F462013

General Info

Members Datasets Scaffolds Average Seq Length
546 244 1092 109

Family's Representative Sequence

Representative Sequence 3300031901|Ga0307406_10316801|Ga0307406_103168012
Length 132
Sequence MSNVPHRVLVRSADVILGKEETQMGCGGQSGLSFQPEENRTGRKVFCVKFQREMPGLDEAPFDNEMGQRIFENVSKEAWKMWVEQMKMIMNEYRLNLSTPDAQQFLMTQMEQYFFGEGSAFPPGYLPPKSKN

Samples

Sample ID Description Type Environment
1 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
2 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
3 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
4 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
5 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
9 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
16 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
17 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
18 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
19 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
20 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
21 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
22 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
23 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
24 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
25 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
26 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
27 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
28 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
29 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
30 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
31 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
32 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
33 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
34 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
35 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
36 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
37 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
38 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
39 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
40 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
41 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
42 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
43 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
44 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
45 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
46 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
47 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
48 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
49 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
50 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
51 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
52 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
53 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
54 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
55 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
56 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
57 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
58 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
59 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
60 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
61 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
62 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
63 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
64 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
65 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
66 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
67 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
68 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
69 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
70 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
71 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
72 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
73 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
74 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
75 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
76 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
77 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
78 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
79 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
80 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
81 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
82 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
83 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
84 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
85 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
86 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
87 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
88 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
89 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
90 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
91 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
92 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
93 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
94 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
95 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
96 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
97 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
98 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
99 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
100 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
101 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
102 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
103 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
104 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
105 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
106 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
107 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
108 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
109 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
110 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
111 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
112 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
113 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
114 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
115 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
165 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
166 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
167 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
168 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
169 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
170 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
171 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
172 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
173 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
174 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
175 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
176 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
177 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
178 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
179 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
180 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
181 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
182 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
183 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
184 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
185 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
186 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
187 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
188 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
189 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
190 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
191 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
192 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
193 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
194 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
195 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
196 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
197 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
198 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
199 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
200 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
201 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
202 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
203 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
204 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
205 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
206 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
207 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
208 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
209 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
210 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
211 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
212 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
213 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
214 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
215 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
216 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
217 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
218 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
219 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
220 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
221 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
222 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
223 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
224 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
225 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
226 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
227 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
228 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
229 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
230 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
231 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
232 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
233 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
234 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
235 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
236 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
237 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
238 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
239 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
240 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
241 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
242 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
243 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
244 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 95.6
Metatranscriptomes 4.4
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.47
Rhizosphere 97.25
Stem 0
Stem Tuber 0
Unclassified 28.02

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0307406_10316801 3300031901 Bacteria 1205
2 Ga0058863_10007972 3300004799 Bacteria 2362
3 Ga0058863_11833493 3300004799 Bacteria 617
4 Ga0058861_11483757 3300004800 Bacteria 668
5 Ga0058861_11852505 3300004800 Unclassified 579
6 Ga0058862_10039874 3300004803 Unclassified 1530
7 Ga0058862_12132514 3300004803 Bacteria 732
8 Ga0058862_12563914 3300004803 Bacteria 1161
9 Ga0070676_10055291 3300005328 Bacteria 2342
10 Ga0070676_10808189 3300005328 Unclassified 692
11 Ga0070683_100012817 3300005329 Bacteria 7296
12 Ga0070683_100020437 3300005329 Bacteria 5893
13 Ga0070683_100071983 3300005329 Bacteria 3226
14 Ga0070683_100196570 3300005329 Bacteria 1915
15 Ga0070690_100600777 3300005330 Unclassified 835
16 Ga0070670_101028367 3300005331 Bacteria 750
17 Ga0070670_101583772 3300005331 Bacteria 602
18 Ga0070677_10530833 3300005333 Unclassified 642
19 Ga0068869_100112045 3300005334 Bacteria 2076
20 Ga0068869_100301630 3300005334 Unclassified 1294
21 Ga0070666_10883993 3300005335 Unclassified 660
22 Ga0070680_100001558 3300005336 Bacteria 16748
23 Ga0070682_100170475 3300005337 Bacteria 1512
24 Ga0070682_100830859 3300005337 Bacteria 753
25 Ga0068868_100212822 3300005338 Bacteria 1616
26 Ga0068868_101052285 3300005338 Bacteria 747
27 Ga0068868_101404130 3300005338 Unclassified 651
28 Ga0070660_100039560 3300005339 Bacteria 3585
29 Ga0070689_100065591 3300005340 Unclassified 2828
30 Ga0070689_100122458 3300005340 Bacteria 2078
31 Ga0070691_10008104 3300005341 Bacteria 4811
32 Ga0070692_10492111 3300005345 Unclassified 793
33 Ga0070671_100331255 3300005355 Bacteria 1298
34 Ga0070671_101578103 3300005355 Bacteria 581
35 Ga0070674_101216974 3300005356 Unclassified 669
36 Ga0070673_100083360 3300005364 Bacteria 2597
37 Ga0070673_100835025 3300005364 Bacteria 852
38 Ga0070667_100127512 3300005367 Bacteria 2218
39 Ga0070667_100957231 3300005367 Unclassified 798
40 Ga0070709_10008747 3300005434 Bacteria 5569
41 Ga0070709_10033739 3300005434 Bacteria 3098
42 Ga0070709_11669776 3300005434 Unclassified 520
43 Ga0070714_100009438 3300005435 Bacteria 7672
44 Ga0070713_100000816 3300005436 Bacteria 20007
45 Ga0070713_100298194 3300005436 Unclassified 1483
46 Ga0070713_100313316 3300005436 Unclassified 1447
47 Ga0070713_102267082 3300005436 Unclassified 526
48 Ga0070710_10141268 3300005437 Unclassified 1477
49 Ga0070701_10031784 3300005438 Bacteria 2622
50 Ga0070711_100163626 3300005439 Bacteria 1689
51 Ga0070711_100844670 3300005439 Bacteria 779
52 Ga0070705_101220181 3300005440 Unclassified 620
53 Ga0070705_101581019 3300005440 Unclassified 551
54 Ga0070705_101590839 3300005440 Bacteria 550
55 Ga0070700_100523665 3300005441 Bacteria 916
56 Ga0070700_100885643 3300005441 Unclassified 726
57 Ga0070694_101389769 3300005444 Unclassified 592
58 Ga0070678_100062855 3300005456 Bacteria 2744
59 Ga0070681_10002648 3300005458 Bacteria 16442
60 Ga0070681_10033831 3300005458 Bacteria 5131
61 Ga0070681_10091294 3300005458 Bacteria 2996
62 Ga0070681_10671165 3300005458 Unclassified 952
63 Ga0070681_10934039 3300005458 Bacteria 786
64 Ga0068867_100047006 3300005459 Bacteria 3172
65 Ga0068867_100649296 3300005459 Bacteria 926
66 Ga0070685_11183852 3300005466 Bacteria 580
67 Ga0070698_100499583 3300005471 Bacteria 1154
68 Ga0070698_100958064 3300005471 Bacteria 802
69 Ga0070698_101958942 3300005471 Bacteria 539
70 Ga0070679_100000878 3300005530 Bacteria 26099
71 Ga0070679_100018360 3300005530 Bacteria 6787
72 Ga0070679_100067514 3300005530 Unclassified 3566
73 Ga0070679_100314050 3300005530 Bacteria 1517
74 Ga0070684_100009906 3300005535 Bacteria 7531
75 Ga0070684_100269067 3300005535 Bacteria 1560
76 Ga0070684_101162658 3300005535 Bacteria 726
77 Ga0070684_101471468 3300005535 Unclassified 642
78 Ga0068853_100090210 3300005539 Unclassified 2694
79 Ga0068853_100148151 3300005539 Unclassified 2111
80 Ga0068853_100377843 3300005539 Bacteria 1323
81 Ga0068853_101506926 3300005539 Bacteria 651
82 Ga0070686_100071116 3300005544 Bacteria 2277
83 Ga0070695_101069048 3300005545 Bacteria 659
84 Ga0070696_101542787 3300005546 Unclassified 569
85 Ga0070693_100651967 3300005547 Bacteria 766
86 Ga0070693_101476387 3300005547 Bacteria 531
87 Ga0070704_100060572 3300005549 Bacteria 2705
88 Ga0068855_100026454 3300005563 Bacteria 6940
89 Ga0068855_100061136 3300005563 Bacteria 4402
90 Ga0068855_100116685 3300005563 Bacteria 3059
91 Ga0068855_100386411 3300005563 Bacteria 1536
92 Ga0070664_100037988 3300005564 Bacteria 4051
93 Ga0070664_100752144 3300005564 Bacteria 910
94 Ga0070664_101524845 3300005564 Bacteria 633
95 Ga0070664_101689142 3300005564 Bacteria 600
96 Ga0068857_100000098 3300005577 Bacteria 50740
97 Ga0068857_100028217 3300005577 Bacteria 4952
98 Ga0068857_100209847 3300005577 Unclassified 1777
99 Ga0068857_100639048 3300005577 Bacteria 1008
100 Ga0068854_101645393 3300005578 Bacteria 586
101 Ga0068856_100000431 3300005614 Bacteria 46002
102 Ga0068856_100024562 3300005614 Bacteria 5868
103 Ga0068856_100038203 3300005614 Bacteria 4713
104 Ga0068856_100392903 3300005614 Bacteria 1406
105 Ga0068856_101467680 3300005614 Bacteria 696
106 Ga0068856_102020653 3300005614 Unclassified 587
107 Ga0070702_100468019 3300005615 Unclassified 918
108 Ga0068852_100008290 3300005616 Bacteria 7647
109 Ga0068852_100080542 3300005616 Bacteria 2887
110 Ga0068859_100057729 3300005617 Bacteria 3909
111 Ga0068859_100986993 3300005617 Bacteria 925
112 Ga0068859_102164795 3300005617 Bacteria 614
113 Ga0068864_100560013 3300005618 Unclassified 1106
114 Ga0068864_100752078 3300005618 Bacteria 955
115 Ga0068864_101195277 3300005618 Bacteria 759
116 Ga0068864_101329607 3300005618 Unclassified 719
117 Ga0068866_10372238 3300005718 Bacteria 914
118 Ga0068861_100106793 3300005719 Unclassified 2237
119 Ga0068870_11171981 3300005840 Bacteria 555
120 Ga0068863_100039612 3300005841 Bacteria 4483
121 Ga0068863_101104346 3300005841 Bacteria 798
122 Ga0068858_100006344 3300005842 Bacteria 11515
123 Ga0068858_100255206 3300005842 Unclassified 1666
124 Ga0068858_100283471 3300005842 Bacteria 1578
125 Ga0068858_100500550 3300005842 Unclassified 1174
126 Ga0068860_100295527 3300005843 Bacteria 1586
127 Ga0068860_102345964 3300005843 Bacteria 554
128 Ga0068862_100787071 3300005844 Unclassified 928
129 Ga0081539_10090438 3300005985 Bacteria 1583
130 Ga0070717_10013534 3300006028 Bacteria 6256
131 Ga0070717_10239644 3300006028 Bacteria 1599
132 Ga0070717_10262012 3300006028 Bacteria 1530
133 Ga0070717_10641817 3300006028 Unclassified 964
134 Ga0070715_10574598 3300006163 Bacteria 657
135 Ga0070716_101697634 3300006173 Bacteria 521
136 Ga0070712_100177837 3300006175 Bacteria 1656
137 Ga0097621_100046533 3300006237 Unclassified 3511
138 Ga0097621_100167249 3300006237 Unclassified 1894
139 Ga0097621_100262679 3300006237 Unclassified 1515
140 Ga0097621_100277885 3300006237 Bacteria 1473
141 Ga0097621_100968763 3300006237 Bacteria 795
142 Ga0097621_101809820 3300006237 Unclassified 582
143 Ga0068871_100026551 3300006358 Bacteria 4520
144 Ga0068871_100027159 3300006358 Bacteria 4473
145 Ga0068871_100055243 3300006358 Unclassified 3224
146 Ga0068871_100265203 3300006358 Unclassified 1499
147 Ga0068871_100662318 3300006358 Bacteria 954
148 Ga0068871_101699619 3300006358 Bacteria 598
149 Ga0075428_101783774 3300006844 Unclassified 641
150 Ga0075428_101820969 3300006844 Unclassified 633
151 Ga0075430_100416273 3300006846 Unclassified 1109
152 Ga0075430_100805220 3300006846 Unclassified 774
153 Ga0075431_100172355 3300006847 Unclassified 2223
154 Ga0075433_10796184 3300006852 Unclassified 826
155 Ga0075433_11666568 3300006852 Unclassified 549
156 Ga0075434_100468507 3300006871 Unclassified 1281
157 Ga0075434_100847020 3300006871 Unclassified 930
158 Ga0068865_100484565 3300006881 Bacteria 1028
159 Ga0097620_100057731 3300006931 Bacteria 3909
160 Ga0097620_100986875 3300006931 Bacteria 925
161 Ga0097620_102164586 3300006931 Bacteria 614
162 Ga0105240_10011972 3300009093 Bacteria 12023
163 Ga0105240_10022664 3300009093 Bacteria 8319
164 Ga0105240_10116662 3300009093 Viruses 3220
165 Ga0105240_10187434 3300009093 Unclassified 2435
166 Ga0105240_10600932 3300009093 Bacteria 1211
167 Ga0105240_11528380 3300009093 Bacteria 699
168 Ga0105245_10000827 3300009098 Bacteria 28177
169 Ga0105245_10002868 3300009098 Bacteria 15482
170 Ga0105245_10030444 3300009098 Bacteria 4772
171 Ga0105245_10497715 3300009098 Bacteria 1234
172 Ga0105245_10669865 3300009098 Unclassified 1069
173 Ga0105245_11424212 3300009098 Bacteria 743
174 Ga0105247_10313356 3300009101 Bacteria 1092
175 Ga0105247_10380086 3300009101 Bacteria 1001
176 Ga0105243_10033452 3300009148 Unclassified 3976
177 Ga0105243_10153886 3300009148 Bacteria 1976
178 Ga0105243_10192408 3300009148 Bacteria 1783
179 Ga0105243_10384625 3300009148 Bacteria 1299
180 Ga0105243_11700902 3300009148 Unclassified 660
181 Ga0105241_10003348 3300009174 Bacteria 11936
182 Ga0105241_10048257 3300009174 Bacteria 3240
183 Ga0105241_10939829 3300009174 Unclassified 805
184 Ga0105241_11131172 3300009174 Bacteria 739
185 Ga0105242_10003739 3300009176 Bacteria 11821
186 Ga0105242_10054075 3300009176 Bacteria 3281
187 Ga0105242_10078957 3300009176 Bacteria 2748
188 Ga0105242_10088018 3300009176 Bacteria 2608
189 Ga0105242_10675472 3300009176 Bacteria 1007
190 Ga0105242_10732260 3300009176 Unclassified 971
191 Ga0105242_10781905 3300009176 Unclassified 943
192 Ga0105248_10010505 3300009177 Bacteria 10196
193 Ga0105248_10033422 3300009177 Bacteria 5746
194 Ga0105248_10200657 3300009177 Bacteria 2247
195 Ga0105248_10250074 3300009177 Bacteria 1995
196 Ga0105248_10382773 3300009177 Unclassified 1584
197 Ga0105248_10418980 3300009177 Bacteria 1508
198 Ga0105248_10742118 3300009177 Bacteria 1108
199 Ga0105248_11289150 3300009177 Unclassified 826
200 Ga0105248_11656130 3300009177 Bacteria 725
201 Ga0105237_10032287 3300009545 Bacteria 5301
202 Ga0105237_10162436 3300009545 Unclassified 2232
203 Ga0105237_10258486 3300009545 Bacteria 1744
204 Ga0105237_10474220 3300009545 Unclassified 1257
205 Ga0105237_11695708 3300009545 Bacteria 639
206 Ga0105238_10001899 3300009551 Bacteria 20977
207 Ga0105238_10025617 3300009551 Bacteria 6012
208 Ga0105238_10058174 3300009551 Bacteria 3875
209 Ga0105238_10091594 3300009551 Bacteria 3027
210 Ga0105238_10259819 3300009551 Bacteria 1716
211 Ga0105238_10643070 3300009551 Unclassified 1070
212 Ga0105238_12416680 3300009551 Unclassified 561
213 Ga0105249_10002362 3300009553 Bacteria 16384
214 Ga0105249_10316432 3300009553 Unclassified 1571
215 Ga0105249_10320631 3300009553 Bacteria 1561
216 Ga0105249_10725050 3300009553 Bacteria 1055
217 Ga0105239_10003081 3300010375 Bacteria 20711
218 Ga0105239_10030924 3300010375 Bacteria 5890
219 Ga0105239_10135472 3300010375 Bacteria 2742
220 Ga0105239_10148704 3300010375 Unclassified 2614
221 Ga0105239_10337708 3300010375 Bacteria 1700
222 Ga0105239_12870351 3300010375 Unclassified 562
223 Ga0105246_10051360 3300011119 Bacteria 2831
224 Ga0105246_10105044 3300011119 Bacteria 2064
225 Ga0105246_10317537 3300011119 Bacteria 1264
226 Ga0157373_11291987 3300013100 Bacteria 552
227 Ga0157371_10163210 3300013102 Bacteria 1591
228 Ga0157370_10020397 3300013104 Bacteria 6620
229 Ga0157370_10050179 3300013104 Viruses 3989
230 Ga0157370_10065558 3300013104 Bacteria 3436
231 Ga0157369_10001514 3300013105 Bacteria 28521
232 Ga0157369_10255160 3300013105 Bacteria 1830
233 Ga0157369_10276751 3300013105 Unclassified 1748
234 Ga0157369_10832864 3300013105 Bacteria 947
235 Ga0157374_10278639 3300013296 Bacteria 1651
236 Ga0157374_10294724 3300013296 Bacteria 1604
237 Ga0157374_10866563 3300013296 Unclassified 920
238 Ga0157378_10043005 3300013297 Bacteria 4011
239 Ga0157378_10376761 3300013297 Bacteria 1393
240 Ga0157378_10586259 3300013297 Bacteria 1124
241 Ga0157378_11135332 3300013297 Bacteria 819
242 Ga0157378_12191348 3300013297 Unclassified 604
243 Ga0163162_10377986 3300013306 Bacteria 1550
244 Ga0163162_10553065 3300013306 Bacteria 1279
245 Ga0163162_10607733 3300013306 Unclassified 1219
246 Ga0163162_11265924 3300013306 Unclassified 838
247 Ga0157372_10028231 3300013307 Bacteria 6124
248 Ga0157372_10063232 3300013307 Bacteria 4149
249 Ga0157372_10109832 3300013307 Bacteria 3159
250 Ga0157372_10119271 3300013307 Viruses 3028
251 Ga0157372_10123065 3300013307 Bacteria 2981
252 Ga0157372_10276681 3300013307 Bacteria 1951
253 Ga0157375_10178187 3300013308 Bacteria 2276
254 Ga0157375_11038833 3300013308 Bacteria 957
255 Ga0157375_11144069 3300013308 Unclassified 912
256 Ga0157375_12389461 3300013308 Bacteria 631
257 Ga0163163_10194763 3300014325 Bacteria 2075
258 Ga0163163_10301688 3300014325 Bacteria 1654
259 Ga0163163_10572213 3300014325 Bacteria 1193
260 Ga0163163_11436146 3300014325 Unclassified 751
261 Ga0157377_10614057 3300014745 Unclassified 777
262 Ga0157379_10025517 3300014968 Bacteria 5251
263 Ga0157379_10044486 3300014968 Bacteria 3963
264 Ga0157379_10152883 3300014968 Unclassified 2082
265 Ga0157379_10261476 3300014968 Bacteria 1572
266 Ga0157379_10312681 3300014968 Bacteria 1433
267 Ga0157379_10916205 3300014968 Unclassified 832
268 Ga0157376_10635777 3300014969 Bacteria 1066
269 Ga0157376_10654757 3300014969 Bacteria 1051
270 Ga0157376_11829019 3300014969 Bacteria 644
271 Ga0182007_10321146 3300015262 Bacteria 574
272 Ga0163161_11353274 3300017792 Bacteria 620
273 Ga0197907_10689410 3300020069 Bacteria 634
274 Ga0197907_10721518 3300020069 Bacteria 1845
275 Ga0206356_11199016 3300020070 Bacteria 1080
276 Ga0206349_1570513 3300020075 Bacteria 844
277 Ga0206349_1692425 3300020075 Bacteria 1631
278 Ga0206355_1154888 3300020076 Bacteria 539
279 Ga0206351_11008654 3300020077 Bacteria 2142
280 Ga0206352_10097937 3300020078 Bacteria 1125
281 Ga0206352_10120868 3300020078 Unclassified 695
282 Ga0206352_10264694 3300020078 Bacteria 1571
283 Ga0206350_10860057 3300020080 Bacteria 719
284 Ga0206354_11573403 3300020081 Bacteria 1117
285 Ga0206353_11009071 3300020082 Unclassified 576
286 Ga0206353_11850561 3300020082 Unclassified 674
287 Ga0154015_1459444 3300020610 Bacteria 582
288 Ga0213875_10009995 3300021388 Unclassified 4774
289 Ga0224712_10011191 3300022467 Bacteria 2773
290 Ga0224712_10025139 3300022467 Bacteria 2090
291 Ga0228598_1024355 3300024227 Bacteria 1191
292 Ga0207642_10042806 3300025899 Bacteria 1993
293 Ga0207699_10021505 3300025906 Bacteria 3478
294 Ga0207699_10271734 3300025906 Bacteria 1175
295 Ga0207699_10421862 3300025906 Unclassified 953
296 Ga0207699_11166411 3300025906 Unclassified 570
297 Ga0207645_10018537 3300025907 Bacteria 4577
298 Ga0207654_10001123 3300025911 Bacteria 14447
299 Ga0207654_10018734 3300025911 Bacteria 3638
300 Ga0207654_10233505 3300025911 Bacteria 1226
301 Ga0207707_10000509 3300025912 Bacteria 39960
302 Ga0207707_10043854 3300025912 Bacteria 3900
303 Ga0207707_10799271 3300025912 Bacteria 786
304 Ga0207695_10000470 3300025913 Bacteria 87551
305 Ga0207695_10001269 3300025913 Bacteria 42929
306 Ga0207695_10009168 3300025913 Bacteria 12278
307 Ga0207695_10074281 3300025913 Bacteria 3461
308 Ga0207695_10866158 3300025913 Unclassified 783
309 Ga0207671_10071953 3300025914 Bacteria 2580
310 Ga0207671_10098439 3300025914 Unclassified 2212
311 Ga0207693_10203709 3300025915 Bacteria 1556
312 Ga0207663_10004584 3300025916 Bacteria 6886
313 Ga0207663_10208407 3300025916 Unclassified 1415
314 Ga0207663_10387752 3300025916 Unclassified 1066
315 Ga0207663_11209612 3300025916 Bacteria 608
316 Ga0207660_10008842 3300025917 Bacteria 6509
317 Ga0207652_10018144 3300025921 Bacteria 5768
318 Ga0207652_10783802 3300025921 Bacteria 847
319 Ga0207652_10812619 3300025921 Bacteria 830
320 Ga0207646_10743579 3300025922 Bacteria 875
321 Ga0207694_10001376 3300025924 Bacteria 20931
322 Ga0207694_10010735 3300025924 Bacteria 6917
323 Ga0207694_10067609 3300025924 Bacteria 2789
324 Ga0207694_10281303 3300025924 Unclassified 1367
325 Ga0207694_10573836 3300025924 Bacteria 948
326 Ga0207694_11281413 3300025924 Bacteria 620
327 Ga0207687_10002080 3300025927 Bacteria 13680
328 Ga0207687_10002685 3300025927 Bacteria 12035
329 Ga0207687_10038239 3300025927 Unclassified 3279
330 Ga0207687_10088177 3300025927 Bacteria 2256
331 Ga0207687_10185971 3300025927 Bacteria 1613
332 Ga0207687_10872712 3300025927 Bacteria 769
333 Ga0207687_10885653 3300025927 Bacteria 763
334 Ga0207700_10008750 3300025928 Bacteria 6288
335 Ga0207700_11785878 3300025928 Unclassified 541
336 Ga0207700_11882781 3300025928 Unclassified 524
337 Ga0207664_10004461 3300025929 Bacteria 9480
338 Ga0207664_10069601 3300025929 Bacteria 2830
339 Ga0207644_10260430 3300025931 Bacteria 1387
340 Ga0207690_10056865 3300025932 Bacteria 2641
341 Ga0207706_10821339 3300025933 Unclassified 789
342 Ga0207686_10045375 3300025934 Unclassified 2704
343 Ga0207686_10112898 3300025934 Bacteria 1836
344 Ga0207686_10468552 3300025934 Unclassified 972
345 Ga0207686_10715127 3300025934 Unclassified 797
346 Ga0207709_10058562 3300025935 Bacteria 2394
347 Ga0207709_10094379 3300025935 Bacteria 1964
348 Ga0207670_10065670 3300025936 Bacteria 2491
349 Ga0207670_10248756 3300025936 Bacteria 1373
350 Ga0207669_10119661 3300025937 Bacteria 1784
351 Ga0207704_10059149 3300025938 Bacteria 2364
352 Ga0207665_10153923 3300025939 Bacteria 1649
353 Ga0207665_11081034 3300025939 Bacteria 639
354 Ga0207691_10669075 3300025940 Bacteria 876
355 Ga0207711_10002714 3300025941 Bacteria 15622
356 Ga0207711_10032957 3300025941 Bacteria 4381
357 Ga0207711_10176403 3300025941 Bacteria 1942
358 Ga0207711_10266939 3300025941 Unclassified 1574
359 Ga0207711_10826215 3300025941 Unclassified 863
360 Ga0207689_10111742 3300025942 Bacteria 2246
361 Ga0207689_10186868 3300025942 Unclassified 1709
362 Ga0207689_10303369 3300025942 Unclassified 1324
363 Ga0207689_10677823 3300025942 Bacteria 869
364 Ga0207661_10007221 3300025944 Bacteria 7897
365 Ga0207661_10022897 3300025944 Bacteria 4712
366 Ga0207661_10142188 3300025944 Bacteria 2066
367 Ga0207661_10277349 3300025944 Bacteria 1497
368 Ga0207661_10314948 3300025944 Unclassified 1405
369 Ga0207661_10988118 3300025944 Bacteria 775
370 Ga0207661_11759649 3300025944 Unclassified 565
371 Ga0207679_10465820 3300025945 Bacteria 1123
372 Ga0207667_10000145 3300025949 Bacteria 107389
373 Ga0207667_10000290 3300025949 Bacteria 69361
374 Ga0207667_10717235 3300025949 Unclassified 1001
375 Ga0207667_12140254 3300025949 Bacteria 517
376 Ga0207651_10055918 3300025960 Unclassified 2713
377 Ga0207651_10091267 3300025960 Bacteria 2230
378 Ga0207712_10016178 3300025961 Bacteria 4823
379 Ga0207712_10474664 3300025961 Unclassified 1065
380 Ga0207668_11707831 3300025972 Bacteria 568
381 Ga0207640_10099140 3300025981 Unclassified 2039
382 Ga0207640_12016533 3300025981 Bacteria 523
383 Ga0207658_10512403 3300025986 Unclassified 1070
384 Ga0207677_10091864 3300026023 Unclassified 2209
385 Ga0207703_10288836 3300026035 Bacteria 1492
386 Ga0207703_10523412 3300026035 Unclassified 1116
387 Ga0207703_10550558 3300026035 Unclassified 1088
388 Ga0207703_11077129 3300026035 Bacteria 772
389 Ga0207703_11303792 3300026035 Bacteria 698
390 Ga0207639_10119435 3300026041 Bacteria 2163
391 Ga0207708_10557110 3300026075 Unclassified 967
392 Ga0207708_11582496 3300026075 Unclassified 576
393 Ga0207702_10037744 3300026078 Bacteria 4044
394 Ga0207702_10047978 3300026078 Bacteria 3600
395 Ga0207702_10079490 3300026078 Bacteria 2843
396 Ga0207702_10090783 3300026078 Viruses 2673
397 Ga0207702_10108384 3300026078 Bacteria 2464
398 Ga0207702_12167783 3300026078 Unclassified 545
399 Ga0207641_10030193 3300026088 Bacteria 4488
400 Ga0207641_10653553 3300026088 Bacteria 1033
401 Ga0207648_10417771 3300026089 Bacteria 1217
402 Ga0207676_10420676 3300026095 Bacteria 1253
403 Ga0207676_10545239 3300026095 Bacteria 1107
404 Ga0207676_10641885 3300026095 Unclassified 1024
405 Ga0207676_11755416 3300026095 Unclassified 619
406 Ga0207676_12350261 3300026095 Bacteria 530
407 Ga0207676_12447673 3300026095 Bacteria 519
408 Ga0207674_10000264 3300026116 Bacteria 65695
409 Ga0207675_100900631 3300026118 Bacteria 901
410 Ga0207675_100938334 3300026118 Bacteria 882
411 Ga0207675_101111091 3300026118 Unclassified 810
412 Ga0207683_10126265 3300026121 Unclassified 2299
413 Ga0207698_10576485 3300026142 Bacteria 1106
414 Ga0207698_11279718 3300026142 Bacteria 748
415 Ga0207698_12200657 3300026142 Bacteria 564
416 Ga0268264_10867208 3300028381 Bacteria 905
417 Ga0268264_11787721 3300028381 Bacteria 625
418 Ga0265338_10054985 3300028800 Bacteria 3545
419 Ga0265338_10124469 3300028800 Bacteria 2048
420 Ga0265320_10231592 3300031240 Bacteria 821
421 Ga0265329_10044316 3300031242 Bacteria 1422
422 Ga0265340_10164619 3300031247 Unclassified 1006
423 Ga0265339_10158327 3300031249 Bacteria 1141
424 Ga0265331_10010992 3300031250 Bacteria 4969
425 Ga0265316_10056589 3300031344 Bacteria 3061
426 Ga0265313_10000996 3300031595 Bacteria 27796
427 Ga0265314_10017482 3300031711 Bacteria 5628
428 Ga0265314_10064869 3300031711 Bacteria 2470
429 Ga0265314_10106223 3300031711 Bacteria 1794
430 Ga0265342_10032319 3300031712 Bacteria 3228
431 Ga0307516_10469092 3300031730 Unclassified 914
432 Ga0307409_102101755 3300031995 Bacteria 594
433 Ga0307411_10665678 3300032005 Bacteria 903
434 Ga0373934_0011729 3300035086 Bacteria 3300
435 Ga0373944_0195111 3300035089 Unclassified 731
436 Ga0373923_0073668 3300035111 Bacteria 1471
437 Ga0373923_0083339 3300035111 Bacteria 1389
438 Ga0373923_0097344 3300035111 Unclassified 1294
439 Ga0373953_0049272 3300035117 Unclassified 1699
440 Ga0373953_0075419 3300035117 Bacteria 1396
441 Ga0373953_0342370 3300035117 Bacteria 655
442 Ga0373954_0038162 3300035118 Bacteria 2233
443 Ga0373954_0626711 3300035118 Bacteria 533
444 Ga0373956_0090700 3300035119 Bacteria 1410
445 Ga0373956_0136771 3300035119 Unclassified 1149
446 Ga0373956_0235726 3300035119 Bacteria 869
447 Ga0373956_0600453 3300035119 Bacteria 525
448 Ga0373943_0057527 3300035170 Unclassified 1932
449 Ga0373946_0185627 3300035171 Bacteria 989
450 Ga0373946_0189177 3300035171 Bacteria 981
451 Ga0373946_0394091 3300035171 Bacteria 698
452 Ga0373955_0017226 3300035172 Bacteria 3571
453 Ga0373955_0405926 3300035172 Bacteria 828
454 Ga0373955_0556409 3300035172 Bacteria 702
455 Ga0373924_0557174 3300035410 Bacteria 516
456 Ga0373935_0135462 3300035692 Bacteria 1659
457 Ga0373935_0572387 3300035692 Bacteria 825
458 Ga0373935_0652570 3300035692 Bacteria 772
459 Ga0373927_0001406 3300035695 Bacteria 18142
460 Ga0373927_0278556 3300035695 Bacteria 1100
461 Ga0373933_0010268 3300035724 Bacteria 5130
462 Ga0373933_0068379 3300035724 Bacteria 2157
463 Ga0373947_0005742 3300035725 Bacteria 7233
464 Ga0373947_0310480 3300035725 Bacteria 1053
465 Ga0373947_0357386 3300035725 Bacteria 981
466 Ga0373937_0034388 3300036401 Bacteria 4610
467 Ga0373937_0039043 3300036401 Bacteria 4326
468 Ga0373937_0122414 3300036401 Bacteria 2425
469 Ga0373937_0217587 3300036401 Bacteria 1798
470 Ga0373937_0307865 3300036401 Bacteria 1498
471 Ga0373925_0000480 3300037068 Bacteria 39960
472 Ga0373925_0235365 3300037068 Bacteria 1465
473 Ga0373925_0310463 3300037068 Bacteria 1275
474 Ga0373925_0343831 3300037068 Unclassified 1210
475 Ga0373925_0456572 3300037068 Bacteria 1047
476 Ga0373925_0722298 3300037068 Bacteria 821
477 Ga0436364_0299861 3300037853 Bacteria 2330
478 Ga0436364_0538283 3300037853 Bacteria 749
479 Ga0436364_0753572 3300037853 Bacteria 823
480 Ga0436364_1023071 3300037853 Bacteria 768
481 Ga0436362_0589643 3300039453 Bacteria 824
482 Ga0451839_0552730 3300041496 Bacteria 672
483 Ga0453684_0200388 3300044712 Bacteria 2327
484 Ga0495629_0433857 3300046459 Unclassified 891
485 Ga0495651_0184429 3300046462 Bacteria 1474
486 Ga0495582_0449689 3300046473 Unclassified 744
487 Ga0495582_0574650 3300046473 Bacteria 652
488 Ga0495639_0278411 3300046475 Unclassified 831
489 Ga0495594_0707891 3300046499 Unclassified 569
490 Ga0495608_0072679 3300046511 Bacteria 2244
491 Ga0495628_0422639 3300046516 Bacteria 971
492 Ga0495652_0171400 3300046529 Bacteria 1675
493 Ga0495665_0118631 3300046531 Bacteria 1386
494 Ga0495665_0300830 3300046531 Bacteria 821
495 Ga0495586_0022569 3300046535 Bacteria 3359
496 Ga0495586_0148074 3300046535 Bacteria 1320
497 Ga0495587_0004470 3300046536 Bacteria 9200
498 Ga0495587_0139671 3300046536 Unclassified 1383
499 Ga0495645_0062793 3300046543 Bacteria 2690
500 Ga0495656_0719540 3300046615 Unclassified 538
501 Ga0495634_0042896 3300046642 Bacteria 3067
502 Ga0495657_0332815 3300046675 Bacteria 901
503 Ga0495599_0046814 3300046678 Bacteria 2711
504 Ga0495599_0256168 3300046678 Unclassified 1064
505 Ga0495599_0590641 3300046678 Bacteria 647
506 Ga0495623_0039987 3300046679 Bacteria 2995
507 Ga0495646_0565351 3300046680 Bacteria 580
508 Ga0495658_0152259 3300046683 Bacteria 1421
509 Ga0495658_1086630 3300046683 Bacteria 510
510 Ga0495669_0060760 3300046684 Bacteria 1709
511 Ga0495613_0527203 3300046689 Bacteria 793
512 Ga0495624_0052711 3300046690 Bacteria 2570
513 Ga0495636_0159599 3300047318 Unclassified 1015
514 Ga0495674_0314033 3300047319 Unclassified 1278
515 Ga0495676_0467789 3300047321 Unclassified 830
516 Ga0495680_0854873 3300047322 Unclassified 591
517 Ga0495675_0026328 3300047444 Bacteria 3708
518 Ga0495684_0061325 3300047471 Bacteria 2861
519 Ga0495684_0837690 3300047471 Unclassified 598
520 Ga0495602_0037153 3300048088 Bacteria 4523
521 Ga0495602_0252640 3300048088 Unclassified 1313
522 Ga0496104_0877310 3300048907 Unclassified 802
523 Ga0496106_0521796 3300048909 Bacteria 954
524 Ga0496107_0989144 3300048910 Bacteria 611
525 Ga0496112_0144473 3300048915 Bacteria 2348
526 Ga0496112_0523768 3300048915 Bacteria 1120
527 Ga0496113_0177734 3300048916 Bacteria 1687
528 Ga0496114_1666165 3300048917 Unclassified 526
529 Ga0496115_0101772 3300048918 Bacteria 2356
530 Ga0501036_0804920 3300049572 Bacteria 774
531 Ga0501071_0730023 3300049587 Bacteria 763
532 Ga0501075_1042801 3300049591 Unclassified 621
533 Ga0501225_0270933 3300049705 Unclassified 565
534 Ga0501268_047204 3300049765 Bacteria 825
535 nmdc:mga0qj67_378122_c1 3300050509 Unclassified 1144
536 nmdc:mga06r32_409872_c1 3300050510 Unclassified 1337
537 nmdc:mga0n895_1942820_c1 3300050512 Unclassified 547
538 nmdc:mga0n895_707322_c1 3300050512 Unclassified 1003
539 nmdc:mga08x19_614419_c1 3300050514 Unclassified 770
540 nmdc:mga0a205_1095412_c1 3300050515 Unclassified 644
541 nmdc:mga0a205_1203897_c1 3300050515 Unclassified 605
542 Ga0495601_0229280 3300053077 Unclassified 1213
543 Ga0495601_0237617 3300053077 Bacteria 1190
544 Ga0495601_0252412 3300053077 Unclassified 1152
545 Ga0495601_0815402 3300053077 Unclassified 592
546 Ga0495595_0496692 3300053084 Unclassified 622
547 Ga0307406_10316801
548 Ga0058863_10007972
549 Ga0058863_11833493
550 Ga0058861_11483757
551 Ga0058861_11852505
552 Ga0058862_10039874
553 Ga0058862_12132514
554 Ga0058862_12563914
555 Ga0070676_10055291
556 Ga0070676_10808189
557 Ga0070683_100012817
558 Ga0070683_100020437
559 Ga0070683_100071983
560 Ga0070683_100196570
561 Ga0070690_100600777
562 Ga0070670_101028367
563 Ga0070670_101583772
564 Ga0070677_10530833
565 Ga0068869_100112045
566 Ga0068869_100301630
567 Ga0070666_10883993
568 Ga0070680_100001558
569 Ga0070682_100170475
570 Ga0070682_100830859
571 Ga0068868_100212822
572 Ga0068868_101052285
573 Ga0068868_101404130
574 Ga0070660_100039560
575 Ga0070689_100065591
576 Ga0070689_100122458
577 Ga0070691_10008104
578 Ga0070692_10492111
579 Ga0070671_100331255
580 Ga0070671_101578103
581 Ga0070674_101216974
582 Ga0070673_100083360
583 Ga0070673_100835025
584 Ga0070667_100127512
585 Ga0070667_100957231
586 Ga0070709_10008747
587 Ga0070709_10033739
588 Ga0070709_11669776
589 Ga0070714_100009438
590 Ga0070713_100000816
591 Ga0070713_100298194
592 Ga0070713_100313316
593 Ga0070713_102267082
594 Ga0070710_10141268
595 Ga0070701_10031784
596 Ga0070711_100163626
597 Ga0070711_100844670
598 Ga0070705_101220181
599 Ga0070705_101581019
600 Ga0070705_101590839
601 Ga0070700_100523665
602 Ga0070700_100885643
603 Ga0070694_101389769
604 Ga0070678_100062855
605 Ga0070681_10002648
606 Ga0070681_10033831
607 Ga0070681_10091294
608 Ga0070681_10671165
609 Ga0070681_10934039
610 Ga0068867_100047006
611 Ga0068867_100649296
612 Ga0070685_11183852
613 Ga0070698_100499583
614 Ga0070698_100958064
615 Ga0070698_101958942
616 Ga0070679_100000878
617 Ga0070679_100018360
618 Ga0070679_100067514
619 Ga0070679_100314050
620 Ga0070684_100009906
621 Ga0070684_100269067
622 Ga0070684_101162658
623 Ga0070684_101471468
624 Ga0068853_100090210
625 Ga0068853_100148151
626 Ga0068853_100377843
627 Ga0068853_101506926
628 Ga0070686_100071116
629 Ga0070695_101069048
630 Ga0070696_101542787
631 Ga0070693_100651967
632 Ga0070693_101476387
633 Ga0070704_100060572
634 Ga0068855_100026454
635 Ga0068855_100061136
636 Ga0068855_100116685
637 Ga0068855_100386411
638 Ga0070664_100037988
639 Ga0070664_100752144
640 Ga0070664_101524845
641 Ga0070664_101689142
642 Ga0068857_100000098
643 Ga0068857_100028217
644 Ga0068857_100209847
645 Ga0068857_100639048
646 Ga0068854_101645393
647 Ga0068856_100000431
648 Ga0068856_100024562
649 Ga0068856_100038203
650 Ga0068856_100392903
651 Ga0068856_101467680
652 Ga0068856_102020653
653 Ga0070702_100468019
654 Ga0068852_100008290
655 Ga0068852_100080542
656 Ga0068859_100057729
657 Ga0068859_100986993
658 Ga0068859_102164795
659 Ga0068864_100560013
660 Ga0068864_100752078
661 Ga0068864_101195277
662 Ga0068864_101329607
663 Ga0068866_10372238
664 Ga0068861_100106793
665 Ga0068870_11171981
666 Ga0068863_100039612
667 Ga0068863_101104346
668 Ga0068858_100006344
669 Ga0068858_100255206
670 Ga0068858_100283471
671 Ga0068858_100500550
672 Ga0068860_100295527
673 Ga0068860_102345964
674 Ga0068862_100787071
675 Ga0081539_10090438
676 Ga0070717_10013534
677 Ga0070717_10239644
678 Ga0070717_10262012
679 Ga0070717_10641817
680 Ga0070715_10574598
681 Ga0070716_101697634
682 Ga0070712_100177837
683 Ga0097621_100046533
684 Ga0097621_100167249
685 Ga0097621_100262679
686 Ga0097621_100277885
687 Ga0097621_100968763
688 Ga0097621_101809820
689 Ga0068871_100026551
690 Ga0068871_100027159
691 Ga0068871_100055243
692 Ga0068871_100265203
693 Ga0068871_100662318
694 Ga0068871_101699619
695 Ga0075428_101783774
696 Ga0075428_101820969
697 Ga0075430_100416273
698 Ga0075430_100805220
699 Ga0075431_100172355
700 Ga0075433_10796184
701 Ga0075433_11666568
702 Ga0075434_100468507
703 Ga0075434_100847020
704 Ga0068865_100484565
705 Ga0097620_100057731
706 Ga0097620_100986875
707 Ga0097620_102164586
708 Ga0105240_10011972
709 Ga0105240_10022664
710 Ga0105240_10116662
711 Ga0105240_10187434
712 Ga0105240_10600932
713 Ga0105240_11528380
714 Ga0105245_10000827
715 Ga0105245_10002868
716 Ga0105245_10030444
717 Ga0105245_10497715
718 Ga0105245_10669865
719 Ga0105245_11424212
720 Ga0105247_10313356
721 Ga0105247_10380086
722 Ga0105243_10033452
723 Ga0105243_10153886
724 Ga0105243_10192408
725 Ga0105243_10384625
726 Ga0105243_11700902
727 Ga0105241_10003348
728 Ga0105241_10048257
729 Ga0105241_10939829
730 Ga0105241_11131172
731 Ga0105242_10003739
732 Ga0105242_10054075
733 Ga0105242_10078957
734 Ga0105242_10088018
735 Ga0105242_10675472
736 Ga0105242_10732260
737 Ga0105242_10781905
738 Ga0105248_10010505
739 Ga0105248_10033422
740 Ga0105248_10200657
741 Ga0105248_10250074
742 Ga0105248_10382773
743 Ga0105248_10418980
744 Ga0105248_10742118
745 Ga0105248_11289150
746 Ga0105248_11656130
747 Ga0105237_10032287
748 Ga0105237_10162436
749 Ga0105237_10258486
750 Ga0105237_10474220
751 Ga0105237_11695708
752 Ga0105238_10001899
753 Ga0105238_10025617
754 Ga0105238_10058174
755 Ga0105238_10091594
756 Ga0105238_10259819
757 Ga0105238_10643070
758 Ga0105238_12416680
759 Ga0105249_10002362
760 Ga0105249_10316432
761 Ga0105249_10320631
762 Ga0105249_10725050
763 Ga0105239_10003081
764 Ga0105239_10030924
765 Ga0105239_10135472
766 Ga0105239_10148704
767 Ga0105239_10337708
768 Ga0105239_12870351
769 Ga0105246_10051360
770 Ga0105246_10105044
771 Ga0105246_10317537
772 Ga0157373_11291987
773 Ga0157371_10163210
774 Ga0157370_10020397
775 Ga0157370_10050179
776 Ga0157370_10065558
777 Ga0157369_10001514
778 Ga0157369_10255160
779 Ga0157369_10276751
780 Ga0157369_10832864
781 Ga0157374_10278639
782 Ga0157374_10294724
783 Ga0157374_10866563
784 Ga0157378_10043005
785 Ga0157378_10376761
786 Ga0157378_10586259
787 Ga0157378_11135332
788 Ga0157378_12191348
789 Ga0163162_10377986
790 Ga0163162_10553065
791 Ga0163162_10607733
792 Ga0163162_11265924
793 Ga0157372_10028231
794 Ga0157372_10063232
795 Ga0157372_10109832
796 Ga0157372_10119271
797 Ga0157372_10123065
798 Ga0157372_10276681
799 Ga0157375_10178187
800 Ga0157375_11038833
801 Ga0157375_11144069
802 Ga0157375_12389461
803 Ga0163163_10194763
804 Ga0163163_10301688
805 Ga0163163_10572213
806 Ga0163163_11436146
807 Ga0157377_10614057
808 Ga0157379_10025517
809 Ga0157379_10044486
810 Ga0157379_10152883
811 Ga0157379_10261476
812 Ga0157379_10312681
813 Ga0157379_10916205
814 Ga0157376_10635777
815 Ga0157376_10654757
816 Ga0157376_11829019
817 Ga0182007_10321146
818 Ga0163161_11353274
819 Ga0197907_10689410
820 Ga0197907_10721518
821 Ga0206356_11199016
822 Ga0206349_1570513
823 Ga0206349_1692425
824 Ga0206355_1154888
825 Ga0206351_11008654
826 Ga0206352_10097937
827 Ga0206352_10120868
828 Ga0206352_10264694
829 Ga0206350_10860057
830 Ga0206354_11573403
831 Ga0206353_11009071
832 Ga0206353_11850561
833 Ga0154015_1459444
834 Ga0213875_10009995
835 Ga0224712_10011191
836 Ga0224712_10025139
837 Ga0228598_1024355
838 Ga0207642_10042806
839 Ga0207699_10021505
840 Ga0207699_10271734
841 Ga0207699_10421862
842 Ga0207699_11166411
843 Ga0207645_10018537
844 Ga0207654_10001123
845 Ga0207654_10018734
846 Ga0207654_10233505
847 Ga0207707_10000509
848 Ga0207707_10043854
849 Ga0207707_10799271
850 Ga0207695_10000470
851 Ga0207695_10001269
852 Ga0207695_10009168
853 Ga0207695_10074281
854 Ga0207695_10866158
855 Ga0207671_10071953
856 Ga0207671_10098439
857 Ga0207693_10203709
858 Ga0207663_10004584
859 Ga0207663_10208407
860 Ga0207663_10387752
861 Ga0207663_11209612
862 Ga0207660_10008842
863 Ga0207652_10018144
864 Ga0207652_10783802
865 Ga0207652_10812619
866 Ga0207646_10743579
867 Ga0207694_10001376
868 Ga0207694_10010735
869 Ga0207694_10067609
870 Ga0207694_10281303
871 Ga0207694_10573836
872 Ga0207694_11281413
873 Ga0207687_10002080
874 Ga0207687_10002685
875 Ga0207687_10038239
876 Ga0207687_10088177
877 Ga0207687_10185971
878 Ga0207687_10872712
879 Ga0207687_10885653
880 Ga0207700_10008750
881 Ga0207700_11785878
882 Ga0207700_11882781
883 Ga0207664_10004461
884 Ga0207664_10069601
885 Ga0207644_10260430
886 Ga0207690_10056865
887 Ga0207706_10821339
888 Ga0207686_10045375
889 Ga0207686_10112898
890 Ga0207686_10468552
891 Ga0207686_10715127
892 Ga0207709_10058562
893 Ga0207709_10094379
894 Ga0207670_10065670
895 Ga0207670_10248756
896 Ga0207669_10119661
897 Ga0207704_10059149
898 Ga0207665_10153923
899 Ga0207665_11081034
900 Ga0207691_10669075
901 Ga0207711_10002714
902 Ga0207711_10032957
903 Ga0207711_10176403
904 Ga0207711_10266939
905 Ga0207711_10826215
906 Ga0207689_10111742
907 Ga0207689_10186868
908 Ga0207689_10303369
909 Ga0207689_10677823
910 Ga0207661_10007221
911 Ga0207661_10022897
912 Ga0207661_10142188
913 Ga0207661_10277349
914 Ga0207661_10314948
915 Ga0207661_10988118
916 Ga0207661_11759649
917 Ga0207679_10465820
918 Ga0207667_10000145
919 Ga0207667_10000290
920 Ga0207667_10717235
921 Ga0207667_12140254
922 Ga0207651_10055918
923 Ga0207651_10091267
924 Ga0207712_10016178
925 Ga0207712_10474664
926 Ga0207668_11707831
927 Ga0207640_10099140
928 Ga0207640_12016533
929 Ga0207658_10512403
930 Ga0207677_10091864
931 Ga0207703_10288836
932 Ga0207703_10523412
933 Ga0207703_10550558
934 Ga0207703_11077129
935 Ga0207703_11303792
936 Ga0207639_10119435
937 Ga0207708_10557110
938 Ga0207708_11582496
939 Ga0207702_10037744
940 Ga0207702_10047978
941 Ga0207702_10079490
942 Ga0207702_10090783
943 Ga0207702_10108384
944 Ga0207702_12167783
945 Ga0207641_10030193
946 Ga0207641_10653553
947 Ga0207648_10417771
948 Ga0207676_10420676
949 Ga0207676_10545239
950 Ga0207676_10641885
951 Ga0207676_11755416
952 Ga0207676_12350261
953 Ga0207676_12447673
954 Ga0207674_10000264
955 Ga0207675_100900631
956 Ga0207675_100938334
957 Ga0207675_101111091
958 Ga0207683_10126265
959 Ga0207698_10576485
960 Ga0207698_11279718
961 Ga0207698_12200657
962 Ga0268264_10867208
963 Ga0268264_11787721
964 Ga0265338_10054985
965 Ga0265338_10124469
966 Ga0265320_10231592
967 Ga0265329_10044316
968 Ga0265340_10164619
969 Ga0265339_10158327
970 Ga0265331_10010992
971 Ga0265316_10056589
972 Ga0265313_10000996
973 Ga0265314_10017482
974 Ga0265314_10064869
975 Ga0265314_10106223
976 Ga0265342_10032319
977 Ga0307516_10469092
978 Ga0307409_102101755
979 Ga0307411_10665678
980 Ga0373934_0011729
981 Ga0373944_0195111
982 Ga0373923_0073668
983 Ga0373923_0083339
984 Ga0373923_0097344
985 Ga0373953_0049272
986 Ga0373953_0075419
987 Ga0373953_0342370
988 Ga0373954_0038162
989 Ga0373954_0626711
990 Ga0373956_0090700
991 Ga0373956_0136771
992 Ga0373956_0235726
993 Ga0373956_0600453
994 Ga0373943_0057527
995 Ga0373946_0185627
996 Ga0373946_0189177
997 Ga0373946_0394091
998 Ga0373955_0017226
999 Ga0373955_0405926
1000 Ga0373955_0556409
1001 Ga0373924_0557174
1002 Ga0373935_0135462
1003 Ga0373935_0572387
1004 Ga0373935_0652570
1005 Ga0373927_0001406
1006 Ga0373927_0278556
1007 Ga0373933_0010268
1008 Ga0373933_0068379
1009 Ga0373947_0005742
1010 Ga0373947_0310480
1011 Ga0373947_0357386
1012 Ga0373937_0034388
1013 Ga0373937_0039043
1014 Ga0373937_0122414
1015 Ga0373937_0217587
1016 Ga0373937_0307865
1017 Ga0373925_0000480
1018 Ga0373925_0235365
1019 Ga0373925_0310463
1020 Ga0373925_0343831
1021 Ga0373925_0456572
1022 Ga0373925_0722298
1023 Ga0436364_0299861
1024 Ga0436364_0538283
1025 Ga0436364_0753572
1026 Ga0436364_1023071
1027 Ga0436362_0589643
1028 Ga0451839_0552730
1029 Ga0453684_0200388
1030 Ga0495629_0433857
1031 Ga0495651_0184429
1032 Ga0495582_0449689
1033 Ga0495582_0574650
1034 Ga0495639_0278411
1035 Ga0495594_0707891
1036 Ga0495608_0072679
1037 Ga0495628_0422639
1038 Ga0495652_0171400
1039 Ga0495665_0118631
1040 Ga0495665_0300830
1041 Ga0495586_0022569
1042 Ga0495586_0148074
1043 Ga0495587_0004470
1044 Ga0495587_0139671
1045 Ga0495645_0062793
1046 Ga0495656_0719540
1047 Ga0495634_0042896
1048 Ga0495657_0332815
1049 Ga0495599_0046814
1050 Ga0495599_0256168
1051 Ga0495599_0590641
1052 Ga0495623_0039987
1053 Ga0495646_0565351
1054 Ga0495658_0152259
1055 Ga0495658_1086630
1056 Ga0495669_0060760
1057 Ga0495613_0527203
1058 Ga0495624_0052711
1059 Ga0495636_0159599
1060 Ga0495674_0314033
1061 Ga0495676_0467789
1062 Ga0495680_0854873
1063 Ga0495675_0026328
1064 Ga0495684_0061325
1065 Ga0495684_0837690
1066 Ga0495602_0037153
1067 Ga0495602_0252640
1068 Ga0496104_0877310
1069 Ga0496106_0521796
1070 Ga0496107_0989144
1071 Ga0496112_0144473
1072 Ga0496112_0523768
1073 Ga0496113_0177734
1074 Ga0496114_1666165
1075 Ga0496115_0101772
1076 Ga0501036_0804920
1077 Ga0501071_0730023
1078 Ga0501075_1042801
1079 Ga0501225_0270933
1080 Ga0501268_047204
1081 nmdc:mga0qj67_378122_c1
1082 nmdc:mga06r32_409872_c1
1083 nmdc:mga0n895_1942820_c1
1084 nmdc:mga0n895_707322_c1
1085 nmdc:mga08x19_614419_c1
1086 nmdc:mga0a205_1095412_c1
1087 nmdc:mga0a205_1203897_c1
1088 Ga0495601_0229280
1089 Ga0495601_0237617
1090 Ga0495601_0252412
1091 Ga0495601_0815402
1092 Ga0495595_0496692

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04362

Iron_traffic

Bacterial Fe(2+) trafficking

41

128

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
1t07-assembly1.cif.gz_A crystal structure of conserved protein of unknown function pa5148 from pseudomonas aeruginosa 0.8963 19 94
1t07-assembly1.cif.gz_A crystal structure of conserved protein of unknown function pa5148 from pseudomonas aeruginosa 0.8261 19 94
1yhd-assembly1.cif.gz_A the solution structure of yggx from escherichia coli 0.782 18 108
1yhd-assembly1.cif.gz_A the solution structure of yggx from escherichia coli 0.7583 18 108
2mzy-assembly1.cif.gz_A 1h, 13c, and 15n chemical shift assignments and structure of probable fe(2+)-trafficking protein from burkholderia pseudomallei 1710b. 0.7212 19 108
ID Description Score Start End Superfamily
1yhdA01 Mainly Alpha;Orthogonal Bundle;YggX-like;Fe(II) trafficking protein YggX 0.9193 18 90 1.10.3880.10
1yhdA01 Mainly Alpha;Orthogonal Bundle;YggX-like;Fe(II) trafficking protein YggX 0.8742 18 90 1.10.3880.10
1t07A00 Mainly Alpha;Orthogonal Bundle;YggX-like;Fe(II) trafficking protein YggX 0.8537 19 94 1.10.3880.10
1xs8A01 Mainly Alpha;Orthogonal Bundle;YggX-like;Fe(II) trafficking protein YggX 0.8422 19 92 1.10.3880.10
af_P0A8P3_1_91_1.10.3880.10 Mainly Alpha;Orthogonal Bundle;YggX-like;Fe(II) trafficking protein YggX 0.8344 19 104 1.10.3880.10
ID Description Score Start End GO Terms
AF-A0A2P5SXT7-F1-model_v4 Probable Fe(2+)-trafficking protein 0.9813 19 92 GO:0005506
GO:0005829
GO:0034599
AF-A0A1G0XW91-F1-model_v4 Probable Fe(2+)-trafficking protein 0.9807 19 94 GO:0005506
GO:0005829
GO:0034599
AF-A0A523HRR3-F1-model_v4 Oxidative damage protection protein 0.9803 19 91 GO:0005506
GO:0005829
GO:0034599
AF-S5R8P8-F1-model_v4 Fe(II) trafficking protein YggX 0.9802 19 94 GO:0005506
GO:0005829
GO:0034599
AF-D4G7L0-F1-model_v4 Conserved domain protein 0.9772 19 94 GO:0005506
GO:0005829
GO:0034599

Map