11364898
540 2819741304 2818991472 Bacteria 10089953
541 2837272282 2837268691 Bacteria 7850704
542 2891401108 2891395885 Bacteria 9251614
543 2891562438 2891554331 Bacteria 8812224
544 2912723831 2912715099 Bacteria 9460473
545 8025534982 8025530807 Bacteria 8495698
546 8047902851 8047893842 Bacteria 11723082
547 8048128888 8048127548 Bacteria 11053136
548 8048370648 8048369669 Bacteria 11666822
549 8048388774 8048379754 Bacteria 11877923
550 8055175582 8055172936 Bacteria 9305943
551 Ga0163163_10117813
552 JGI25407J50210_10010822
553 Ga0070658_10080161
554 Ga0070683_100070734
555 Ga0070690_100074496
556 Ga0070670_100095983
557 Ga0068869_100006577
558 Ga0070666_10221127
559 Ga0070680_100018412
560 Ga0070680_100119015
561 Ga0070680_100139256
562 Ga0070682_100005835
563 Ga0070682_100013867
564 Ga0068868_100004884
565 Ga0068868_100024864
566 Ga0070660_100203196
567 Ga0070689_100018502
568 Ga0070689_100244776
569 Ga0070691_10003766
570 Ga0070691_10050195
571 Ga0070661_100027044
572 Ga0070661_100601988
573 Ga0070692_10022500
574 Ga0070671_100018515
575 Ga0070688_100117747
576 Ga0070659_100102747
577 Ga0070659_100599069
578 Ga0070714_100064727
579 Ga0070714_100391797
580 Ga0070714_100729917
581 Ga0070713_100014145
582 Ga0070713_100357968
583 Ga0070710_10003864
584 Ga0070710_10020977
585 Ga0070710_10162109
586 Ga0070711_100007143
587 Ga0070711_100203991
588 Ga0070705_100009983
589 Ga0070705_100066424
590 Ga0070705_100105660
591 Ga0070700_100133084
592 Ga0070708_100005813
593 Ga0070708_100110006
594 Ga0070708_100196955
595 Ga0070663_100005762
596 Ga0070678_100013722
597 Ga0070678_100123044
598 Ga0070681_10012788
599 Ga0070681_10042947
600 Ga0070681_10066849
601 Ga0068867_100212092
602 Ga0070685_10008932
603 Ga0070706_100005602
604 Ga0070706_100347273
605 Ga0070707_100064883
606 Ga0070707_100195501
607 Ga0070707_100740996
608 Ga0070698_100055868
609 Ga0070699_100027567
610 Ga0070699_100130945
611 Ga0070679_100041106
612 Ga0070679_100563244
613 Ga0070684_100024015
614 Ga0070697_100120154
615 Ga0068853_100056916
616 Ga0070696_100060262
617 Ga0070696_100102252
618 Ga0070696_100445165
619 Ga0070693_100000306
620 Ga0070693_100085217
621 Ga0070665_100332871
622 Ga0070704_100094493
623 Ga0070704_100630308
624 Ga0068855_100066948
625 Ga0068855_100100171
626 Ga0068857_100173899
627 Ga0068854_100117981
628 Ga0068856_100029467
629 Ga0068856_100029559
630 Ga0068856_100094756
631 Ga0068856_100096928
632 Ga0068856_100144842
633 Ga0070702_100007509
634 Ga0070702_100103769
635 Ga0068852_100030241
636 Ga0068852_100274228
637 Ga0068852_100482037
638 Ga0068859_100020428
639 Ga0068859_100793209
640 Ga0068864_100034550
641 Ga0068864_100195559
642 Ga0068864_100213679
643 Ga0068864_100247582
644 Ga0068866_10105762
645 Ga0068861_100111046
646 Ga0068851_10009485
647 Ga0068870_10002514
648 Ga0068863_100003223
649 Ga0068863_100262261
650 Ga0068858_100433977
651 Ga0068860_100029995
652 Ga0068860_100107141
653 Ga0081455_10010186
654 Ga0081455_10042340
655 Ga0081538_10000068
656 Ga0081538_10000170
657 Ga0081538_10042005
658 Ga0081538_10087612
659 Ga0070717_10001051
660 Ga0070717_10253337
661 Ga0070717_10519234
662 Ga0070715_10042110
663 Ga0070712_100001049
664 Ga0070712_100069697
665 Ga0097621_100110798
666 Ga0097621_100448984
667 Ga0068871_100004996
668 Ga0068871_100015891
669 Ga0075428_100004816
670 Ga0075430_100004876
671 Ga0075431_100003839
672 Ga0075431_100323929
673 Ga0075431_100762704
674 Ga0075431_100805381
675 Ga0075433_10010897
676 Ga0075433_10032104
677 Ga0075433_10154465
678 Ga0075434_100005314
679 Ga0075434_100011008
680 Ga0075434_100231934
681 Ga0075434_100361808
682 Ga0068865_100221061
683 Ga0075436_100010760
684 Ga0075436_100077017
685 Ga0097620_100020425
686 Ga0097620_100793379
687 Ga0075435_100003771
688 Ga0075435_100094727
689 Ga0105251_10048749
690 Ga0111539_10048677
691 Ga0111539_10067799
692 Ga0111539_10152519
693 Ga0105245_10498412
694 Ga0105245_10732316
695 Ga0114129_10016178
696 Ga0114129_10099444
697 Ga0114129_10632621
698 Ga0114129_10990211
699 Ga0105241_10033351
700 Ga0105242_10336156
701 Ga0105248_10444551
702 Ga0105237_10058707
703 Ga0105238_10020827
704 Ga0105238_10078134
705 Ga0105239_10161927
706 Ga0105239_10337410
707 Ga0105239_10656383
708 Ga0105246_10039447
709 Ga0157373_10318518
710 Ga0157370_10181277
711 Ga0157369_10132753
712 Ga0157374_10019428
713 Ga0157374_10075842
714 Ga0163162_10077014
715 Ga0157372_10022192
716 Ga0157372_10505522
717 Ga0157372_10828152
718 Ga0157372_10852402
719 Ga0157372_10910279
720 Ga0157375_10092258
721 Ga0157375_10094840
722 Ga0163163_10031608
723 Ga0163163_10233919
724 Ga0163163_10632358
725 Ga0157380_10056292
726 Ga0157380_10269478
727 Ga0157380_11222771
728 Ga0182008_10031644
729 Ga0157377_10028676
730 Ga0157377_10398312
731 Ga0157379_10002352
732 Ga0157379_10039388
733 Ga0157379_10326627
734 Ga0157376_10017375
735 Ga0206354_11116139
736 Ga0206353_10695326
737 Ga0206353_11570503
738 Ga0213875_10000628
739 Ga0213871_10071413
740 Ga0207692_10016813
741 Ga0207692_10068679
742 Ga0207710_10011296
743 Ga0207688_10008601
744 Ga0207680_10052984
745 Ga0207685_10084824
746 Ga0207699_10020979
747 Ga0207699_10024277
748 Ga0207699_10053522
749 Ga0207645_10100451
750 Ga0207643_10001058
751 Ga0207643_10035461
752 Ga0207705_10001017
753 Ga0207705_10003565
754 Ga0207705_10325148
755 Ga0207684_10065107
756 Ga0207684_10109225
757 Ga0207654_10122400
758 Ga0207707_10097036
759 Ga0207707_10111241
760 Ga0207707_10403689
761 Ga0207693_10069100
762 Ga0207693_10089164
763 Ga0207693_10353814
764 Ga0207663_10017351
765 Ga0207663_10096656
766 Ga0207663_10131989
767 Ga0207663_10230056
768 Ga0207660_10024112
769 Ga0207660_10033405
770 Ga0207657_10134874
771 Ga0207649_10003680
772 Ga0207652_10050945
773 Ga0207646_10004857
774 Ga0207646_10005524
775 Ga0207646_10138615
776 Ga0207646_10347337
777 Ga0207694_10026388
778 Ga0207650_10003121
779 Ga0207659_10090821
780 Ga0207687_10025056
781 Ga0207687_10081498
782 Ga0207700_10041490
783 Ga0207700_10243973
784 Ga0207700_10358748
785 Ga0207664_10083341
786 Ga0207664_10206681
787 Ga0207644_10138813
788 Ga0207706_10065737
789 Ga0207686_10054553
790 Ga0207709_10226824
791 Ga0207691_10524830
792 Ga0207711_10308055
793 Ga0207689_10011323
794 Ga0207661_10004511
795 Ga0207661_10055852
796 Ga0207661_10283394
797 Ga0207679_10004746
798 Ga0207679_10093059
799 Ga0207679_10351160
800 Ga0207679_10524791
801 Ga0207679_10593042
802 Ga0207667_10066851
803 Ga0207667_10225738
804 Ga0207651_10084385
805 Ga0207677_10007176
806 Ga0207677_10018299
807 Ga0207703_10036186
808 Ga0207703_10107269
809 Ga0207703_10263933
810 Ga0207639_10094440
811 Ga0207678_10000891
812 Ga0207708_10125490
813 Ga0207708_10210941
814 Ga0207702_10000901
815 Ga0207702_10021361
816 Ga0207702_10030182
817 Ga0207702_10205331
818 Ga0207702_10836395
819 Ga0207641_10017212
820 Ga0207641_10084024
821 Ga0207641_10170913
822 Ga0207648_10035876
823 Ga0207676_10000683
824 Ga0207674_10137081
825 Ga0207675_100057509
826 Ga0207683_10003187
827 Ga0207683_10026078
828 Ga0207683_10158496
829 Ga0207428_10032481
830 Ga0268266_10088490
831 Ga0268266_10290182
832 Ga0268264_10024573
833 Ga0268264_10084861
834 Ga0307508_10011504
835 Ga0307516_10112486
836 Ga0307416_100156860
837 Ga0307416_101394070
838 Ga0307414_10133387
839 Ga0307414_10799779
840 Ga0307415_100140710
841 Ga0307415_100182913
842 Ga0307415_100529214
843 Ga0373948_0004775
844 Ga0373958_0026897
845 Ga0373959_0038436
846 Ga0373938_0018277
847 Ga0373926_0050070
848 Ga0373928_0007972
849 Ga0373929_0010831
850 Ga0373934_0001105
851 Ga0373949_0012949
852 Ga0373941_0004784
853 Ga0373953_0002361
854 Ga0373954_0062403
855 Ga0373956_0032820
856 Ga0373957_0009640
857 Ga0373943_0145643
858 Ga0373955_0048212
859 Ga0373955_0122813
860 Ga0373961_0009091
861 Ga0373924_0025682
862 Ga0373924_0045137
863 Ga0373933_0041395
864 Ga0373933_0059124
865 Ga0373947_0290587
866 Ga0373947_0329232
867 Ga0373937_0001190
868 Ga0373937_0071070
869 Ga0395899_0030325
870 Ga0395900_0035688
871 Ga0395900_0067887
872 Ga0395898_0008360
873 Ga0395898_0056170
874 Ga0395905_0006775
875 Ga0395905_0021427
876 Ga0436364_0433954
877 Ga0436364_0978060
878 Ga0395901_0005233
879 Ga0436365_1302682
880 Ga0436360_1196668
881 Ga0436363_0704632
882 Ga0436363_0908061
883 Ga0436363_1541826
884 Ga0439448_0017804
885 Ga0439450_036685
886 Ga0439455_0046485
887 Ga0439463_030005
888 Ga0439434_0123895
889 Ga0439459_0001945
890 Ga0439464_0017089
891 Ga0439460_0013761
892 Ga0466969_0003834
893 Ga0466966_0013499
894 Ga0466966_0050324
895 Ga0466961_0290543
896 Ga0466963_0071705
897 Ga0466963_0102585
898 Ga0466963_0190637
899 Ga0466963_0307155
900 Ga0466968_0016414
901 Ga0466968_0047661
902 Ga0466957_0220625
903 Ga0466960_0245608
904 Ga0466959_0009292
905 Ga0466959_0356398
906 Ga0466958_0082426
907 Ga0466958_0268923
908 Ga0466967_0069187
909 Ga0466967_0124246
910 Ga0466967_0434337
911 Ga0466967_0473482
912 Ga0495592_0002851
913 Ga0495592_0005189
914 Ga0495629_0011947
915 Ga0495651_0000097
916 Ga0495651_0072746
917 Ga0495653_0003612
918 Ga0495653_0065394
919 Ga0495653_0179824
920 Ga0495580_0333068
921 Ga0495582_0115666
922 Ga0495639_0194074
923 Ga0495662_0022581
924 Ga0495662_0054163
925 Ga0495664_0198331
926 Ga0495584_0122715
927 Ga0495608_0001079
928 Ga0495608_0042576
929 Ga0495618_0001738
930 Ga0495618_0057911
931 Ga0495628_0001325
932 Ga0495628_0052437
933 Ga0495630_0012943
934 Ga0495652_0001520
935 Ga0495652_0319194
936 Ga0495640_0031662
937 Ga0495587_0000886
938 Ga0495587_0004508
939 Ga0495587_0066369
940 Ga0495587_0188056
941 Ga0495645_0000054
942 Ga0495667_0068859
943 Ga0495667_0166759
944 Ga0495634_0020038
945 Ga0495634_0105646
946 Ga0495635_0036941
947 Ga0495635_0191704
948 Ga0495635_0258834
949 Ga0495588_0049349
950 Ga0495657_0009152
951 Ga0495599_0000344
952 Ga0495599_0029928
953 Ga0495623_0000648
954 Ga0495623_0006424
955 Ga0495623_0023708
956 Ga0495646_0002610
957 Ga0495646_0023341
958 Ga0495600_0024581
959 Ga0495600_0041451
960 Ga0495600_0252986
961 Ga0495604_0000085
962 Ga0495604_0011089
963 Ga0495604_0012713
964 Ga0495604_0019462
965 Ga0495674_0186936
966 Ga0495674_0226869
967 Ga0495680_0002327
968 Ga0495680_0003888
969 Ga0495680_0011912
970 Ga0495675_0000041
971 Ga0495685_039107
972 Ga0495593_0041623
973 Ga0495593_0086095
974 Ga0495602_0004638
975 Ga0495602_0074190
976 Ga0496100_0208030
977 Ga0496101_0135156
978 Ga0496101_0265519
979 Ga0496102_0019332
980 Ga0496102_0607928
981 Ga0496104_0028734
982 Ga0496104_0037518
983 Ga0496104_0493593
984 Ga0496104_0522308
985 Ga0496105_0016078
986 Ga0496105_0087795
987 Ga0496106_0029958
988 Ga0496107_0012106
989 Ga0496108_0003437
990 Ga0496108_0004350
991 Ga0496108_0021673
992 Ga0496108_0376360
993 Ga0496109_0016940
994 Ga0496109_0036847
995 Ga0496109_0054801
996 Ga0496110_0016417
997 Ga0496110_0025324
998 Ga0496111_0001418
999 Ga0496111_0104508
1000 Ga0496111_0129230
1001 Ga0496112_0000666
1002 Ga0496112_0068577
1003 Ga0496112_0102600
1004 Ga0496113_0007559
1005 Ga0496113_0018994
1006 Ga0496113_0111932
1007 Ga0496114_0071901
1008 Ga0496114_0195063
1009 Ga0496115_0160869
1010 Ga0496115_0214336
1011 Ga0496115_0263675
1012 Ga0496115_0553200
1013 Ga0501032_0002020
1014 Ga0501033_0042158
1015 Ga0501034_0001710
1016 Ga0501034_0071863
1017 Ga0501036_0066725
1018 Ga0501037_0002748
1019 Ga0501038_0002968
1020 Ga0501038_0016782
1021 Ga0501039_0046637
1022 Ga0501039_0055362
1023 Ga0501040_0043197
1024 Ga0501041_0000956
1025 Ga0501042_0021537
1026 Ga0501043_0004488
1027 Ga0501043_0068675
1028 Ga0501046_0004028
1029 Ga0501046_0076370
1030 Ga0501047_0000550
1031 Ga0501047_0005893
1032 Ga0501047_0081819
1033 Ga0501047_0214672
1034 Ga0501048_0017060
1035 Ga0501067_0001163
1036 Ga0501068_0003502
1037 Ga0501070_0025729
1038 Ga0501071_0003463
1039 Ga0501072_0001572
1040 Ga0501074_0006093
1041 Ga0501074_0041627
1042 Ga0501076_0006629
1043 Ga0501076_0128516
1044 Ga0501077_0040296
1045 Ga0501079_0135298
1046 Ga0501080_0069525
1047 Ga0501083_0003860
1048 Ga0501035_0000285
1049 Ga0501044_0001295
1050 Ga0501045_0030615
1051 nmdc:mga05p37_12097_c1
1052 nmdc:mga05p37_191178_c1
1053 nmdc:mga05p37_490557_c1
1054 nmdc:mga0qj67_3662_c1
1055 nmdc:mga06r32_13999_c1
1056 nmdc:mga06r32_707666_c1
1057 nmdc:mga06r32_720811_c1
1058 nmdc:mga08y16_18973_c1
1059 nmdc:mga08y16_495783_c1
1060 nmdc:mga08y16_95895_c1
1061 nmdc:mga0n895_15620_c1
1062 nmdc:mga0n895_3095_c1
1063 nmdc:mga0n895_35674_c1
1064 nmdc:mga0n895_365519_c1
1065 nmdc:mga0n895_68820_c1
1066 nmdc:mga0rr50_512140_c1
1067 nmdc:mga0rr50_7408_c1
1068 nmdc:mga08x19_124560_c1
1069 nmdc:mga0a205_25509_c1
1070 nmdc:mga0a205_369999_c1
1071 nmdc:mga0a205_73233_c1
1072 nmdc:mga0a205_86464_c2
1073 Ga0495601_0000385
1074 Ga0495601_0159791
1075 Ga0495612_0096589
1076 Ga0495595_0005018
1077 Ga0495595_0034544
1078 Ga0495595_0037885
1079 Ga0495619_0024438
1080 Ga0495619_0025668
1081 Ga0495619_0041146
1082 Ga0495619_0104135
1083 Ga0501084_0011789
1084 Ga0501082_0002627
1085 Ga0530510_0039620
1086 Ga0530510_0073371
1087 2644019356
1088 2644175256
1089 2793980927
1090 2819741304
1091 2837272282
1092 2891401108
1093 2891562438
1094 2912723831
1095 8025534982
1096 8047902851
1097 8048128888
1098 8048370648
1099 8048388774
1100 8055175582

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13419

HAD_2

Haloacid dehalogenase-like hydrolase

143

268

0.88

PF00702

Hydrolase

haloacid dehalogenase-like hydrolase

59

263

0.78

Structural Annotation

Top 5 Hits

ID Description Score Start End
1lvh-assembly1.cif.gz_A the structure of phosphorylated beta-phosphoglucomutase from lactoccocus lactis to 2.3 angstrom resolution 0.8747 8 240
6hdh-assembly1.cif.gz_A r49k variant of beta-phosphoglucomutase from lactococcus lactis in an open conformer to 1.6 a. 0.873 8 240
3fm9-assembly1.cif.gz_A analysis of the structural determinants underlying discrimination between substrate and solvent in beta-phosphoglucomutase catalysis 0.8618 8 240
6h8y-assembly1.cif.gz_A t16a variant of beta-phosphoglucomutase from lactococcus lactis in an open conformer complexed with aluminium tetrafluoride to 1.9 a. 0.8604 8 244
6h90-assembly1.cif.gz_A k145a variant of beta-phosphoglucomutase from lactococcus lactis inhibited by beryllium trifluoride to 1.3 a. 0.8531 8 244
ID Description Score Start End Superfamily
af_Q4CSI4_580_667_3.40.50.1000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.9535 118 189 3.40.50.1000
4gibB01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.934 125 242 3.40.50.1000
3nasA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.9319 123 241 3.40.50.1000
af_P32662_111_227_3.40.50.1000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.9197 118 218 3.40.50.1000
4g9bA01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;HAD superfamily/HAD-like 0.9155 125 242 3.40.50.1000
ID Description Score Start End GO Terms
AF-A0A2S8BJ31-F1-model_v4 Trehalose-phosphate phosphatase (EC 3.1.3.12) 0.998 166 242 GO:0004805
AF-A0A6A0CTZ3-F1-model_v4 deleted 0.9968 117 242
AF-A0A6J4Q238-F1-model_v4 Beta-phosphoglucomutase (EC 5.4.2.6) 0.9964 1 242 GO:0008801
AF-A0A124EYC8-F1-model_v4 deleted 0.9934 2 242
AF-A0A0U1DPI8-F1-model_v4 Beta-phosphoglucomutase (EC 5.4.2.6) 0.9933 1 243 GO:0016787
GO:0016853

Map