F461794

General Info

Members Datasets Scaffolds Average Seq Length
544 425 292 306

Family's Representative Sequence

Representative Sequence 3300053111|Ga0500572_020979|Ga0500572_020979_444_1478
Length 344
Sequence MQAFQPRHEIGLEFFCGLIKESQPLFRKPRMATNQFSSGDVIADRRADYARMLAESGDHAAAAELIEQALELAPHWAAGWSRLGEYSEKAGQTANAIAAYEKVAELDAEGIFAAPLKLAVLGAAKTPEQPPSRYIEGLFDDYADRFETSLVEKLDYSVPQKLAALIETAKPANDKFRCIVDIGCGTGLLGSEVHAWAQRLEGFDISTNMLAKAEGKGIYDHLAQADLALEADASGLFNADLPHHRADLVAAADVMMYLGSLETVMPLVLGLLAPGGTFAFSVEDAGDEAGFVLLPSLRYAHSQTYVRTLLTSFGLETLETQKTTIRKDAGKPLSGILFLARKPA

Samples

Sample ID Description Type Environment
1 2509276021 Rhizobium leguminosarum bv. trifolii WSM597 Isolate Nodule
2 2509276033 Rhizobium leguminosarum bv. trifolii WSM2012 Isolate Nodule
3 2510065019 Rhizobium leguminosarum bv. trifolii WSM1689 Isolate Nodule
4 2510461076 Rhizobium leguminosarum bv. trifolii TA1 Isolate Nodule
5 2510917022 Rhizobium sp. AP16 Isolate Rhizosphere
6 2510917030 Rhizobium sp. CF142 Isolate Rhizosphere
7 2513237084 Rhizobium leguminosarum bv. viciae UPM1131 Isolate Nodule
8 2513237085 Rhizobium leguminosarum bv. viciae UPM1137 Isolate Nodule
9 2513237088 Rhizobium mesoamericanum STM6155 Isolate Nodule
10 2513237093 Rhizobium leguminosarum bv. phaseoli FA23 Isolate Nodule
11 2513237103 Rhizobium leguminosarum bv. viciae VF39 Isolate Nodule
12 2513237146 Rhizobium mongolense USDA 1844 (Illumina) Isolate Nodule
13 2513237162 Rhizobium ruizarguesonis GB30 Isolate Nodule
14 2515075009 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
15 2515154113 Rhizobium ruizarguesonis Vc2 Isolate Nodule
16 2515154114 Rhizobium ruizarguesonis Vh3 Isolate Nodule
17 2515154116 Rhizobium ruizarguesonis Ps8 Isolate Nodule
18 2515154134 Rhizobium gallicum bv. gallicum R602sp Isolate Nodule
19 2516653077 Rhizobium acaciae WSM1481 Isolate Nodule
20 2516653085 Rhizobium leguminosarum bv. phaseoli 4292 Isolate Nodule
21 2517093000 Rhizobium leguminosarum bv. trifolii SRDI943 Isolate Nodule
22 2517287029 Rhizobium leguminosarum bv. trifolii SRDI565 Isolate Nodule
23 2519899620 Rhizobium sp. Pop5 Isolate Nodule
24 2523231067 Pleomorphomonas oryzae DSM 16300 Isolate Unclassified
25 2524023209 Rhizobium leucaenae USDA 9039 Isolate Nodule
26 2529292951 Rhizobium sp. CCGE 510 Isolate Nodule
27 2537561587 Agrobacterium tumefaciens Cherry 2E-2-2 Isolate Rhizosphere
28 2554235003 Agrobacterium tumefaciens WRT31 Isolate Rhizosphere
29 2558860242 Agrobacterium fabacearum P4 Isolate Rhizosphere
30 2582581298 Rhizobium alamii YR540 Isolate Rhizosphere
31 2582581299 Rhizobium leguminosarum OV483 Isolate Rhizosphere
32 2582581307 Rhizobium sp. YR060 Isolate Rhizosphere
33 2582581308 Rhizobium sp. OK494 Isolate Rhizosphere
34 2582581315 Agrobacterium rhizogenes YR147 Isolate Rhizosphere
35 2582581316 Agrobacterium rhizogenes OK036 Isolate Rhizosphere
36 2585427526 Rhizobium leguminosarum OV152 Isolate Rhizosphere
37 2585427527 Rhizobium lusitanum YR374 Isolate Rhizosphere
38 2585427528 Rhizobium leguminosarum CF307 Isolate Rhizosphere
39 2585427529 Rhizobium alamii YR584 Isolate Rhizosphere
40 2585427530 Rhizobium tropici YR635 Isolate Rhizosphere
41 2585427531 Agrobacterium rhizogenes YR530 Isolate Rhizosphere
42 2585427593 Rhizobium tropici CF286 Isolate Rhizosphere
43 2585427608 Agrobacterium rhizogenes OV677 Isolate Rhizosphere
44 2585427609 Agrobacterium rhizogenes CF263 Isolate Rhizosphere
45 2585428125 Agrobacterium rhizogenes CF262 Isolate Rhizosphere
46 2599185210 Rhizobium sp. NFACC06-2 Isolate Rhizoplane
47 2600254933 Rhizobium sp. NFR12 Isolate Rhizoplane
48 2600255279 Rhizobium sp. NFIX01 Isolate Rhizoplane
49 2600255308 Rhizobium sp. NFIX02 Isolate Rhizoplane
50 2615840624 Rhizobium aethiopicum HBR26 Isolate Nodule
51 2615840626 Rhizobium lusitanum P1-7 Isolate Nodule
52 2615840698 Rhizobium multihospitium HAMBI 2975 Isolate Nodule
53 2617270742 Rhizobium miluonense HAMBI 2971 Isolate Nodule
54 2643221558 Rhizobium sp. Root149 Isolate Unclassified
55 2643221568 Rhizobium sp. Root564 Isolate Unclassified
56 2643221582 Rhizobium sp. Root651 Isolate Unclassified
57 2643221634 Rhizobium sp. Root1203 Isolate Unclassified
58 2643221643 Rhizobium sp. Root1220 Isolate Unclassified
59 2643221693 Rhizobium sp. Root491 Isolate Unclassified
60 2667528174 Rhizobium sp. NFR17 Isolate Rhizoplane
61 2718217882 Rhizobium sp. N741 Isolate Nodule
62 2718217927 Rhizobium sp. N324 Isolate Nodule
63 2718217997 Rhizobium phaseoli sv. phaseoli R723 Isolate Nodule
64 2718218009 Rhizobium sp. N561 Isolate Nodule
65 2718218199 Rhizobium phaseoli sv. phaseoli N261 Isolate Nodule
66 2718218232 Rhizobium phaseoli sv. phaseoli N161 Isolate Nodule
67 2718218233 Rhizobium phaseoli sv. phaseoli R744 Isolate Nodule
68 2718218235 Rhizobium phaseoli sv. phaseoli R620 Isolate Nodule
69 2718218269 Rhizobium phaseoli sv. phaseoli N671 Isolate Nodule
70 2718218363 Rhizobium sp. N113 Isolate Nodule
71 2718218365 Rhizobium sp. N731 Isolate Nodule
72 2718218366 Rhizobium sp. N621 Isolate Nodule
73 2718218423 Rhizobium sp. N941 Isolate Nodule
74 2721755514 Rhizobium sp. N6212 Isolate Nodule
75 2721755556 Rhizobium phaseoli sv. phaseoli N931 Isolate Nodule
76 2721755684 Rhizobium phaseoli sv. phaseoli N841 Isolate Nodule
77 2721755685 Rhizobium phaseoli sv. phaseoli R611 Isolate Nodule
78 2721755809 Rhizobium sp. N541 Isolate Nodule
79 2721755810 Rhizobium sp. N871 Isolate Nodule
80 2721755819 Rhizobium phaseoli sv. phaseoli N771 Isolate Nodule
81 2721755822 Rhizobium phaseoli sv. phaseoli R650 Isolate Nodule
82 2721755823 Rhizobium phaseoli sv. phaseoli R630 Isolate Nodule
83 2724679232 Rhizobium leguminosarum Vaf12 Isolate Unclassified
84 2728369352 Rhizobium phaseoli sv. phaseoli N831 Isolate Nodule
85 2728369365 Rhizobium sp. N1341 Isolate Nodule
86 2728369397 Rhizobium sp. N1314 Isolate Nodule
87 2738541333 Rhizobium sophoriradicis CCBAU 03470 Isolate Unclassified
88 2738543031 Pleomorphomonas sp. CF100 Isolate Unclassified
89 2775507049 Rhizobium sp. ACO-34A Isolate Unclassified
90 2775507266 Rhizobium tropici PRF 81 Isolate Nodule
91 2791355256 Rhizobium sp. M10 Isolate Nodule
92 2791355259 Rhizobium hidalgonense FH14 Isolate Nodule
93 2791355260 Rhizobium sp. L9 Isolate Nodule
94 2791355261 Rhizobium sp. J15 Isolate Nodule
95 2791355262 Rhizobium sp. M1 Isolate Nodule
96 2791355263 Rhizobium chutanense C5 Isolate Nodule
97 2791355267 Rhizobium sp. L18 Isolate Nodule
98 2802429633 Rhizobium anhuiense J3 Isolate Nodule
99 2802429634 Rhizobium anhuiense S10 Isolate Nodule
100 2802429635 Rhizobium anhuiense Y27 Isolate Nodule
101 2802429636 Rhizobium anhuiense JX3 Isolate Nodule
102 2802429637 Rhizobium anhuiense C15 Isolate Nodule
103 2808606387 Rhizobium sp. SJZ105 Isolate Rhizosphere
104 2818991439 Agrobacterium tumefaciens 1187 Isolate Unclassified
105 2818991448 Rhizobium miluonense 1234 Isolate Unclassified
106 2818991453 Rhizobium lusitanum 1158 Isolate Unclassified
107 2838016132 Rhizobium phaseoli SEMIA 4071 Isolate Nodule
108 2838022645 Rhizobium aethiopicum SEMIA 4074 Isolate Nodule
109 2838029111 Rhizobium tropici SEMIA 4079 Isolate Nodule
110 2838042994 Rhizobium esperanzae SEMIA 4089 Isolate Nodule
111 2838048938 Rhizobium pisi 27/80 Isolate Nodule
112 2838061910 Rhizobium phaseoli L15 Isolate Nodule
113 2838068647 Rhizobium esperanzae VC28 Isolate Nodule
114 2838675328 Agrobacterium radiobacter SEMIA 410 Isolate Nodule
115 2838680041 Rhizobium leguminosarum SEMIA 415 Isolate Nodule
116 2838686498 Rhizobium leguminosarum SEMIA 416 Isolate Nodule
117 2838694306 Rhizobium leguminosarum SEMIA 421 Isolate Nodule
118 2838707686 Rhizobium leguminosarum SEMIA 430 Isolate Nodule
119 2838714209 Agrobacterium radiobacter SEMIA 435 Isolate Nodule
120 2838719591 Agrobacterium radiobacter SEMIA 436 Isolate Nodule
121 2838724970 Agrobacterium radiobacter SEMIA 437 Isolate Nodule
122 2838729681 Rhizobium leguminosarum SEMIA 445 Isolate Nodule
123 2838742623 Rhizobium leguminosarum SEMIA 449 Isolate Nodule
124 2841846520 Agrobacterium radiobacter SEMIA 440 Isolate Nodule
125 2841851746 Rhizobium leguminosarum SEMIA 498 Isolate Nodule
126 2841859092 Agrobacterium radiobacter SEMIA 4026 Isolate Nodule
127 2841864319 Rhizobium leguminosarum SEMIA 4052 Isolate Nodule
128 2842077413 Rhizobium leguminosarum SEMIA 422 Isolate Nodule
129 2842110456 Rhizobium esperanzae SEMIA 414 Isolate Nodule
130 2842118031 Rhizobium esperanzae SEMIA 420 Isolate Nodule
131 2842124991 Agrobacterium radiobacter SEMIA 434 Isolate Nodule
132 2842130223 Agrobacterium radiobacter SEMIA 441 Isolate Nodule
133 2842152218 Agrobacterium radiobacter SEMIA 457 Isolate Nodule
134 2842156927 Rhizobium leguminosarum SEMIA 459 Isolate Nodule
135 2842163707 Rhizobium leguminosarum SEMIA 460 Isolate Nodule
136 2842170452 Agrobacterium radiobacter SEMIA 461 Isolate Nodule
137 2842175837 Agrobacterium radiobacter SEMIA 462 Isolate Nodule
138 2842180545 Rhizobium leguminosarum SEMIA 463 Isolate Nodule
139 2842187318 Agrobacterium radiobacter SEMIA 464 Isolate Nodule
140 2842198810 Rhizobium aethiopicum SEMIA 470 Isolate Nodule
141 2842205361 Rhizobium etli SEMIA 471 Isolate Nodule
142 2842211629 Agrobacterium radiobacter SEMIA 472 Isolate Nodule
143 2842217011 Rhizobium leguminosarum SEMIA 475 Isolate Nodule
144 2842224351 Agrobacterium radiobacter SEMIA 480 Isolate Nodule
145 2842229732 Rhizobium leguminosarum SEMIA 481 Isolate Nodule
146 2842237096 Rhizobium leguminosarum SEMIA 482 Isolate Nodule
147 2842243621 Rhizobium leguminosarum SEMIA 483 Isolate Nodule
148 2842257432 Rhizobium leguminosarum SEMIA 485 Isolate Nodule
149 2842264693 Rhizobium phaseoli SEMIA 487 Isolate Nodule
150 2842271015 Rhizobium leguminosarum SEMIA 488 Isolate Nodule
151 2842278818 Rhizobium etli SEMIA 489 Isolate Nodule
152 2842285085 Rhizobium lentis SEMIA 490 Isolate Nodule
153 2842291075 Rhizobium leguminosarum SEMIA 491 Isolate Nodule
154 2842298080 Rhizobium leucaenae SEMIA 492 Isolate Nodule
155 2842304105 Rhizobium leguminosarum SEMIA 499 Isolate Nodule
156 2842311132 Rhizobium phaseoli SEMIA 4002 Isolate Nodule
157 2842341865 Rhizobium leguminosarum SEMIA 4011 Isolate Nodule
158 2842357229 Rhizobium leucaenae SEMIA 4015 Isolate Nodule
159 2842363717 Rhizobium leguminosarum SEMIA 4016 Isolate Nodule
160 2842370503 Rhizobium leguminosarum SEMIA 4022 Isolate Nodule
161 2842377471 Rhizobium leguminosarum SEMIA 4024 Isolate Nodule
162 2842384541 Rhizobium leguminosarum SEMIA 4025 Isolate Nodule
163 2842395702 Rhizobium ecuadorense SEMIA 4029 Isolate Nodule
164 2842402390 Rhizobium lentis SEMIA 4033 Isolate Nodule
165 2842409023 Rhizobium lentis SEMIA 4034 Isolate Nodule
166 2842415677 Rhizobium lentis SEMIA 4036 Isolate Nodule
167 2842422224 Rhizobium esperanzae SEMIA 4042 Isolate Nodule
168 2842428310 Rhizobium phaseoli SEMIA 4050 Isolate Nodule
169 2842434925 Rhizobium esperanzae SEMIA 4051 Isolate Nodule
170 2842441272 Rhizobium esperanzae SEMIA 4053 Isolate Nodule
171 2842447887 Rhizobium esperanzae SEMIA 4055 Isolate Nodule
172 2842462802 Rhizobium phaseoli SEMIA 4057 Isolate Nodule
173 2842469257 Rhizobium phaseoli SEMIA 4058 Isolate Nodule
174 2842475841 Rhizobium tropici SEMIA 4059 Isolate Nodule
175 2842482326 Rhizobium lusitanum SEMIA 4060 Isolate Nodule
176 2842502639 Rhizobium tropici SEMIA 4063 Isolate Nodule
177 2842509118 Rhizobium paranaense SEMIA 4064 Isolate Nodule
178 2842515876 Agrobacterium radiobacter SEMIA 4072 Isolate Nodule
179 2844454524 Rhizobium leguminosarum bv. viciae BIHB 1217 Isolate Nodule
180 2852387548 Rhizobium jaguaris CCGE525 Isolate Unclassified
181 2857516855 Rhizobium sp. R-72456 Isolate Unclassified
182 2899792073 Agrobacterium deltaense CNPSo 3391 Isolate Nodule
183 2899845264 Agrobacterium fabacearum CNPSo 675 Isolate Unclassified
184 2917554339 Chthonobacter rhizosphaerae yh7-1 Isolate Rhizosphere
185 2919100787 Rhizobium sp. 1399 Isolate Rhizosphere
186 2919114240 Agrobacterium tumefaciens 1457 Isolate Rhizosphere
187 2919166419 Agrobacterium cavarae 2074 Isolate Unclassified
188 2919408235 Rhizobium miluonense 3199 Isolate Unclassified
189 2926754445 Agrobacterium radiobacter SLBN-94 Isolate Rhizosphere
190 2926760298 Agrobacterium tumefaciens SLBN-170 Isolate Rhizosphere
191 2929138655 Agrobacterium sp. R-72433 Hybrid assembly Isolate Unclassified
192 2933006813 Rhizobium sp. SEMIA 439 Isolate Unclassified
193 2933011516 Rhizobium sp. SEMIA 4032 Isolate Unclassified
194 2933570622 Rhizobium leguminosarum SEMIA 409 Isolate Nodule
195 2933586486 Rhizobium leguminosarum SEMIA 4039 Isolate Nodule
196 2933594066 Agrobacterium fabrum 35/80 Isolate Nodule
197 2933599457 Rhizobium phaseoli M3 Isolate Nodule
198 2935894831 Rhizobium leguminosarum SEMIA 419 Isolate Nodule
199 2935901341 Rhizobium leguminosarum SEMIA 4082 Isolate Nodule
200 2936367885 Rhizobium changzhiense WYCCWR 11290 Isolate Nodule
201 2936375103 Rhizobium changzhiense WYCCWR 11317 Isolate Nodule
202 2936381700 Rhizobium chutanense C16 Isolate Unclassified
203 2978969890 Agrobacterium sp. SORGH_AS 787 Isolate Unclassified
204 2979089926 Agrobacterium sp. SORGH_AS 745 Isolate Unclassified
205 2979095461 Agrobacterium tumefaciens SORGH_AS 749 Isolate Unclassified
206 2979100975 Agrobacterium pusense SORGH_AS 755 Isolate Unclassified
207 2984509177 Agrobacterium pusense SORGH_AS260 Isolate Aerial Root
208 2984518228 Agrobacterium pusense SORGH_AS285 Isolate Aerial Root
209 2984537506 Agrobacterium sp. SORGH_AS440 Isolate Aerial Root
210 2984587000 Agrobacterium larrymoorei SORGH_AS974 Isolate Aerial Root
211 2984601300 Rhizobium pusense SORGH_AS1083 Isolate Aerial Root
212 2989771324 Rhizobium rhizolycopersici DBTS2 Isolate Rhizosphere
213 2996887358 Rhizobium sp. R711 Isolate Nodule
214 3005416602 Rhizobium sp. P40RR-XXII Isolate Rhizosphere
215 3005445848 Rhizobium sp. WYJ-E13 Isolate Unclassified
216 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
217 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
218 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
219 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
220 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
221 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
222 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
223 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
224 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
225 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
226 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
227 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
228 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
229 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
230 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
231 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
232 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
233 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
234 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
235 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
236 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
237 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
238 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
239 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
240 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
241 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
242 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
243 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
244 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
245 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
246 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
247 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
248 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
249 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
250 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
251 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
252 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
253 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
254 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
255 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
256 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
257 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
258 3300009765 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule Metagenome Nodule
259 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
260 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
261 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
262 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
263 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
264 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
265 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
266 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
267 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
268 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
269 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
270 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
271 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
272 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
273 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
274 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
275 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
276 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
277 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
278 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
279 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
280 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
281 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
282 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
283 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
284 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
285 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
286 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
287 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
288 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
289 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
290 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
291 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
292 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
293 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
294 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
295 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
296 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
297 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
298 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
299 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
300 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
301 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
302 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
303 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
304 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
305 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
306 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
307 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
308 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
309 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
310 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
311 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
312 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
313 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
314 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
315 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
316 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
317 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
318 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
319 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
320 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
321 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
322 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
323 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
324 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
325 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
326 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
327 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
328 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
329 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
330 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
331 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
332 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
333 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
334 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
335 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
336 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
337 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
338 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
339 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
340 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
341 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
342 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
343 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
344 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
345 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
346 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
347 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
348 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
349 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
350 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
351 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
352 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
353 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
354 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
355 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
356 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
357 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
358 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
359 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
360 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
361 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
362 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
363 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
364 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
365 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
366 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
367 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
368 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
369 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
370 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
371 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
372 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
373 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
374 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
375 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
376 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
377 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
378 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
379 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
380 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
381 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
382 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
383 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
384 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
385 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
386 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
387 3300053736 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere Metagenome Endosphere
388 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
389 639633055 Rhizobium leguminosarum bv. viciae 3841 Isolate Unclassified
390 650716007 Agrobacterium fabacearum H13-3 Isolate Rhizosphere
391 8003570095 Agrobacterium rhizogenes GBBC3284 Isolate Unclassified
392 8005275841 Rhizobium sp. N4311 Isolate Nodule
393 8005282627 Rhizobium phaseoli NC1 Isolate Nodule
394 8005289223 Rhizobium bangladeshense 1002 Isolate Nodule
395 8005301065 Rhizobium bangladeshense 1017 Isolate Nodule
396 8005307578 Rhizobium leguminosarum bv. phaseoli LCS0306 Isolate Unclassified
397 8005314921 Rhizobium sp. P28RR-XV Isolate Rhizosphere
398 8005376324 Rhizobium changzhiense WYCCWR 11279 Isolate Nodule
399 8005382845 Rhizobium sp. R634 Isolate Nodule
400 8005430974 Rhizobium phaseoli Y20 Isolate Nodule
401 8005460587 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
402 8005484373 Rhizobium tropici SARCC-755 Isolate Nodule
403 8005497431 Rhizobium phaseoli CCGM8 Isolate Unclassified
404 8005556819 Rhizobium sp. WYCCWR 11128 Isolate Nodule
405 8005563573 Rhizobium sp. WYCCWR 11152 Isolate Nodule
406 8005570704 Rhizobium anhuiense bv. trifolii WYCCWR10015 Isolate Nodule
407 8005619151 Rhizobium phaseoli CCGM2 Isolate Unclassified
408 8005626139 Rhizobium phaseoli Y18 Isolate Nodule
409 8005645114 Rhizobium tropici IGFRI Rhizo-19 Isolate Rhizosphere
410 8005668836 Rhizobium phaseoli CCGM9 Isolate Unclassified
411 8005682033 Rhizobium dioscoreae S-93 Isolate Unclassified
412 8005688590 Rhizobium bangladeshense 1024 Isolate Nodule
413 8005695170 Rhizobium sp. RMa-01 Isolate Unclassified
414 8018127388 Rhizobium aegyptiacum 950 Isolate Nodule
415 8018150411 Rhizobium straminoryzae SM12 Isolate Rhizosphere
416 8018163183 Rhizobium sp. WYCCWR 11146 Isolate Nodule
417 8018176218 Rhizobium sp. N122 Isolate Nodule
418 8023680758 Rhizobium leguminosarum SARCC-132 Isolate Nodule
419 8024479707 Rhizobium leguminosarum Tri-43 Isolate Nodule
420 8046767195 Rhizobium calliandrae CCGE524 Isolate Unclassified
421 8054460903 Agrobacterium vaccinii B7.6 Isolate Unclassified
422 8054558443 Rhizobium alarense TRM95111 Isolate Nodule
423 8056375014 Rhizobium redzepovicii 18T Isolate Nodule
424 8057575449 Rhizobium mayense CCGE526 Isolate Nodule
425 8057874678 Rhizobium acaciae 1AS12 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 53.68
Metatranscriptomes 0
Isolates 46.32

Biome Distribution

Category Percentage (%)
Aerial Root 0.92
Bulb 0
Endosphere 22.98
Nodule 31.99
Rhizoplane 2.39
Rhizosphere 22.79
Stem 0
Stem Tuber 0
Unclassified 18.93

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10000426 3300001979 Bacteria 18039
2 JGI25155J39150_1000013 3300002704 Bacteria 198215
3 JGI25156J39149_1000011 3300002705 Bacteria 198215
4 JGI25162J39368_1000169 3300002737 Bacteria 72114
5 JGI25162J39368_1000698 3300002737 Bacteria 23303
6 JGI25154J39366_1000030 3300002738 Bacteria 191444
7 JGI25158J39367_1000090 3300002739 Bacteria 21062
8 JGI25157J39369_1000013 3300002741 Bacteria 198211
9 JGI25152J39213_1000500 3300002773 Bacteria 22005
10 JGI25152J39213_1005013 3300002773 Bacteria 4000
11 JGI25152J39213_1006168 3300002773 Bacteria 3329
12 JGI25159J45721_1001485 3300002987 Bacteria 9636
13 JGI25151J46595_10001413 3300003187 Bacteria 16422
14 JGI25151J46595_10003099 3300003187 Bacteria 9366
15 JGI25165J46597_1000349 3300003214 Bacteria 52229
16 JGI25165J46597_1001006 3300003214 Bacteria 18692
17 JGI25165J46597_1003078 3300003214 Bacteria 4500
18 JGI25153J46596_10000786 3300003215 Bacteria 19448
19 JGI25153J46596_10005878 3300003215 Bacteria 6343
20 JGI25153J46596_10006808 3300003215 Bacteria 5723
21 rootH1_10239613 3300003323 Bacteria 3228
22 JGI25160J50197_1000041 3300003354 Bacteria 152843
23 JGI25160J50197_1000514 3300003354 Bacteria 22846
24 JGI25160J50197_1002856 3300003354 Bacteria 7899
25 JGI25161J50226_1000002 3300003374 Bacteria 420324
26 JGI25161J50226_1000184 3300003374 Bacteria 41591
27 JGI25161J50226_1001407 3300003374 Bacteria 7297
28 Ga0055526_1002842 3300003771 Bacteria 11434
29 Ga0055526_1008064 3300003771 Bacteria 5316
30 Ga0055526_1013663 3300003771 Bacteria 3413
31 Ga0055524_1002851 3300003775 Bacteria 8668
32 Ga0055524_1007423 3300003775 Bacteria 4655
33 Ga0055524_1011936 3300003775 Bacteria 3363
34 Ga0055528_1000618 3300003790 Bacteria 26522
35 Ga0055528_1007385 3300003790 Bacteria 4864
36 Ga0055540_1000190 3300003792 Bacteria 59767
37 Ga0055540_1004939 3300003792 Bacteria 5810
38 Ga0058692_1004991 3300003856 Bacteria 3844
39 Ga0058692_1009206 3300003856 Bacteria 2504
40 Ga0055543_1000008 3300004625 Bacteria 202062
41 Ga0055543_1000059 3300004625 Bacteria 100942
42 Ga0065165_1000031 3300005262 Bacteria 216330
43 Ga0065165_1005797 3300005262 Bacteria 6746
44 Ga0065165_1029217 3300005262 Bacteria 1769
45 Ga0070668_100224115 3300005347 Bacteria 1552
46 Ga0070669_100171987 3300005353 Bacteria 1689
47 Ga0070665_100006477 3300005548 Bacteria 11909
48 Ga0070665_100076972 3300005548 Bacteria 3342
49 Ga0068855_100049030 3300005563 Bacteria 4983
50 Ga0068854_100301351 3300005578 Bacteria 1297
51 Ga0068856_100085469 3300005614 Bacteria 3134
52 Ga0068852_100026271 3300005616 Bacteria 4730
53 Ga0075365_10003496 3300006038 Bacteria 8115
54 Ga0075368_10001661 3300006042 Bacteria 7143
55 Ga0075363_100025110 3300006048 Bacteria 3035
56 Ga0075363_100033852 3300006048 Bacteria 2664
57 Ga0075364_10025007 3300006051 Bacteria 3798
58 Ga0075362_10001262 3300006177 Bacteria 7992
59 Ga0075362_10006195 3300006177 Bacteria 4443
60 Ga0075367_10003001 3300006178 Bacteria 7899
61 Ga0075367_10019433 3300006178 Bacteria 3766
62 Ga0075369_10012293 3300006186 Bacteria 3381
63 Ga0075369_10020885 3300006186 Bacteria 2685
64 Ga0075366_10024187 3300006195 Bacteria 3543
65 Ga0075370_10020049 3300006353 Bacteria 3648
66 Ga0099826_10000109 3300006948 Bacteria 38139
67 Ga0105240_10000024 3300009093 Bacteria 375919
68 Ga0105243_10004195 3300009148 Bacteria 11428
69 Ga0105243_10039320 3300009148 Bacteria 3686
70 Ga0105237_10001005 3300009545 Bacteria 37989
71 Ga0123341_1000067 3300009765 Bacteria 44232
72 Ga0105239_10002984 3300010375 Bacteria 21103
73 Ga0157373_10015828 3300013100 Bacteria 5506
74 Ga0157371_10000004 3300013102 Bacteria 512593
75 Ga0157371_10018490 3300013102 Bacteria 5151
76 Ga0157370_10000185 3300013104 Bacteria 78153
77 Ga0157370_10003095 3300013104 Bacteria 19696
78 Ga0157369_10045640 3300013105 Bacteria 4764
79 Ga0157372_10375462 3300013307 Bacteria 1657
80 Ga0182008_10095923 3300014497 Bacteria 1464
81 Ga0182007_10004392 3300015262 Bacteria 6401
82 Ga0209435_100026 3300025206 Bacteria 198295
83 Ga0209436_100006 3300025208 Bacteria 150277
84 Ga0209437_100056 3300025233 Bacteria 363071
85 Ga0209437_100196 3300025233 Bacteria 121199
86 Ga0207425_1005750 3300025245 Bacteria 3491
87 Ga0207425_1006389 3300025245 Bacteria 3229
88 Ga0209646_1000084 3300025246 Bacteria 198295
89 Ga0209646_1002684 3300025246 Bacteria 3811
90 Ga0209026_1000080 3300025250 Bacteria 198295
91 Ga0209759_1000061 3300025256 Bacteria 198295
92 Ga0209129_1000105 3300025258 Bacteria 159104
93 Ga0209129_1000429 3300025258 Bacteria 31758
94 Ga0209129_1001523 3300025258 Bacteria 12805
95 Ga0209129_1002388 3300025258 Bacteria 9244
96 Ga0209233_1000037 3300025261 Bacteria 554620
97 Ga0209233_1000071 3300025261 Bacteria 363290
98 Ga0209233_1000243 3300025261 Bacteria 90170
99 Ga0209673_1000063 3300025273 Bacteria 256709
100 Ga0209673_1001004 3300025273 Bacteria 34285
101 Ga0209673_1002293 3300025273 Bacteria 13648
102 Ga0209673_1007036 3300025273 Bacteria 5280
103 Ga0209673_1007671 3300025273 Bacteria 4919
104 Ga0209130_1000002 3300025284 Bacteria 722648
105 Ga0209130_1000382 3300025284 Bacteria 49448
106 Ga0209025_1000060 3300025294 Bacteria 305017
107 Ga0209025_1000638 3300025294 Bacteria 61892
108 Ga0209025_1003060 3300025294 Bacteria 16457
109 Ga0209564_1000316 3300025295 Bacteria 94849
110 Ga0209564_1002071 3300025295 Bacteria 17245
111 Ga0209564_1016624 3300025295 Bacteria 2913
112 Ga0209758_1000361 3300025297 Bacteria 81006
113 Ga0209758_1000876 3300025297 Bacteria 41358
114 Ga0209758_1001299 3300025297 Bacteria 30604
115 Ga0209758_1002582 3300025297 Bacteria 18177
116 Ga0209758_1010392 3300025297 Bacteria 5579
117 Ga0209758_1012983 3300025297 Bacteria 4596
118 Ga0209050_1006814 3300025298 Bacteria 6650
119 Ga0209256_1000880 3300025299 Bacteria 37115
120 Ga0209256_1002179 3300025299 Bacteria 16813
121 Ga0209256_1004658 3300025299 Bacteria 8440
122 Ga0207426_1000012 3300025302 Bacteria 730942
123 Ga0207426_1000013 3300025302 Bacteria 721897
124 Ga0207426_1000070 3300025302 Bacteria 331559
125 Ga0209051_1000135 3300025303 Bacteria 138142
126 Ga0209051_1019270 3300025303 Bacteria 2984
127 Ga0209051_1019730 3300025303 Bacteria 2930
128 Ga0209051_1035340 3300025303 Bacteria 1860
129 Ga0209257_1009466 3300025304 Bacteria 5202
130 Ga0207695_10000036 3300025913 Bacteria 477897
131 Ga0207671_10000153 3300025914 Bacteria 107114
132 Ga0207667_10074404 3300025949 Bacteria 3529
133 Ga0207640_10381227 3300025981 Bacteria 1142
134 Ga0207702_10074512 3300026078 Bacteria 2930
135 Ga0209371_1000009 3300027312 Bacteria 963030
136 Ga0209371_1000697 3300027312 Bacteria 28520
137 Ga0209371_1002930 3300027312 Bacteria 8906
138 Ga0209282_1000263 3300027666 Bacteria 26280
139 Ga0209813_10006401 3300027866 Bacteria 2907
140 Ga0268266_10057879 3300028379 Bacteria 3336
141 Ga0307515_10095784 3300028794 Bacteria 3648
142 Ga0268256_1000010 3300030500 Bacteria 963034
143 Ga0268256_1002732 3300030500 Bacteria 8626
144 Ga0268256_1002955 3300030500 Bacteria 8074
145 Ga0307513_10074506 3300031456 Bacteria 3529
146 Ga0307406_10157291 3300031901 Bacteria 1629
147 Ga0439465_0008850 3300041413 Bacteria 3172
148 Ga0439465_0042632 3300041413 Bacteria 1471
149 Ga0439465_0056448 3300041413 Bacteria 1294
150 Ga0451804_0526355 3300041463 Bacteria 1512
151 Ga0451833_0035375 3300041491 Bacteria 1086
152 Ga0451843_0153037 3300041509 Bacteria 1003
153 Ga0451853_0242547 3300041512 Bacteria 1272
154 Ga0450910_018882 3300042147 Bacteria 1033
155 Ga0466963_0008338 3300044694 Bacteria 6208
156 Ga0466970_0042101 3300044765 Bacteria 2428
157 Ga0466959_0323799 3300045049 Bacteria 1053
158 Ga0495617_103846 3300046452 Bacteria 922
159 Ga0495585_0009240 3300046492 Bacteria 5928
160 Ga0495585_0013281 3300046492 Bacteria 4824
161 Ga0495607_0050812 3300046501 Bacteria 2411
162 Ga0495607_0163056 3300046501 Bacteria 1131
163 Ga0495583_0003772 3300046506 Bacteria 11259
164 Ga0495583_0006339 3300046506 Bacteria 7759
165 Ga0495583_0108035 3300046506 Bacteria 1181
166 Ga0495606_0078929 3300046507 Bacteria 2052
167 Ga0495606_0091010 3300046507 Bacteria 1876
168 Ga0495610_0019970 3300046512 Bacteria 3733
169 Ga0495610_0127169 3300046512 Bacteria 1110
170 Ga0495616_0019461 3300046513 Bacteria 3705
171 Ga0495620_0024363 3300046515 Bacteria 2879
172 Ga0495631_0001140 3300046518 Bacteria 16466
173 Ga0495632_0108926 3300046519 Bacteria 1301
174 Ga0495643_0045482 3300046522 Bacteria 2382
175 Ga0495648_0207545 3300046524 Bacteria 976
176 Ga0495663_0097190 3300046525 Bacteria 966
177 Ga0495654_0139472 3300046530 Bacteria 1082
178 Ga0495633_0044996 3300046558 Bacteria 2091
179 Ga0495668_0004115 3300046616 Bacteria 10534
180 Ga0495611_0008321 3300046648 Bacteria 4393
181 Ga0495625_0004231 3300046660 Bacteria 13678
182 Ga0495625_0200473 3300046660 Bacteria 1317
183 Ga0495625_0222242 3300046660 Bacteria 1237
184 Ga0495588_0000806 3300046674 Bacteria 14026
185 Ga0495670_0090703 3300046691 Bacteria 1564
186 Ga0495671_0261703 3300046692 Bacteria 834
187 Ga0495687_021348 3300047443 Bacteria 3134
188 Ga0495685_047744 3300047447 Bacteria 1456
189 Ga0495686_0043023 3300047472 Bacteria 2867
190 Ga0496100_0020490 3300048903 Bacteria 3965
191 Ga0496102_0007987 3300048905 Bacteria 9042
192 Ga0496103_0002987 3300048906 Bacteria 10461
193 Ga0496104_0088054 3300048907 Bacteria 2966
194 Ga0496106_0006201 3300048909 Bacteria 8843
195 Ga0496106_0032960 3300048909 Bacteria 3863
196 Ga0496113_0167059 3300048916 Bacteria 1741
197 Ga0496116_0000100 3300048919 Bacteria 194740
198 Ga0496116_0002602 3300048919 Bacteria 18765
199 Ga0496116_0053667 3300048919 Unclassified 2660
200 Ga0496116_0055863 3300048919 Bacteria 2591
201 Ga0496117_0000002 3300048920 Bacteria 2483758
202 Ga0496117_0001819 3300048920 Bacteria 28947
203 Ga0496117_0085537 3300048920 Bacteria 2052
204 Ga0496117_0134246 3300048920 Bacteria 1494
205 Ga0496117_0218569 3300048920 Bacteria 1062
206 Ga0496118_0000776 3300048921 Bacteria 51291
207 Ga0496118_0001431 3300048921 Bacteria 35926
208 Ga0496118_0012825 3300048921 Bacteria 8000
209 Ga0496119_0004023 3300048922 Bacteria 14858
210 Ga0496119_0014626 3300048922 Bacteria 6117
211 Ga0496119_0015097 3300048922 Bacteria 5979
212 Ga0496119_0169551 3300048922 Bacteria 1154
213 Ga0496120_0000034 3300048923 Bacteria 215228
214 Ga0496120_0005580 3300048923 Bacteria 9988
215 Ga0496120_0060328 3300048923 Bacteria 2122
216 Ga0496121_0000005 3300048924 Bacteria 1034486
217 Ga0496121_0002730 3300048924 Bacteria 26286
218 Ga0496121_0024048 3300048924 Bacteria 5838
219 Ga0496121_0318598 3300048924 Bacteria 1048
220 Ga0496122_0000001 3300048925 Bacteria 1827766
221 Ga0496122_0005818 3300048925 Bacteria 14496
222 Ga0496122_0006750 3300048925 Bacteria 13064
223 Ga0496122_0016384 3300048925 Bacteria 7016
224 Ga0496122_0018531 3300048925 Bacteria 6424
225 Ga0496122_0160807 3300048925 Bacteria 1369
226 Ga0496122_0168498 3300048925 Bacteria 1324
227 Ga0496123_0000001 3300048926 Bacteria 1831497
228 Ga0496123_0007220 3300048926 Bacteria 10543
229 Ga0496123_0007700 3300048926 Bacteria 10059
230 Ga0496123_0027998 3300048926 Bacteria 4182
231 Ga0496123_0124672 3300048926 Unclassified 1440
232 Ga0496124_0000063 3300048927 Bacteria 229705
233 Ga0496124_0004942 3300048927 Bacteria 15279
234 Ga0496124_0039868 3300048927 Bacteria 4066
235 Ga0496124_0082632 3300048927 Bacteria 2636
236 Ga0496124_0183575 3300048927 Bacteria 1607
237 Ga0496125_0000107 3300048928 Bacteria 197483
238 Ga0496125_0005338 3300048928 Bacteria 14357
239 Ga0496125_0010068 3300048928 Bacteria 9593
240 Ga0496125_0025248 3300048928 Bacteria 5446
241 Ga0496125_0140495 3300048928 Bacteria 1680
242 Ga0496125_0226290 3300048928 Bacteria 1200
243 Ga0496125_0307585 3300048928 Bacteria 967
244 Ga0496126_0000311 3300048929 Bacteria 103353
245 Ga0496126_0041885 3300048929 Bacteria 4233
246 Ga0496126_0187257 3300048929 Bacteria 1754
247 Ga0495678_017044 3300049459 Bacteria 3303
248 Ga0495682_0063390 3300049460 Bacteria 1333
249 Ga0501031_0037990 3300049568 Bacteria 3143
250 Ga0501032_0016183 3300049569 Bacteria 5249
251 Ga0501033_0000848 3300049570 Bacteria 27906
252 Ga0501038_0030980 3300049574 Bacteria 4729
253 Ga0501039_0036846 3300049575 Bacteria 3774
254 Ga0501043_0062708 3300049579 Bacteria 2919
255 Ga0501046_0250109 3300049580 Bacteria 1305
256 Ga0501047_0197338 3300049581 Bacteria 1874
257 Ga0501068_0091222 3300049584 Bacteria 1880
258 Ga0501073_0037450 3300049589 Bacteria 3444
259 Ga0501035_0000378 3300049822 Bacteria 51250
260 nmdc:mga03n38_6281_c1 3300050490 Bacteria 4117
261 nmdc:mga00v17_3852_c1 3300050491 Bacteria 7741
262 nmdc:mga00v17_48_c1 3300050491 Bacteria 75606
263 nmdc:mga0yw44_64046_c1 3300050492 Bacteria 2262
264 nmdc:mga04h51_33019_c1 3300050495 Bacteria 1645
265 nmdc:mga07m45_42017_c1 3300050496 Bacteria 2562
266 nmdc:mga0sz30_1315_c1 3300050516 Bacteria 8833
267 nmdc:mga0sz30_26121_c1 3300050516 Bacteria 2391
268 nmdc:mga0sz30_66536_c1 3300050516 Bacteria 1546
269 Ga0500610_0009480 3300053079 Bacteria 4319
270 Ga0500578_0075429 3300053086 Bacteria 2148
271 Ga0500643_062444 3300053087 Bacteria 1044
272 Ga0500557_000447 3300053105 Bacteria 5427
273 Ga0500560_001304 3300053107 Bacteria 4238
274 Ga0500569_005957 3300053109 Bacteria 2646
275 Ga0500569_079454 3300053109 Bacteria 1046
276 Ga0500572_020979 3300053111 Bacteria 1725
277 Ga0500618_000743 3300053125 Bacteria 18539
278 Ga0500658_0009334 3300053134 Bacteria 3617
279 Ga0500561_0000031 3300053137 Bacteria 28771
280 Ga0500568_0005217 3300053139 Bacteria 6764
281 Ga0500568_0025303 3300053139 Bacteria 2506
282 Ga0500573_0000473 3300053140 Bacteria 17324
283 Ga0500577_0029439 3300053142 Bacteria 1902
284 Ga0500616_0071518 3300053153 Bacteria 1766
285 Ga0500622_0001167 3300053156 Bacteria 21767
286 Ga0500624_001155 3300053157 Bacteria 4830
287 Ga0500633_0006102 3300053160 Bacteria 2928
288 Ga0500634_0036652 3300053161 Bacteria 2669
289 Ga0500636_0000006 3300053177 Bacteria 183899
290 Ga0500636_0002632 3300053177 Bacteria 9981
291 Ga0500599_009957 3300053736 Bacteria 1252
292 Ga0501082_0051578 3300060353 Bacteria 3546

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046692 Ga0495671_0261703 Ga0495671_0261703_36_782 248
2 3300047447 Ga0495685_047744 Ga0495685_047744_10_816 268
3 3300049579 Ga0501043_0062708 Ga0501043_0062708_611_1543 274
4 3300049580 Ga0501046_0250109 Ga0501046_0250109_50_982 274
5 3300049581 Ga0501047_0197338 Ga0501047_0197338_548_1480 274
6 3300049584 Ga0501068_0091222 Ga0501068_0091222_545_1477 274
7 3300060353 Ga0501082_0051578 Ga0501082_0051578_1087_2019 274
8 3300046452 Ga0495617_103846 Ga0495617_103846_14_841 275
9 3300046525 Ga0495663_0097190 Ga0495663_0097190_18_845 275
10 3300048924 Ga0496121_0318598 Ga0496121_0318598_211_1038 275
11 3300046507 Ga0495606_0078929 Ga0495606_0078929_14_853 279
12 3300048928 Ga0496125_0140495 Ga0496125_0140495_794_1663 279
13 3300041491 Ga0451833_0035375 Ga0451833_0035375_125_1057 282
14 3300041509 Ga0451843_0153037 Ga0451843_0153037_55_987 286
15 3300041512 Ga0451853_0242547 Ga0451853_0242547_267_1199 286
16 3300003187 JGI25151J46595_10001413 JGI25151J46595_100014134 288
17 3300003354 JGI25160J50197_1000514 JGI25160J50197_10005149 288
18 3300003374 JGI25161J50226_1001407 JGI25161J50226_10014077 288
19 3300003771 Ga0055526_1008064 Ga0055526_10080642 288
20 3300005262 Ga0065165_1029217 Ga0065165_10292172 288
21 3300006038 Ga0075365_10003496 Ga0075365_100034963 288
22 3300006048 Ga0075363_100033852 Ga0075363_1000338524 288
23 3300006177 Ga0075362_10001262 Ga0075362_100012627 288
24 3300006178 Ga0075367_10019433 Ga0075367_100194333 288
25 3300006186 Ga0075369_10012293 Ga0075369_100122932 288
26 3300006186 Ga0075369_10020885 Ga0075369_100208852 288
27 3300006353 Ga0075370_10020049 Ga0075370_100200492 288
28 3300025245 Ga0207425_1006389 Ga0207425_10063891 288
29 3300025258 Ga0209129_1002388 Ga0209129_10023889 288
30 3300025294 Ga0209025_1000638 Ga0209025_100063817 288
31 3300025295 Ga0209564_1016624 Ga0209564_10166242 288
32 3300025297 Ga0209758_1000361 Ga0209758_100036135 288
33 3300025297 Ga0209758_1001299 Ga0209758_100129916 288
34 3300025299 Ga0209256_1004658 Ga0209256_10046586 288
35 3300025302 Ga0207426_1000070 Ga0207426_1000070194 288
36 3300025303 Ga0209051_1035340 Ga0209051_10353402 288
37 3300049568 Ga0501031_0037990 Ga0501031_0037990_1093_2025 288
38 3300049569 Ga0501032_0016183 Ga0501032_0016183_3065_3997 288
39 3300049574 Ga0501038_0030980 Ga0501038_0030980_1405_2337 288
40 3300049575 Ga0501039_0036846 Ga0501039_0036846_1365_2297 288
41 3300050492 nmdc:mga0yw44_64046_c1 nmdc:mga0yw44_64046_c1_701_1630 288
42 3300050495 nmdc:mga04h51_33019_c1 nmdc:mga04h51_33019_c1_497_1426 288
43 3300050496 nmdc:mga07m45_42017_c1 nmdc:mga07m45_42017_c1_801_1730 288
44 3300050516 nmdc:mga0sz30_26121_c1 nmdc:mga0sz30_26121_c1_1075_2007 288
45 3300050516 nmdc:mga0sz30_66536_c1 nmdc:mga0sz30_66536_c1_282_1211 288
46 3300002739 JGI25158J39367_1000090 JGI25158J39367_10000905 289
47 3300002773 JGI25152J39213_1000500 JGI25152J39213_100050017 289
48 3300002987 JGI25159J45721_1001485 JGI25159J45721_10014859 289
49 3300003215 JGI25153J46596_10000786 JGI25153J46596_100007864 289
50 3300003354 JGI25160J50197_1002856 JGI25160J50197_10028565 289
51 3300003374 JGI25161J50226_1000184 JGI25161J50226_100018419 289
52 3300003771 Ga0055526_1002842 Ga0055526_10028425 289
53 3300003775 Ga0055524_1007423 Ga0055524_10074231 289
54 3300003792 Ga0055540_1004939 Ga0055540_10049396 289
55 3300004625 Ga0055543_1000059 Ga0055543_1000059103 289
56 3300005262 Ga0065165_1005797 Ga0065165_10057978 289
57 3300025208 Ga0209436_100006 Ga0209436_100006113 289
58 3300025258 Ga0209129_1000429 Ga0209129_100042928 289
59 3300025273 Ga0209673_1002293 Ga0209673_100229310 289
60 3300025284 Ga0209130_1000002 Ga0209130_1000002249 289
61 3300025295 Ga0209564_1002071 Ga0209564_100207114 289
62 3300025297 Ga0209758_1002582 Ga0209758_100258212 289
63 3300025299 Ga0209256_1002179 Ga0209256_100217912 289
64 3300025302 Ga0207426_1000013 Ga0207426_1000013249 289
65 3300025303 Ga0209051_1019730 Ga0209051_10197301 289
66 3300048909 Ga0496106_0006201 Ga0496106_0006201_3279_4262 289
67 3300049460 Ga0495682_0063390 Ga0495682_0063390_13_882 289
68 3300053087 Ga0500643_062444 Ga0500643_062444_153_1022 289
69 3300053109 Ga0500569_079454 Ga0500569_079454_165_1034 289
70 3300003790 Ga0055528_1007385 Ga0055528_10073854 290
71 3300005347 Ga0070668_100224115 Ga0070668_1002241152 290
72 3300005353 Ga0070669_100171987 Ga0070669_1001719872 290
73 3300025273 Ga0209673_1007036 Ga0209673_10070366 290
74 3300046506 Ga0495583_0108035 Ga0495583_0108035_216_1148 290
75 3300046512 Ga0495610_0019970 Ga0495610_0019970_2628_3560 290
76 3300046512 Ga0495610_0127169 Ga0495610_0127169_123_1055 290
77 3300046524 Ga0495648_0207545 Ga0495648_0207545_28_960 290
78 3300046660 Ga0495625_0200473 Ga0495625_0200473_281_1213 290
79 3300047443 Ga0495687_021348 Ga0495687_021348_293_1225 290
80 3300048920 Ga0496117_0134246 Ga0496117_0134246_471_1403 290
81 3300048924 Ga0496121_0024048 Ga0496121_0024048_2221_3153 290
82 3300048925 Ga0496122_0016384 Ga0496122_0016384_1242_2174 290
83 3300048926 Ga0496123_0007220 Ga0496123_0007220_697_1629 290
84 3300048927 Ga0496124_0183575 Ga0496124_0183575_124_1056 290
85 3300048928 Ga0496125_0010068 Ga0496125_0010068_6587_7519 290
86 3300053125 Ga0500618_000743 Ga0500618_000743_1898_2833 290
87 3300053139 Ga0500568_0025303 Ga0500568_0025303_42_974 290
88 3300053156 Ga0500622_0001167 Ga0500622_0001167_17644_18576 290
89 3300009765 Ga0123341_1000067 Ga0123341_100006740 291
90 3300025245 Ga0207425_1005750 Ga0207425_10057504 292
91 3300025258 Ga0209129_1001523 Ga0209129_10015237 292
92 3300025297 Ga0209758_1000876 Ga0209758_100087612 292
93 3300048920 Ga0496117_0218569 Ga0496117_0218569_14_892 292
94 3300044765 Ga0466970_0042101 Ga0466970_0042101_19_900 293
95 3300048922 Ga0496119_0169551 Ga0496119_0169551_226_1137 293
96 3300048925 Ga0496122_0006750 Ga0496122_0006750_3192_4073 293
97 3300049589 Ga0501073_0037450 Ga0501073_0037450_406_1338 294
98 iso_pu_bacteria 2523231067 2523467009 296
99 iso_pu_bacteria 2738543031 2739348576 296
100 3300041463 Ga0451804_0526355 Ga0451804_0526355_183_1115 297
101 iso_pu_bacteria 2917554339 2917556252 300
102 iso_pu_bacteria 2600254933 2600376497 304
103 iso_pu_bacteria 2516653077 2517038855 305
104 iso_pu_bacteria 2585427528 2585542023 305
105 iso_pu_bacteria 2585427593 2585840329 305
106 iso_pu_bacteria 2738541333 2739036741 305
107 iso_pu_bacteria 2802429633 2806048441 305
108 iso_pu_bacteria 2802429634 2806055922 305
109 iso_pu_bacteria 2802429635 2806062750 305
110 iso_pu_bacteria 2802429636 2806066442 305
111 iso_pu_bacteria 2802429637 2806073497 305
112 iso_pu_bacteria 8005570704 8005573695 305
113 iso_pu_bacteria 2509276021 2509388628 306
114 iso_pu_bacteria 2510065019 2510131230 306
115 iso_pu_bacteria 2510461076 2510897566 306
116 iso_pu_bacteria 2510917030 2511197718 306
117 iso_pu_bacteria 2513237084 2513570435 306
118 iso_pu_bacteria 2513237085 2513574562 306
119 iso_pu_bacteria 2513237088 2513597268 306
120 iso_pu_bacteria 2513237093 2513635894 306
121 iso_pu_bacteria 2513237103 2513707163 306
122 iso_pu_bacteria 2513237162 2514020443 306
123 iso_pu_bacteria 2515075009 2515110163 306
124 iso_pu_bacteria 2515154113 2515637483 306
125 iso_pu_bacteria 2515154114 2515643605 306
126 iso_pu_bacteria 2515154116 2515657000 306
127 iso_pu_bacteria 2515154134 2515740764 306
128 iso_pu_bacteria 2516653085 2517079102 306
129 iso_pu_bacteria 2517093000 2517093044 306
130 iso_pu_bacteria 2517287029 2517409321 306
131 iso_pu_bacteria 2519899620 2520375681 306
132 iso_pu_bacteria 2529292951 2530648001 306
133 iso_pu_bacteria 2582581298 2585223605 306
134 iso_pu_bacteria 2582581299 2585229666 306
135 iso_pu_bacteria 2585427526 2585523561 306
136 iso_pu_bacteria 2585427529 2585545799 306
137 iso_pu_bacteria 2615840624 2616293614 306
138 iso_pu_bacteria 2643221558 2643812767 306
139 iso_pu_bacteria 2643221634 2644190404 306
140 iso_pu_bacteria 2643221643 2644237337 306
141 iso_pu_bacteria 2718217882 2719179367 306
142 iso_pu_bacteria 2718217927 2719383939 306
143 iso_pu_bacteria 2718217997 2719663728 306
144 iso_pu_bacteria 2718218009 2719730037 306
145 iso_pu_bacteria 2718218199 2720490147 306
146 iso_pu_bacteria 2718218232 2720611527 306
147 iso_pu_bacteria 2718218233 2720618377 306
148 iso_pu_bacteria 2718218235 2720629784 306
149 iso_pu_bacteria 2718218269 2720773479 306
150 iso_pu_bacteria 2718218363 2721145460 306
151 iso_pu_bacteria 2718218365 2721156994 306
152 iso_pu_bacteria 2718218366 2721162355 306
153 iso_pu_bacteria 2718218423 2721397709 306
154 iso_pu_bacteria 2721755514 2722838525 306
155 iso_pu_bacteria 2721755556 2723025149 306
156 iso_pu_bacteria 2721755684 2723558734 306
157 iso_pu_bacteria 2721755685 2723565305 306
158 iso_pu_bacteria 2721755809 2724036519 306
159 iso_pu_bacteria 2721755810 2724042793 306
160 iso_pu_bacteria 2721755819 2724088086 306
161 iso_pu_bacteria 2721755822 2724102570 306
162 iso_pu_bacteria 2721755823 2724108467 306
163 iso_pu_bacteria 2724679232 2725945508 306
164 iso_pu_bacteria 2728369352 2730106085 306
165 iso_pu_bacteria 2728369365 2730162604 306
166 iso_pu_bacteria 2728369397 2730296626 306
167 iso_pu_bacteria 2791355256 2793299875 306
168 iso_pu_bacteria 2791355260 2793325093 306
169 iso_pu_bacteria 2791355261 2793326335 306
170 iso_pu_bacteria 2791355262 2793338434 306
171 iso_pu_bacteria 2791355263 2793344222 306
172 iso_pu_bacteria 2791355267 2793365695 306
173 iso_pu_bacteria 2838016132 2838020096 306
174 iso_pu_bacteria 2838022645 2838027664 306
175 iso_pu_bacteria 2838042994 2838048680 306
176 iso_pu_bacteria 2838048938 2838054625 306
177 iso_pu_bacteria 2838061910 2838064254 306
178 iso_pu_bacteria 2838068647 2838070923 306
179 iso_pu_bacteria 2838680041 2838680404 306
180 iso_pu_bacteria 2838686498 2838693665 306
181 iso_pu_bacteria 2838694306 2838695563 306
182 iso_pu_bacteria 2838707686 2838708940 306
183 iso_pu_bacteria 2838729681 2838736341 306
184 iso_pu_bacteria 2838742623 2838749160 306
185 iso_pu_bacteria 2841851746 2841858457 306
186 iso_pu_bacteria 2842077413 2842079825 306
187 iso_pu_bacteria 2842110456 2842112005 306
188 iso_pu_bacteria 2842118031 2842120443 306
189 iso_pu_bacteria 2842156927 2842163333 306
190 iso_pu_bacteria 2842163707 2842165365 306
191 iso_pu_bacteria 2842180545 2842186902 306
192 iso_pu_bacteria 2842198810 2842204221 306
193 iso_pu_bacteria 2842205361 2842207126 306
194 iso_pu_bacteria 2842217011 2842219031 306
195 iso_pu_bacteria 2842229732 2842236480 306
196 iso_pu_bacteria 2842237096 2842238351 306
197 iso_pu_bacteria 2842243621 2842250059 306
198 iso_pu_bacteria 2842257432 2842264128 306
199 iso_pu_bacteria 2842264693 2842270711 306
200 iso_pu_bacteria 2842271015 2842278261 306
201 iso_pu_bacteria 2842278818 2842280181 306
202 iso_pu_bacteria 2842285085 2842286637 306
203 iso_pu_bacteria 2842291075 2842293486 306
204 iso_pu_bacteria 2842304105 2842310451 306
205 iso_pu_bacteria 2842311132 2842312812 306
206 iso_pu_bacteria 2842341865 2842343266 306
207 iso_pu_bacteria 2842363717 2842370464 306
208 iso_pu_bacteria 2842370503 2842370867 306
209 iso_pu_bacteria 2842377471 2842379883 306
210 iso_pu_bacteria 2842384541 2842386954 306
211 iso_pu_bacteria 2842395702 2842399037 306
212 iso_pu_bacteria 2842402390 2842403810 306
213 iso_pu_bacteria 2842409023 2842410488 306
214 iso_pu_bacteria 2842415677 2842417135 306
215 iso_pu_bacteria 2842422224 2842424538 306
216 iso_pu_bacteria 2842428310 2842434595 306
217 iso_pu_bacteria 2842434925 2842440945 306
218 iso_pu_bacteria 2842441272 2842447583 306
219 iso_pu_bacteria 2842447887 2842454280 306
220 iso_pu_bacteria 2842462802 2842468956 306
221 iso_pu_bacteria 2842469257 2842475509 306
222 iso_pu_bacteria 2844454524 2844456209 306
223 iso_pu_bacteria 2857516855 2857521876 306
224 iso_pu_bacteria 2919100787 2919101512 306
225 iso_pu_bacteria 2933570622 2933576890 306
226 iso_pu_bacteria 2933586486 2933587334 306
227 iso_pu_bacteria 2933599457 2933601722 306
228 iso_pu_bacteria 2935894831 2935896087 306
229 iso_pu_bacteria 2935901341 2935902714 306
230 iso_pu_bacteria 2936367885 2936369137 306
231 iso_pu_bacteria 2936375103 2936377520 306
232 iso_pu_bacteria 2936381700 2936383568 306
233 iso_pu_bacteria 3005445848 3005446023 306
234 iso_pu_bacteria 639633055 639646451 306
235 iso_pu_bacteria 8005275841 8005278649 306
236 iso_pu_bacteria 8005282627 8005289198 306
237 iso_pu_bacteria 8005289223 8005291268 306
238 iso_pu_bacteria 8005301065 8005301358 306
239 iso_pu_bacteria 8005307578 8005310641 306
240 iso_pu_bacteria 8005376324 8005377629 306
241 iso_pu_bacteria 8005430974 8005432743 306
242 iso_pu_bacteria 8005460587 8005460800 306
243 iso_pu_bacteria 8005497431 8005498472 306
244 iso_pu_bacteria 8005619151 8005619664 306
245 iso_pu_bacteria 8005626139 8005628234 306
246 iso_pu_bacteria 8005668836 8005669882 306
247 iso_pu_bacteria 8005688590 8005692434 306
248 iso_pu_bacteria 8005695170 8005699469 306
249 iso_pu_bacteria 8018127388 8018132905 306
250 iso_pu_bacteria 8018150411 8018154469 306
251 iso_pu_bacteria 8018176218 8018181025 306
252 iso_pu_bacteria 8023680758 8023684444 306
253 iso_pu_bacteria 8024479707 8024480089 306
254 iso_pu_bacteria 8057874678 8057875836 306
255 iso_pu_bacteria 2841864319 2841867001 307
256 iso_pu_bacteria 8005382845 8005387476 307
257 iso_pu_bacteria 8005556819 8005560410 307
258 iso_pu_bacteria 8005563573 8005564130 307
259 iso_pu_bacteria 8018163183 8018165400 307
260 iso_pu_bacteria 8056375014 8056378588 307
261 3300041413 Ga0439465_0008850 Ga0439465_0008850_347_1300 308
262 iso_pu_bacteria 2513237146 2513929376 308
263 3300003215 JGI25153J46596_10005878 JGI25153J46596_100058784 309
264 3300003775 Ga0055524_1002851 Ga0055524_10028519 309
265 3300025273 Ga0209673_1007671 Ga0209673_10076711 309
266 iso_pu_bacteria 2537561587 2537873240 309
267 iso_pu_bacteria 2554235003 2554246521 309
268 iso_pu_bacteria 2558860242 2559293696 309
269 iso_pu_bacteria 2599185210 2599606500 309
270 iso_pu_bacteria 2600255279 2601609279 309
271 iso_pu_bacteria 2600255308 2601746054 309
272 iso_pu_bacteria 2643221582 2643918290 309
273 iso_pu_bacteria 2643221693 2644519337 309
274 iso_pu_bacteria 2808606387 2808986474 309
275 iso_pu_bacteria 2818991439 2819556604 309
276 iso_pu_bacteria 2838675328 2838677333 309
277 iso_pu_bacteria 2838714209 2838716221 309
278 iso_pu_bacteria 2838719591 2838719979 309
279 iso_pu_bacteria 2838724970 2838726973 309
280 iso_pu_bacteria 2841846520 2841846911 309
281 iso_pu_bacteria 2841859092 2841860561 309
282 iso_pu_bacteria 2842124991 2842127060 309
283 iso_pu_bacteria 2842130223 2842132226 309
284 iso_pu_bacteria 2842152218 2842152605 309
285 iso_pu_bacteria 2842170452 2842172466 309
286 iso_pu_bacteria 2842175837 2842176224 309
287 iso_pu_bacteria 2842187318 2842189328 309
288 iso_pu_bacteria 2842211629 2842213642 309
289 iso_pu_bacteria 2842224351 2842224740 309
290 iso_pu_bacteria 2842515876 2842517346 309
291 iso_pu_bacteria 2899792073 2899795151 309
292 iso_pu_bacteria 2899845264 2899845988 309
293 iso_pu_bacteria 2919114240 2919116425 309
294 iso_pu_bacteria 2926754445 2926757378 309
295 iso_pu_bacteria 2926760298 2926761622 309
296 iso_pu_bacteria 2929138655 2929143526 309
297 iso_pu_bacteria 2933006813 2933007250 309
298 iso_pu_bacteria 2933011516 2933015159 309
299 iso_pu_bacteria 2933594066 2933594454 309
300 iso_pu_bacteria 2979089926 2979093116 309
301 iso_pu_bacteria 2979095461 2979099496 309
302 iso_pu_bacteria 2979100975 2979105083 309
303 iso_pu_bacteria 2984509177 2984513103 309
304 iso_pu_bacteria 2984518228 2984520531 309
305 iso_pu_bacteria 2984537506 2984539826 309
306 iso_pu_bacteria 2984601300 2984602061 309
307 iso_pu_bacteria 2989771324 2989772649 309
308 iso_pu_bacteria 650716007 650738939 309
309 iso_pu_bacteria 8003570095 8003572570 309
310 iso_pu_bacteria 8054558443 8054563032 309
311 3300002773 JGI25152J39213_1005013 JGI25152J39213_10050134 310
312 3300002773 JGI25152J39213_1006168 JGI25152J39213_10061685 310
313 3300003215 JGI25153J46596_10006808 JGI25153J46596_100068084 310
314 3300003771 Ga0055526_1013663 Ga0055526_10136634 310
315 3300003775 Ga0055524_1011936 Ga0055524_10119364 310
316 3300003790 Ga0055528_1000618 Ga0055528_100061814 310
317 3300003792 Ga0055540_1000190 Ga0055540_100019018 310
318 3300025258 Ga0209129_1000105 Ga0209129_100010581 310
319 3300025273 Ga0209673_1000063 Ga0209673_1000063140 310
320 3300025273 Ga0209673_1001004 Ga0209673_100100417 310
321 3300025294 Ga0209025_1003060 Ga0209025_100306015 310
322 3300025295 Ga0209564_1000316 Ga0209564_100031682 310
323 3300025297 Ga0209758_1010392 Ga0209758_10103926 310
324 3300025297 Ga0209758_1012983 Ga0209758_10129834 310
325 3300025298 Ga0209050_1006814 Ga0209050_10068146 310
326 3300025299 Ga0209256_1000880 Ga0209256_100088025 310
327 3300025303 Ga0209051_1000135 Ga0209051_100013564 310
328 3300025303 Ga0209051_1019270 Ga0209051_10192704 310
329 3300025304 Ga0209257_1009466 Ga0209257_10094667 310
330 3300028794 Ga0307515_10095784 Ga0307515_100957843 310
331 3300031456 Ga0307513_10074506 Ga0307513_100745063 310
332 3300041413 Ga0439465_0042632 Ga0439465_0042632_457_1440 310
333 3300041413 Ga0439465_0056448 Ga0439465_0056448_203_1135 310
334 3300042147 Ga0450910_018882 Ga0450910_018882_63_998 310
335 3300046492 Ga0495585_0009240 Ga0495585_0009240_2900_3832 310
336 3300046492 Ga0495585_0013281 Ga0495585_0013281_976_1908 310
337 3300046501 Ga0495607_0050812 Ga0495607_0050812_1448_2380 310
338 3300046506 Ga0495583_0003772 Ga0495583_0003772_3678_4610 310
339 3300046506 Ga0495583_0006339 Ga0495583_0006339_5137_6069 310
340 3300046507 Ga0495606_0091010 Ga0495606_0091010_881_1813 310
341 3300046513 Ga0495616_0019461 Ga0495616_0019461_2560_3492 310
342 3300046515 Ga0495620_0024363 Ga0495620_0024363_1512_2444 310
343 3300046518 Ga0495631_0001140 Ga0495631_0001140_3904_4836 310
344 3300046519 Ga0495632_0108926 Ga0495632_0108926_53_985 310
345 3300046522 Ga0495643_0045482 Ga0495643_0045482_603_1535 310
346 3300046530 Ga0495654_0139472 Ga0495654_0139472_68_1027 310
347 3300046616 Ga0495668_0004115 Ga0495668_0004115_4503_5435 310
348 3300046648 Ga0495611_0008321 Ga0495611_0008321_2999_3931 310
349 3300046660 Ga0495625_0004231 Ga0495625_0004231_12482_13414 310
350 3300046691 Ga0495670_0090703 Ga0495670_0090703_268_1200 310
351 3300048920 Ga0496117_0085537 Ga0496117_0085537_136_1068 310
352 3300048921 Ga0496118_0012825 Ga0496118_0012825_2812_3744 310
353 3300049459 Ga0495678_017044 Ga0495678_017044_47_979 310
354 3300053079 Ga0500610_0009480 Ga0500610_0009480_1098_2030 310
355 3300053086 Ga0500578_0075429 Ga0500578_0075429_600_1532 310
356 3300053105 Ga0500557_000447 Ga0500557_000447_2794_3726 310
357 3300053109 Ga0500569_005957 Ga0500569_005957_14_946 310
358 3300053134 Ga0500658_0009334 Ga0500658_0009334_858_1790 310
359 3300053139 Ga0500568_0005217 Ga0500568_0005217_2837_3820 310
360 3300053142 Ga0500577_0029439 Ga0500577_0029439_404_1336 310
361 3300053153 Ga0500616_0071518 Ga0500616_0071518_165_1097 310
362 3300053160 Ga0500633_0006102 Ga0500633_0006102_1522_2505 310
363 3300053736 Ga0500599_009957 Ga0500599_009957_128_1060 310
364 iso_pu_bacteria 2509276033 2509444178 310
365 iso_pu_bacteria 2510917022 2511134749 310
366 iso_pu_bacteria 2524023209 2524458237 310
367 iso_pu_bacteria 2582581307 2585273816 310
368 iso_pu_bacteria 2582581308 2585280118 310
369 iso_pu_bacteria 2582581315 2585326103 310
370 iso_pu_bacteria 2582581316 2585330268 310
371 iso_pu_bacteria 2585427527 2585533631 310
372 iso_pu_bacteria 2585427530 2585553222 310
373 iso_pu_bacteria 2585427531 2585559992 310
374 iso_pu_bacteria 2585427608 2585900667 310
375 iso_pu_bacteria 2585427609 2585905828 310
376 iso_pu_bacteria 2585428125 2587979056 310
377 iso_pu_bacteria 2615840626 2616310335 310
378 iso_pu_bacteria 2615840698 2616553286 310
379 iso_pu_bacteria 2617270742 2617380382 310
380 iso_pu_bacteria 2643221568 2643857276 310
381 iso_pu_bacteria 2667528174 2671113785 310
382 iso_pu_bacteria 2775507049 2776911926 310
383 iso_pu_bacteria 2775507266 2778179592 310
384 iso_pu_bacteria 2791355259 2793317988 310
385 iso_pu_bacteria 2818991448 2819608531 310
386 iso_pu_bacteria 2818991453 2819640639 310
387 iso_pu_bacteria 2838029111 2838029414 310
388 iso_pu_bacteria 2842298080 2842299577 310
389 iso_pu_bacteria 2842357229 2842361005 310
390 iso_pu_bacteria 2842475841 2842476156 310
391 iso_pu_bacteria 2842482326 2842487622 310
392 iso_pu_bacteria 2842502639 2842502942 310
393 iso_pu_bacteria 2842509118 2842512792 310
394 iso_pu_bacteria 2852387548 2852388346 310
395 iso_pu_bacteria 2919166419 2919166748 310
396 iso_pu_bacteria 2919408235 2919408677 310
397 iso_pu_bacteria 2978969890 2978973147 310
398 iso_pu_bacteria 2984587000 2984591416 310
399 iso_pu_bacteria 2996887358 2996888342 310
400 iso_pu_bacteria 3005416602 3005422932 310
401 iso_pu_bacteria 8005314921 8005321532 310
402 iso_pu_bacteria 8005484373 8005484823 310
403 iso_pu_bacteria 8005645114 8005649518 310
404 iso_pu_bacteria 8005682033 8005685239 310
405 iso_pu_bacteria 8046767195 8046770827 310
406 iso_pu_bacteria 8054460903 8054461201 310
407 iso_pu_bacteria 8057575449 8057580567 310
408 3300031901 Ga0307406_10157291 Ga0307406_101572911 312
409 3300049570 Ga0501033_0000848 Ga0501033_0000848_12142_13134 312
410 3300049822 Ga0501035_0000378 Ga0501035_0000378_23210_24202 312
411 3300003187 JGI25151J46595_10003099 JGI25151J46595_100030996 313
412 3300003856 Ga0058692_1004991 Ga0058692_10049913 313
413 3300003856 Ga0058692_1009206 Ga0058692_10092064 313
414 3300005548 Ga0070665_100006477 Ga0070665_10000647710 313
415 3300006042 Ga0075368_10001661 Ga0075368_100016615 313
416 3300006048 Ga0075363_100025110 Ga0075363_1000251104 313
417 3300006051 Ga0075364_10025007 Ga0075364_100250076 313
418 3300006177 Ga0075362_10006195 Ga0075362_100061954 313
419 3300006178 Ga0075367_10003001 Ga0075367_100030018 313
420 3300006195 Ga0075366_10024187 Ga0075366_100241874 313
421 3300006948 Ga0099826_10000109 Ga0099826_1000010936 313
422 3300009148 Ga0105243_10004195 Ga0105243_100041956 313
423 3300013100 Ga0157373_10015828 Ga0157373_100158286 313
424 3300013102 Ga0157371_10000004 Ga0157371_10000004378 313
425 3300013104 Ga0157370_10000185 Ga0157370_1000018557 313
426 3300025294 Ga0209025_1000060 Ga0209025_1000060238 313
427 3300027312 Ga0209371_1000009 Ga0209371_1000009567 313
428 3300027312 Ga0209371_1000697 Ga0209371_100069713 313
429 3300027666 Ga0209282_1000263 Ga0209282_100026318 313
430 3300027866 Ga0209813_10006401 Ga0209813_100064013 313
431 3300028379 Ga0268266_10057879 Ga0268266_100578791 313
432 3300030500 Ga0268256_1000010 Ga0268256_1000010566 313
433 3300030500 Ga0268256_1002955 Ga0268256_10029558 313
434 3300046558 Ga0495633_0044996 Ga0495633_0044996_484_1500 313
435 3300046674 Ga0495588_0000806 Ga0495588_0000806_10045_10986 313
436 3300048907 Ga0496104_0088054 Ga0496104_0088054_1953_2894 313
437 3300048919 Ga0496116_0053667 Ga0496116_0053667_784_1725 313
438 3300048919 Ga0496116_0055863 Ga0496116_0055863_665_1606 313
439 3300048920 Ga0496117_0000002 Ga0496117_0000002_2080012_2080953 313
440 3300048921 Ga0496118_0000776 Ga0496118_0000776_43922_44863 313
441 3300048922 Ga0496119_0014626 Ga0496119_0014626_218_1159 313
442 3300048922 Ga0496119_0015097 Ga0496119_0015097_4507_5448 313
443 3300048923 Ga0496120_0000034 Ga0496120_0000034_13313_14254 313
444 3300048924 Ga0496121_0000005 Ga0496121_0000005_479712_480653 313
445 3300048925 Ga0496122_0000001 Ga0496122_0000001_1450802_1451743 313
446 3300048925 Ga0496122_0160807 Ga0496122_0160807_49_990 313
447 3300048926 Ga0496123_0000001 Ga0496123_0000001_1454533_1455474 313
448 3300048926 Ga0496123_0124672 Ga0496123_0124672_45_986 313
449 3300048927 Ga0496124_0004942 Ga0496124_0004942_11027_11968 313
450 3300048927 Ga0496124_0039868 Ga0496124_0039868_45_986 313
451 3300048928 Ga0496125_0000107 Ga0496125_0000107_158271_159212 313
452 3300048928 Ga0496125_0025248 Ga0496125_0025248_25_966 313
453 3300048928 Ga0496125_0307585 Ga0496125_0307585_13_954 313
454 3300048929 Ga0496126_0041885 Ga0496126_0041885_1103_2044 313
455 3300050490 nmdc:mga03n38_6281_c1 nmdc:mga03n38_6281_c1_2953_3894 313
456 3300050491 nmdc:mga00v17_3852_c1 nmdc:mga00v17_3852_c1_171_1112 313
457 3300050491 nmdc:mga00v17_48_c1 nmdc:mga00v17_48_c1_51456_52397 313
458 3300050516 nmdc:mga0sz30_1315_c1 nmdc:mga0sz30_1315_c1_6262_7203 313
459 3300053107 Ga0500560_001304 Ga0500560_001304_1363_2304 313
460 3300053137 Ga0500561_0000031 Ga0500561_0000031_14780_15721 313
461 3300053157 Ga0500624_001155 Ga0500624_001155_1910_2851 313
462 3300001979 JGI24740J21852_10000426 JGI24740J21852_100004269 314
463 3300002704 JGI25155J39150_1000013 JGI25155J39150_100001337 314
464 3300002705 JGI25156J39149_1000011 JGI25156J39149_100001137 314
465 3300002737 JGI25162J39368_1000169 JGI25162J39368_100016959 314
466 3300002737 JGI25162J39368_1000698 JGI25162J39368_100069813 314
467 3300002738 JGI25154J39366_1000030 JGI25154J39366_100003037 314
468 3300002741 JGI25157J39369_1000013 JGI25157J39369_100001337 314
469 3300003214 JGI25165J46597_1000349 JGI25165J46597_100034915 314
470 3300003214 JGI25165J46597_1001006 JGI25165J46597_100100617 314
471 3300003214 JGI25165J46597_1003078 JGI25165J46597_10030784 314
472 3300003323 rootH1_10239613 rootH1_102396132 314
473 3300003354 JGI25160J50197_1000041 JGI25160J50197_1000041104 314
474 3300003374 JGI25161J50226_1000002 JGI25161J50226_1000002104 314
475 3300004625 Ga0055543_1000008 Ga0055543_100000812 314
476 3300005262 Ga0065165_1000031 Ga0065165_1000031117 314
477 3300005548 Ga0070665_100076972 Ga0070665_1000769724 314
478 3300005563 Ga0068855_100049030 Ga0068855_1000490304 314
479 3300005578 Ga0068854_100301351 Ga0068854_1003013511 314
480 3300005614 Ga0068856_100085469 Ga0068856_1000854693 314
481 3300005616 Ga0068852_100026271 Ga0068852_1000262715 314
482 3300009093 Ga0105240_10000024 Ga0105240_100000244 314
483 3300009148 Ga0105243_10039320 Ga0105243_100393204 314
484 3300009545 Ga0105237_10001005 Ga0105237_1000100513 314
485 3300010375 Ga0105239_10002984 Ga0105239_1000298412 314
486 3300013102 Ga0157371_10018490 Ga0157371_100184906 314
487 3300013104 Ga0157370_10003095 Ga0157370_1000309523 314
488 3300013105 Ga0157369_10045640 Ga0157369_100456404 314
489 3300013307 Ga0157372_10375462 Ga0157372_103754622 314
490 3300014497 Ga0182008_10095923 Ga0182008_100959231 314
491 3300015262 Ga0182007_10004392 Ga0182007_100043925 314
492 3300025206 Ga0209435_100026 Ga0209435_10002637 314
493 3300025233 Ga0209437_100056 Ga0209437_10005695 314
494 3300025233 Ga0209437_100196 Ga0209437_100196100 314
495 3300025246 Ga0209646_1000084 Ga0209646_100008437 314
496 3300025246 Ga0209646_1002684 Ga0209646_10026844 314
497 3300025250 Ga0209026_1000080 Ga0209026_100008037 314
498 3300025256 Ga0209759_1000061 Ga0209759_100006137 314
499 3300025261 Ga0209233_1000037 Ga0209233_1000037463 314
500 3300025261 Ga0209233_1000071 Ga0209233_100007195 314
501 3300025261 Ga0209233_1000243 Ga0209233_100024321 314
502 3300025284 Ga0209130_1000382 Ga0209130_100038236 314
503 3300025302 Ga0207426_1000012 Ga0207426_1000012238 314
504 3300025913 Ga0207695_10000036 Ga0207695_1000003675 314
505 3300025914 Ga0207671_10000153 Ga0207671_1000015313 314
506 3300025949 Ga0207667_10074404 Ga0207667_100744044 314
507 3300025981 Ga0207640_10381227 Ga0207640_103812271 314
508 3300026078 Ga0207702_10074512 Ga0207702_100745123 314
509 3300027312 Ga0209371_1002930 Ga0209371_10029309 314
510 3300030500 Ga0268256_1002732 Ga0268256_10027323 314
511 3300044694 Ga0466963_0008338 Ga0466963_0008338_3586_4530 314
512 3300045049 Ga0466959_0323799 Ga0466959_0323799_48_992 314
513 3300046501 Ga0495607_0163056 Ga0495607_0163056_93_1037 314
514 3300046660 Ga0495625_0222242 Ga0495625_0222242_105_1049 314
515 3300047472 Ga0495686_0043023 Ga0495686_0043023_83_1027 314
516 3300048903 Ga0496100_0020490 Ga0496100_0020490_1311_2255 314
517 3300048905 Ga0496102_0007987 Ga0496102_0007987_5347_6291 314
518 3300048906 Ga0496103_0002987 Ga0496103_0002987_7796_8740 314
519 3300048909 Ga0496106_0032960 Ga0496106_0032960_2627_3571 314
520 3300048916 Ga0496113_0167059 Ga0496113_0167059_106_1050 314
521 3300048919 Ga0496116_0000100 Ga0496116_0000100_52087_53031 314
522 3300048919 Ga0496116_0002602 Ga0496116_0002602_12425_13369 314
523 3300048920 Ga0496117_0001819 Ga0496117_0001819_12892_13836 314
524 3300048921 Ga0496118_0001431 Ga0496118_0001431_16992_17936 314
525 3300048922 Ga0496119_0004023 Ga0496119_0004023_5419_6363 314
526 3300048923 Ga0496120_0005580 Ga0496120_0005580_5520_6464 314
527 3300048923 Ga0496120_0060328 Ga0496120_0060328_23_967 314
528 3300048924 Ga0496121_0002730 Ga0496121_0002730_12624_13568 314
529 3300048925 Ga0496122_0005818 Ga0496122_0005818_11793_12737 314
530 3300048925 Ga0496122_0018531 Ga0496122_0018531_2562_3515 314
531 3300048925 Ga0496122_0168498 Ga0496122_0168498_248_1192 314
532 3300048926 Ga0496123_0007700 Ga0496123_0007700_7368_8312 314
533 3300048926 Ga0496123_0027998 Ga0496123_0027998_1770_2723 314
534 3300048927 Ga0496124_0000063 Ga0496124_0000063_220635_221582 314
535 3300048927 Ga0496124_0082632 Ga0496124_0082632_1665_2618 314
536 3300048928 Ga0496125_0005338 Ga0496125_0005338_1767_2711 314
537 3300048928 Ga0496125_0226290 Ga0496125_0226290_227_1180 314
538 3300048929 Ga0496126_0000311 Ga0496126_0000311_52959_53903 314
539 3300048929 Ga0496126_0187257 Ga0496126_0187257_384_1328 314
540 3300053111 Ga0500572_020979 Ga0500572_020979_444_1478 314
541 3300053140 Ga0500573_0000473 Ga0500573_0000473_1196_2161 314
542 3300053161 Ga0500634_0036652 Ga0500634_0036652_893_1837 314
543 3300053177 Ga0500636_0000006 Ga0500636_0000006_79766_80710 314
544 3300053177 Ga0500636_0002632 Ga0500636_0002632_8431_9465 314

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08241

Methyltransf_11

Methyltransferase domain

180

280

0.91

PF13181

TPR_8

Tetratricopeptide repeat

77

109

0.91

PF13181

TPR_8

Tetratricopeptide repeat

45

75

0.91

PF13649

Methyltransf_25

Methyltransferase domain

179

276

0.86

PF13847

Methyltransf_31

Methyltransferase domain

174

314

0.84

PF08242

Methyltransf_12

Methyltransferase domain

180

278

0.78

PF13489

Methyltransf_23

Methyltransferase domain

154

321

0.77

Structural Annotation

Top 5 Hits

ID Description Score Start End
1w3b-assembly1.cif.gz_B the superhelical tpr domain of o-linked glcnac transferase reveals structural similarities to importin alpha. 0.9466 13 91
4cgq-assembly1.cif.gz_A full length tah1 bound to hsp90 peptide srmeevd 0.9424 13 76
3cvp-assembly1.cif.gz_A structure of peroxisomal targeting signal 1 (pts1) binding domain of trypanosoma brucei peroxin 5 (tbpex5)complexed to pts1 peptide (10-skl) 0.9362 13 91
1hxi-assembly1.cif.gz_A an unexpected extended conformation for the third tpr motif of the peroxin pex5 from trypanosoma brucei 0.9324 16 92
4nrh-assembly2.cif.gz_B copn-scc3 complex 0.9304 13 91
ID Description Score Start End Superfamily
af_C0PEY7_222_304_1.25.40.10 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 0.9634 12 78 1.25.40.10
af_Q55FY1_358_430_1.25.40.10 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 0.9603 13 78 1.25.40.10
af_A0A0R4IV14_22_108_1.25.40.10 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 0.9559 13 92 1.25.40.10
af_Q5CZ52_184_270_1.25.40.10 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 0.9501 13 78 1.25.40.10
af_Q4D661_411_630_1.25.40.10 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 0.9471 20 78 1.25.40.10
ID Description Score Start End GO Terms
AF-A0A6N4C916-F1-model_v4 deleted 0.9806 226 314
AF-A0A4R3NX98-F1-model_v4 Putative TPR repeat methyltransferase 0.9723 7 314 GO:0008168
GO:0032259
AF-A0A1I7EGH0-F1-model_v4 Predicted methyltransferase, contains TPR repeat 0.9711 1 313 GO:0008757
GO:0032259
AF-Q98BP3-F1-model_v4 Mlr5485 protein 0.9692 23 313
AF-A0A1I7EGH0-F1-model_v4 Predicted methyltransferase, contains TPR repeat 0.968 1 313 GO:0008757
GO:0032259

Feature Viewer

pLDDT pTM Quality
93.74 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map