F461510

General Info

Members Datasets Scaffolds Average Seq Length
542 413 333 219

Family's Representative Sequence

Representative Sequence 3300037312|Ga0395899_0008512|Ga0395899_0008512_6123_6875
Length 250
Sequence MNYNFDWNVVANAFPAMMQGLGITVQITLITIAISMVLAVPVAVGRMSKIEVIRWAAQGYIEIFRCTPLLVQLFWIFYALPALTGVTLPGEVSAVIALTANLTAFMAEAYRSGFQSVPVEQVEAGRMLQLNRFQQLRYIIVPQALRQQLPVILSLNISLFKDTALVSTIAVADLMFISNTISSQTYRSLEVFTLAAFVYFAIAFPVSLATSALERRMQNSSGLGAPPPKKLVARMMPGSRTADPRTAVPA

Samples

Sample ID Description Type Environment
1 2124908027 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v1 Metagenome Rhizosphere
2 2508501050 Microvirga lupini Lut6 Isolate Nodule
3 2509276021 Rhizobium leguminosarum bv. trifolii WSM597 Isolate Nodule
4 2509276033 Rhizobium leguminosarum bv. trifolii WSM2012 Isolate Nodule
5 2510461076 Rhizobium leguminosarum bv. trifolii TA1 Isolate Nodule
6 2511231022 Pseudomonas sp. GM79 Isolate Nodule
7 2511231052 Sinorhizobium meliloti AK58 Isolate Nodule
8 2512047086 Sinorhizobium arboris LMG 14919 Isolate Nodule
9 2513237083 Paraburkholderia mimosarum LMG 23256 Isolate Nodule
10 2513237084 Rhizobium leguminosarum bv. viciae UPM1131 Isolate Nodule
11 2513237085 Rhizobium leguminosarum bv. viciae UPM1137 Isolate Nodule
12 2513237086 Sinorhizobium meliloti MVII-I Isolate Nodule
13 2513237088 Rhizobium mesoamericanum STM6155 Isolate Nodule
14 2513237093 Rhizobium leguminosarum bv. phaseoli FA23 Isolate Nodule
15 2513237146 Rhizobium mongolense USDA 1844 (Illumina) Isolate Nodule
16 2513237162 Rhizobium ruizarguesonis GB30 Isolate Nodule
17 2513237166 Paraburkholderia azotifigens UYPR1.413 Isolate Nodule
18 2515154189 Paraburkholderia nodosa DSM 21604 Isolate Unclassified
19 2526164713 Paraburkholderia phenoliruptrix JPY366 Isolate Nodule
20 2551306084 Sinorhizobium meliloti 5A14 Isolate Nodule
21 2551306085 Sinorhizobium meliloti AE608H Isolate Nodule
22 2551306086 Sinorhizobium meliloti AK11 Isolate Nodule
23 2551306087 Sinorhizobium meliloti A0643DD Isolate Nodule
24 2551306090 Sinorhizobium meliloti A0641M Isolate Nodule
25 2551306092 Sinorhizobium meliloti AK75 Isolate Nodule
26 2551306093 Sinorhizobium meliloti C0438LL Isolate Nodule
27 2558860112 Pseudonocardia acaciae DSM 45401 Isolate Unclassified
28 2585427528 Rhizobium leguminosarum CF307 Isolate Rhizosphere
29 2585427593 Rhizobium tropici CF286 Isolate Rhizosphere
30 2599185170 Rhizobium mongolense USDA 1844 (PacBio) Isolate Nodule
31 2617270742 Rhizobium miluonense HAMBI 2971 Isolate Nodule
32 2643221636 Rhizobium sp. Root1204 Isolate Unclassified
33 2693429784 Mesorhizobium sp. LCM 4576 Isolate Rhizosphere
34 2738541296 Paraburkholderia sp. GV073 Isolate Unclassified
35 2738541298 Paraburkholderia sp. GV068 Isolate Unclassified
36 2738541306 Paraburkholderia sp. GV052 Isolate Unclassified
37 2738541333 Rhizobium sophoriradicis CCBAU 03470 Isolate Unclassified
38 2738543002 Paraburkholderia sp. GV072 Isolate Unclassified
39 2738543008 Paraburkholderia sp. GV060 Isolate Unclassified
40 2751185846 Paraburkholderia ribeironis STM 7296 Isolate Unclassified
41 2756170246 Mesorhizobium loti DSM 2626 Isolate Nodule
42 2773857670 Pseudomonas sp. 478 Isolate Unclassified
43 2773857925 Microvirga vignae BR3299 Isolate Unclassified
44 2775506902 Phyllobacterium zundukense Tri-48 Isolate Unclassified
45 2775506904 Phyllobacterium zundukense Tri-38 Isolate Unclassified
46 2775507266 Rhizobium tropici PRF 81 Isolate Nodule
47 2784132072 Pseudomonas sp. 460 Isolate Unclassified
48 2791355082 Ensifer alkalisoli YIC4027 Isolate Nodule
49 2791355094 Sinorhizobium sp. BJ1 Isolate Nodule
50 2791355137 Paraburkholderia piptadeniae STM7183 Isolate Unclassified
51 2791355259 Rhizobium hidalgonense FH14 Isolate Nodule
52 2791355266 Rhizobium sp. L43 Isolate Nodule
53 2791355267 Rhizobium sp. L18 Isolate Nodule
54 2802429633 Rhizobium anhuiense J3 Isolate Nodule
55 2802429634 Rhizobium anhuiense S10 Isolate Nodule
56 2802429635 Rhizobium anhuiense Y27 Isolate Nodule
57 2802429636 Rhizobium anhuiense JX3 Isolate Nodule
58 2802429637 Rhizobium anhuiense C15 Isolate Nodule
59 2808606357 Arthrobacter sp. SLBN-122 Isolate Unclassified
60 2834578030 Paracoccus thiocyanatus SST Isolate Unclassified
61 2838035591 Rhizobium mongolense SEMIA 4087 Isolate Nodule
62 2841864319 Rhizobium leguminosarum SEMIA 4052 Isolate Nodule
63 2842341865 Rhizobium leguminosarum SEMIA 4011 Isolate Nodule
64 2842363717 Rhizobium leguminosarum SEMIA 4016 Isolate Nodule
65 2842482326 Rhizobium lusitanum SEMIA 4060 Isolate Nodule
66 2844163670 Ensifer sp. 1H6 Isolate Unclassified
67 2847686936 Mesorhizobium sp. M1A.F.Ca.IN.022.06.1.1 Isolate Nodule
68 2852387548 Rhizobium jaguaris CCGE525 Isolate Unclassified
69 2855825444 Sinorhizobium meliloti CXM1-105 Isolate Nodule
70 2855839649 Sinorhizobium meliloti AK555 Isolate Unclassified
71 2855872281 Sinorhizobium fredii PCH1 Isolate Nodule
72 2856342000 Mesorhizobium sp. M5C.F.Cr.IN.023.01.1.1 Isolate Nodule
73 2869234852 Mesorhizobium sp. M7A.T.Ca.US.000.02.2.1 Isolate Nodule
74 2869278585 Mesorhizobium sp. M8A.F.Ca.ET.198.01.1.1 Isolate Nodule
75 2874109183 Mesorhizobium sp. M7A.T.Ca.TU.009.02.1.1 Isolate Nodule
76 2874139085 Mesorhizobium sp. M8A.F.Ca.ET.207.01.1.1 Isolate Nodule
77 2878730984 Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.1 Isolate Nodule
78 2881155292 Mesorhizobium sp. M4B.F.Ca.ET.058.02.1.1 Isolate Nodule
79 2881861095 Mesorhizobium sp. M4B.F.Ca.ET.049.02.1.2 Isolate Nodule
80 2882456835 Microvirga sp. KLBC 81 Isolate Unclassified
81 2882912400 Mesorhizobium sp. M4B.F.Ca.ET.013.02.1.1 Isolate Nodule
82 2883087390 Paraburkholderia guartelaensis CNPSo 3008 Isolate Unclassified
83 2885270888 Paraburkholderia sp. UYCPa14C Isolate Unclassified
84 2888337043 Mesorhizobium sp. M8A.F.Ca.ET.057.01.1.1 Isolate Nodule
85 2891373044 Shinella sp. AETb1-6 Isolate Rhizosphere
86 2900634093 Paraburkholderia dipogonis ICMP 19430 Isolate Unclassified
87 2902682994 Paraburkholderia atlantica CNPSo 3155 Isolate Unclassified
88 2903513507 Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.2 Isolate Nodule
89 2904615490 Paraburkholderia franconis CNPSo 3157 Isolate Unclassified
90 2908669403 Pantoea coffeiphila 1480 Isolate Rhizosphere
91 2913295892 Sinorhizobium kostiensis DSM 13372 Isolate Nodule
92 2915993759 Sinorhizobium meliloti USDA1336 Isolate Nodule
93 2916007675 Sinorhizobium meliloti USDA1289 Isolate Nodule
94 2916014648 Sinorhizobium meliloti USDA1583 Isolate Nodule
95 2916028427 Sinorhizobium meliloti USDA1613 Isolate Nodule
96 2916055098 Sinorhizobium meliloti USDA1770 Isolate Nodule
97 2916068649 Sinorhizobium meliloti USDA1220 Isolate Nodule
98 2921237296 Sinorhizobium meliloti USDA1508 Isolate Nodule
99 2921263974 Sinorhizobium meliloti USDA1107 Isolate Nodule
100 2921289301 Sinorhizobium meliloti USDA1730 Isolate Nodule
101 2921296804 Sinorhizobium meliloti USDA1200 Isolate Nodule
102 2924150972 Sinorhizobium meliloti USDA1700 Isolate Nodule
103 2924158325 Sinorhizobium meliloti USDA1146 Isolate Nodule
104 2924165586 Sinorhizobium meliloti USDA1264 Isolate Nodule
105 2924172951 Sinorhizobium meliloti USDA1626 Isolate Nodule
106 2924186466 Sinorhizobium meliloti USDA1389 Isolate Nodule
107 2924214083 Sinorhizobium meliloti USDA1702 Isolate Nodule
108 2924221636 Sinorhizobium meliloti USDA1416 Isolate Nodule
109 2924228884 Sinorhizobium meliloti USDA1581 Isolate Nodule
110 2924718760 Mesorhizobium sp. M8A.F.Ca.ET.023.01.1.1 Isolate Nodule
111 2924726620 Mesorhizobium sp. M1A.F.Ca.IN.020.03.2.1 Isolate Nodule
112 2924754689 Mesorhizobium sp. M5C.F.Ca.IN.020.32.2.1 Isolate Nodule
113 2924784321 Mesorhizobium sp. M4B.F.Ca.ET.143.01.1.1 Isolate Nodule
114 2928157003 Burkholderia ambifaria 566 Isolate Unclassified
115 2936375103 Rhizobium changzhiense WYCCWR 11317 Isolate Nodule
116 2937002841 Sinorhizobium meliloti USDA1006 Isolate Nodule
117 2937042894 Sinorhizobium meliloti USDA1687 Isolate Nodule
118 2937049772 Sinorhizobium meliloti USDA1691 Isolate Nodule
119 2937056579 Sinorhizobium meliloti USDA1357 Isolate Nodule
120 2937071275 Sinorhizobium meliloti USDA1623 Isolate Nodule
121 2937091812 Sinorhizobium meliloti USDA1221 Isolate Nodule
122 2937098957 Sinorhizobium meliloti USDA1519 Isolate Nodule
123 2937126314 Sinorhizobium meliloti USDA1612 Isolate Nodule
124 2937843397 Mesorhizobium xinjiangense lm94 Isolate Rhizosphere
125 2937877337 Mesorhizobium sp. M8A.F.Ca.ET.161.01.1.1 Isolate Nodule
126 2957422303 Sinorhizobium meliloti USDA1497 Isolate Nodule
127 2957430029 Sinorhizobium meliloti USDA1590 Isolate Nodule
128 2957457609 Sinorhizobium meliloti USDA1751 Isolate Nodule
129 2957471148 Sinorhizobium meliloti USDA1204 Isolate Nodule
130 2957478035 Sinorhizobium meliloti USDA1171 Isolate Nodule
131 2957484790 Sinorhizobium meliloti USDA1464 Isolate Nodule
132 2957498199 Sinorhizobium meliloti USDA1561 Isolate Nodule
133 2957505466 Sinorhizobium meliloti USDA1696 Isolate Nodule
134 2958034702 Mesorhizobium sp. M8A.F.Ca.ET.202.01.1.1 Isolate Nodule
135 2958041894 Mesorhizobium sp. M00.F.Ca.ET.149.01.1.1 Isolate Nodule
136 2958084443 Mesorhizobium sp. M8A.F.Ca.ET.142.01.1.1 Isolate Nodule
137 2958092219 Mesorhizobium sp. M8A.F.Ca.ET.059.01.1.1 Isolate Nodule
138 2960603979 Sinorhizobium meliloti USDA1580 Isolate Nodule
139 2960624210 Sinorhizobium meliloti USDA1415 Isolate Nodule
140 2960637947 Sinorhizobium meliloti USDA1202 Isolate Nodule
141 2960645483 Sinorhizobium meliloti USDA1703 Isolate Nodule
142 2960652885 Sinorhizobium meliloti USDA1199 Isolate Nodule
143 2964607997 Sinorhizobium meliloti USDA1212 Isolate Nodule
144 2964628898 Sinorhizobium meliloti USDA1191 Isolate Nodule
145 2964649959 Sinorhizobium meliloti USDA1591 Isolate Nodule
146 2964656573 Sinorhizobium meliloti USDA1308 Isolate Nodule
147 2964678106 Sinorhizobium meliloti USDA1210 Isolate Nodule
148 2964719344 Sinorhizobium meliloti USDA1456 Isolate Nodule
149 2965062239 Mesorhizobium sp. M1A.F.Ca.ET.072.01.1.1 Isolate Nodule
150 2967678726 Sinorhizobium meliloti USDA1467 Isolate Nodule
151 2967693043 Sinorhizobium meliloti USDA1183 Isolate Nodule
152 2967706974 Sinorhizobium meliloti USDA1206 Isolate Nodule
153 2967714385 Sinorhizobium meliloti USDA1023 Isolate Nodule
154 2967721400 Sinorhizobium meliloti USDA1742 Isolate Nodule
155 2967735183 Sinorhizobium meliloti USDA1710 Isolate Nodule
156 2967762386 Sinorhizobium meliloti USDA1397 Isolate Nodule
157 2967775926 Sinorhizobium meliloti USDA1678 Isolate Nodule
158 2968128360 Mesorhizobium sp. WSM3873 Isolate Unclassified
159 2970019648 Sinorhizobium meliloti USDA1603 Isolate Nodule
160 2970040964 Sinorhizobium meliloti USDA1501 Isolate Nodule
161 2970047711 Sinorhizobium meliloti USDA1793 Isolate Nodule
162 2970054988 Sinorhizobium meliloti USDA1031 Isolate Nodule
163 2970061556 Sinorhizobium meliloti USDA1810 Isolate Nodule
164 2970088815 Sinorhizobium meliloti USDA1819 Isolate Nodule
165 2970109326 Sinorhizobium meliloti USDA1186 Isolate Nodule
166 2970116247 Sinorhizobium meliloti USDA1566 Isolate Nodule
167 2970129317 Sinorhizobium meliloti USDA1008 Isolate Nodule
168 2970136068 Sinorhizobium meliloti USDA1699 Isolate Nodule
169 2970149975 Sinorhizobium meliloti USDA1215 Isolate Nodule
170 2970164137 Sinorhizobium meliloti USDA1018 Isolate Nodule
171 2970170962 Sinorhizobium meliloti USDA1571 Isolate Nodule
172 2970184632 Sinorhizobium meliloti USDA1593 Isolate Nodule
173 2970191845 Sinorhizobium meliloti USDA1187 Isolate Nodule
174 2970593180 Mesorhizobium sp. M8A.F.Ca.ET.197.01.1.1 Isolate Nodule
175 2977537788 Sinorhizobium meliloti USDA1184 Isolate Nodule
176 2977551784 Sinorhizobium meliloti USDA1035 Isolate Nodule
177 2977572785 Sinorhizobium meliloti USDA1767 Isolate Nodule
178 2977579622 Sinorhizobium meliloti USDA1161 Isolate Nodule
179 2981990288 Burkholderia sp. PvR073 Isolate Rhizosphere
180 2989349275 Shinella kummerowiae CCBAU 25048 Isolate Unclassified
181 3004232784 Mesorhizobium sp. M7A.T.Ca.US.000.02.1.1 Isolate Nodule
182 3004289098 Mesorhizobium sp. M8A.F.Ca.ET.023.02.2.1 Isolate Nodule
183 3007419365 Pseudomonas vanderleydeniana RW8P3 Isolate Unclassified
184 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
185 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
186 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
187 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
188 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
189 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
190 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
191 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
192 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
193 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
194 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
195 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
196 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
197 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
198 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
199 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
200 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
201 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
202 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
203 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
204 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
205 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
206 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
207 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
208 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
209 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
210 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
211 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
212 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
213 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
214 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
215 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
216 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
217 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
218 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
219 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
220 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
221 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
222 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
223 3300009765 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule Metagenome Nodule
224 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
225 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
226 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
227 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
228 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
229 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
230 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
231 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
232 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
233 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
234 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
235 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
236 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
237 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
238 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
239 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
240 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
241 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
242 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
243 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
244 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
245 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
246 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
247 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
248 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
249 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
250 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
251 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
252 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
253 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
254 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
255 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
256 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
257 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
258 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
259 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
260 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
261 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
262 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
263 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
264 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
265 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
266 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
267 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
268 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
269 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
270 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
271 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
272 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
273 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
274 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
275 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
276 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
277 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
278 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
279 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
280 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
281 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
282 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
283 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
284 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
285 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
286 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
287 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
288 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
289 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
290 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
291 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
292 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
293 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
294 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
295 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
296 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
297 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
298 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
299 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
300 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
301 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
302 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
303 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
304 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
305 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
306 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
307 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
308 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
309 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
310 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
311 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
312 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
313 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
314 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
315 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
316 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
317 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
318 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
319 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
320 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
321 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
322 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
323 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
324 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
325 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
326 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
327 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
328 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
329 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
330 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
331 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
332 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
333 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
334 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
335 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
336 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
337 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
338 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
339 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
340 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
341 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
342 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
343 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
344 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
345 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
346 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
347 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
348 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
349 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
350 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
351 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
352 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
353 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
354 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
355 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
356 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
357 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
358 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
359 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
360 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
361 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
362 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
363 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
364 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
365 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
366 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
367 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
368 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
369 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
370 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
371 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
372 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
373 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
374 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
375 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
376 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
377 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
378 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
379 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
380 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
381 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
382 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
383 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
384 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
385 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
386 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
387 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
388 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
389 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
390 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
391 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
392 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
393 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
394 3300053099 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 endosphere Metagenome Endosphere
395 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
396 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
397 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
398 8002285264 Aminobacter anthyllidis LMG 26462 Isolate Nodule
399 8003955200 Paraburkholderia mimosarum LMG 23256 Isolate Nodule
400 8004703790 Mesorhizobium sp. M00.F.Ca.ET.158.01.1.1 Isolate Nodule
401 8005258706 Rhizobium sp. R693 Isolate Nodule
402 8005556819 Rhizobium sp. WYCCWR 11128 Isolate Nodule
403 8005563573 Rhizobium sp. WYCCWR 11152 Isolate Nodule
404 8005570704 Rhizobium anhuiense bv. trifolii WYCCWR10015 Isolate Nodule
405 8018163183 Rhizobium sp. WYCCWR 11146 Isolate Nodule
406 8020938398 Burkholderia sp. BE12 Isolate Rhizosphere
407 8020953355 Burkholderia sp. BE24 Isolate Rhizosphere
408 8039098773 Burkholderia multivorans MSMB612WGS Isolate Unclassified
409 8055266321 Paraburkholderia rhynchosiae LMG 27174 Isolate Nodule
410 8056137416 Pseudomonas fakonensis COW40 Isolate Rhizosphere
411 8056155041 Pseudomonas farris SWRI79 Isolate Rhizosphere
412 8056177738 Pseudomonas azerbaijanoccidentalis SWRI74 Isolate Rhizosphere
413 8056375014 Rhizobium redzepovicii 18T Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 61.44
Metatranscriptomes 0
Isolates 38.56

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 12.18
Nodule 29.7
Rhizoplane 1.11
Rhizosphere 43.73
Stem 0
Stem Tuber 0
Unclassified 13.28

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 MRS2a_Contig_2265 2124908027 Bacteria 2288
2 JGI25159J45721_1000080 3300002987 Bacteria 46567
3 JGI25151J46595_10003218 3300003187 Bacteria 9135
4 JGI25153J46596_10004438 3300003215 Bacteria 7569
5 rootH2_10214548 3300003320 Bacteria 1581
6 JGI25160J50197_1000160 3300003354 Bacteria 57733
7 JGI25160J50197_1001380 3300003354 Bacteria 12223
8 JGI25161J50226_1000644 3300003374 Bacteria 14074
9 JGI25161J50226_1007165 3300003374 Bacteria 1908
10 Ga0055526_1000913 3300003771 Bacteria 21962
11 Ga0055526_1001250 3300003771 Bacteria 18238
12 Ga0055526_1001730 3300003771 Bacteria 15178
13 Ga0055524_1001595 3300003775 Bacteria 12719
14 Ga0055524_1034056 3300003775 Bacteria 1415
15 Ga0055536_1010628 3300003781 Bacteria 3626
16 Ga0055528_1000496 3300003790 Bacteria 31066
17 Ga0055528_1008574 3300003790 Bacteria 4356
18 Ga0055540_1000077 3300003792 Bacteria 114283
19 Ga0055540_1000095 3300003792 Bacteria 97555
20 Ga0055540_1008583 3300003792 Bacteria 3664
21 Ga0055531_10003881 3300003794 Bacteria 9356
22 Ga0058692_1000056 3300003856 Bacteria 105284
23 Ga0055543_1000410 3300004625 Bacteria 27002
24 Ga0055543_1000625 3300004625 Bacteria 19011
25 Ga0065165_1000534 3300005262 Bacteria 57771
26 Ga0065165_1011591 3300005262 Bacteria 3655
27 Ga0065714_10002449 3300005288 Bacteria 17872
28 Ga0065714_10002712 3300005288 Bacteria 12352
29 Ga0070658_10049106 3300005327 Bacteria 3418
30 Ga0070683_100217589 3300005329 Bacteria 1815
31 Ga0070660_100000020 3300005339 Bacteria 98286
32 Ga0070659_100000047 3300005366 Bacteria 98286
33 Ga0070659_100271906 3300005366 Bacteria 1408
34 Ga0070685_10345784 3300005466 Bacteria 1015
35 Ga0068856_100369980 3300005614 Bacteria 1452
36 Ga0068858_100275034 3300005842 Bacteria 1603
37 Ga0081455_10145112 3300005937 Bacteria 1837
38 Ga0081538_10004588 3300005981 Bacteria 12706
39 Ga0075365_10026094 3300006038 Bacteria 3705
40 Ga0075363_100089546 3300006048 Bacteria 1692
41 Ga0075432_10000599 3300006058 Bacteria 10906
42 Ga0075362_10120493 3300006177 Bacteria 1241
43 Ga0075369_10034998 3300006186 Bacteria 2133
44 Ga0075366_10013907 3300006195 Bacteria 4587
45 Ga0079104_1001104 3300006946 Bacteria 19946
46 Ga0105251_10000038 3300009011 Bacteria 116060
47 Ga0105251_10010946 3300009011 Bacteria 5218
48 Ga0105244_10002923 3300009036 Bacteria 12611
49 Ga0105244_10053974 3300009036 Bacteria 2040
50 Ga0105250_10004934 3300009092 Bacteria 6049
51 Ga0105247_10662791 3300009101 Bacteria 781
52 Ga0105243_10068349 3300009148 Bacteria 2863
53 Ga0105242_10178827 3300009176 Bacteria 1870
54 Ga0105238_10009567 3300009551 Bacteria 9694
55 Ga0123341_1000082 3300009765 Bacteria 40371
56 Ga0105239_10005879 3300010375 Bacteria 14296
57 Ga0105239_10128292 3300010375 Bacteria 2820
58 Ga0157373_10211748 3300013100 Bacteria 1367
59 Ga0157370_10022288 3300013104 Bacteria 6304
60 Ga0157369_10138693 3300013105 Bacteria 2574
61 Ga0157372_11394652 3300013307 Bacteria 808
62 Ga0182008_10000970 3300014497 Bacteria 19917
63 Ga0182006_1002548 3300015261 Bacteria 9886
64 Ga0182007_10000152 3300015262 Bacteria 46887
65 Ga0182005_1000181 3300015265 Bacteria 43402
66 Ga0209436_100101 3300025208 Bacteria 42360
67 Ga0207425_1002551 3300025245 Bacteria 6340
68 Ga0209148_1000331 3300025254 Bacteria 64881
69 Ga0209759_1020394 3300025256 Bacteria 1539
70 Ga0209129_1000917 3300025258 Bacteria 18018
71 Ga0209129_1024250 3300025258 Bacteria 1070
72 Ga0209455_1000371 3300025272 Bacteria 41412
73 Ga0209673_1000294 3300025273 Bacteria 93050
74 Ga0209673_1000968 3300025273 Bacteria 35620
75 Ga0209130_1000309 3300025284 Bacteria 57785
76 Ga0209130_1023894 3300025284 Bacteria 1341
77 Ga0209676_1002316 3300025292 Bacteria 13827
78 Ga0209025_1000260 3300025294 Bacteria 124240
79 Ga0209025_1001911 3300025294 Bacteria 24216
80 Ga0209025_1022425 3300025294 Bacteria 3349
81 Ga0209564_1000341 3300025295 Bacteria 89262
82 Ga0209564_1001129 3300025295 Bacteria 31419
83 Ga0209758_1001982 3300025297 Bacteria 22133
84 Ga0209758_1003817 3300025297 Bacteria 13248
85 Ga0209050_1010756 3300025298 Bacteria 4459
86 Ga0209050_1011672 3300025298 Bacteria 4133
87 Ga0209256_1000719 3300025299 Bacteria 43868
88 Ga0209256_1003376 3300025299 Bacteria 11297
89 Ga0207426_1000503 3300025302 Bacteria 57785
90 Ga0207426_1001199 3300025302 Bacteria 23041
91 Ga0209051_1000027 3300025303 Bacteria 412172
92 Ga0209051_1003762 3300025303 Bacteria 9734
93 Ga0209051_1041767 3300025303 Bacteria 1628
94 Ga0209257_1000599 3300025304 Bacteria 59865
95 Ga0209257_1002580 3300025304 Bacteria 17618
96 Ga0207696_1000018 3300025711 Bacteria 478605
97 Ga0207655_1001322 3300025728 Bacteria 23408
98 Ga0207655_1011199 3300025728 Bacteria 5360
99 Ga0207713_1000185 3300025735 Bacteria 88697
100 Ga0207713_1002035 3300025735 Bacteria 15137
101 Ga0207688_10056684 3300025901 Bacteria 2202
102 Ga0207705_10036303 3300025909 Bacteria 3527
103 Ga0207657_10000390 3300025919 Bacteria 46278
104 Ga0207649_10384538 3300025920 Bacteria 1047
105 Ga0207690_10000037 3300025932 Bacteria 142658
106 Ga0207690_10225952 3300025932 Bacteria 1435
107 Ga0207702_10317460 3300026078 Bacteria 1483
108 Ga0209281_1000778 3300027111 Bacteria 30318
109 Ga0209371_1000121 3300027312 Bacteria 132565
110 Ga0207428_10002525 3300027907 Bacteria 18264
111 Ga0268256_1000107 3300030500 Bacteria 121028
112 Ga0307408_100355446 3300031548 Bacteria 1244
113 Ga0307405_10029046 3300031731 Bacteria 3228
114 Ga0307405_10141687 3300031731 Bacteria 1677
115 Ga0307413_10027454 3300031824 Bacteria 3155
116 Ga0307413_10055294 3300031824 Bacteria 2414
117 Ga0307410_10145813 3300031852 Bacteria 1756
118 Ga0307410_10411796 3300031852 Bacteria 1094
119 Ga0307406_10016078 3300031901 Bacteria 4341
120 Ga0307406_10093425 3300031901 Bacteria 2031
121 Ga0307406_10425518 3300031901 Bacteria 1059
122 Ga0307407_10020138 3300031903 Bacteria 3411
123 Ga0307409_100113298 3300031995 Bacteria 2279
124 Ga0307409_100382540 3300031995 Bacteria 1338
125 Ga0307416_100007287 3300032002 Bacteria 7014
126 Ga0307415_100129578 3300032126 Bacteria 1907
127 Ga0373937_0197626 3300036401 Bacteria 1890
128 Ga0373925_0052189 3300037068 Bacteria 3055
129 Ga0395899_0002826 3300037312 Bacteria 13986
130 Ga0395899_0008512 3300037312 Bacteria 7901
131 Ga0395900_0008030 3300037418 Bacteria 10861
132 Ga0395900_0109630 3300037418 Bacteria 2836
133 Ga0395898_0003468 3300037466 Bacteria 17615
134 Ga0395898_0010331 3300037466 Bacteria 9766
135 Ga0395898_0147701 3300037466 Bacteria 2250
136 Ga0395905_0000024 3300037471 Bacteria 318806
137 Ga0395905_0001801 3300037471 Bacteria 24828
138 Ga0395905_0080861 3300037471 Bacteria 3046
139 Ga0395901_0000434 3300038443 Bacteria 48945
140 Ga0395901_0027622 3300038443 Bacteria 5832
141 Ga0395901_0096386 3300038443 Bacteria 3100
142 Ga0395901_0199731 3300038443 Bacteria 2096
143 Ga0400483_044762 3300039062 Bacteria 1104
144 Ga0400483_188268 3300039062 Bacteria 1882
145 Ga0439438_001222 3300041405 Bacteria 11398
146 Ga0439447_009478 3300041407 Bacteria 2947
147 Ga0439466_0008929 3300041411 Bacteria 3768
148 Ga0439466_0016051 3300041411 Bacteria 2711
149 Ga0439465_0009838 3300041413 Bacteria 3012
150 Ga0451835_0189026 3300041492 Bacteria 1202
151 Ga0451835_0889751 3300041492 Bacteria 2335
152 Ga0451837_1430986 3300041494 Bacteria 2695
153 Ga0451839_1280463 3300041496 Bacteria 725
154 Ga0451841_0648979 3300041498 Bacteria 851
155 Ga0451845_0509085 3300041501 Bacteria 1645
156 Ga0451847_0054784 3300041503 Bacteria 2806
157 Ga0451849_0219018 3300041505 Bacteria 3632
158 Ga0451851_0579564 3300041507 Bacteria 3963
159 Ga0451853_0692887 3300041512 Bacteria 3567
160 Ga0439442_009557 3300042002 Bacteria 1961
161 Ga0439449_0089202 3300042007 Bacteria 1138
162 Ga0439449_0148502 3300042007 Bacteria 874
163 Ga0439451_010933 3300042009 Bacteria 1830
164 Ga0439452_000072 3300042010 Bacteria 88574
165 Ga0439440_0002240 3300042993 Bacteria 3624
166 Ga0466963_0250889 3300044694 Bacteria 1242
167 Ga0466963_0302111 3300044694 Bacteria 1126
168 Ga0466957_0000424 3300044842 Bacteria 20789
169 Ga0466960_0027509 3300044901 Bacteria 2595
170 Ga0495627_003113 3300046453 Bacteria 7516
171 Ga0495592_0049789 3300046454 Bacteria 3114
172 Ga0495591_001339 3300046458 Bacteria 15482
173 Ga0495591_001915 3300046458 Bacteria 12215
174 Ga0495638_0000337 3300046460 Bacteria 59070
175 Ga0495638_0032044 3300046460 Bacteria 3372
176 Ga0495638_0060974 3300046460 Bacteria 2332
177 Ga0495651_0028015 3300046462 Bacteria 4391
178 Ga0495653_0006986 3300046463 Bacteria 9265
179 Ga0495653_0061261 3300046463 Bacteria 2847
180 Ga0495653_0068971 3300046463 Bacteria 2650
181 Ga0495582_0002108 3300046473 Bacteria 11126
182 Ga0495605_0012525 3300046474 Bacteria 4702
183 Ga0495639_0006288 3300046475 Bacteria 5101
184 Ga0495639_0142014 3300046475 Bacteria 1155
185 Ga0495664_0005994 3300046477 Bacteria 6701
186 Ga0495585_0000012 3300046492 Bacteria 203064
187 Ga0495585_0031944 3300046492 Bacteria 2985
188 Ga0495594_0140572 3300046499 Bacteria 1369
189 Ga0495607_0017376 3300046501 Bacteria 4620
190 Ga0495583_0002549 3300046506 Bacteria 15393
191 Ga0495606_0002150 3300046507 Bacteria 23749
192 Ga0495610_0001335 3300046512 Bacteria 21880
193 Ga0495610_0002873 3300046512 Bacteria 13984
194 Ga0495610_0041811 3300046512 Bacteria 2298
195 Ga0495610_0061814 3300046512 Bacteria 1778
196 Ga0495616_0006862 3300046513 Bacteria 6858
197 Ga0495616_0049818 3300046513 Bacteria 2097
198 Ga0495620_0031262 3300046515 Bacteria 2441
199 Ga0495630_0003330 3300046517 Bacteria 11191
200 Ga0495630_0005890 3300046517 Bacteria 8668
201 Ga0495630_0013664 3300046517 Bacteria 5902
202 Ga0495630_0025235 3300046517 Bacteria 4394
203 Ga0495632_0002236 3300046519 Bacteria 14936
204 Ga0495637_0000104 3300046520 Bacteria 62838
205 Ga0495637_0006512 3300046520 Bacteria 5853
206 Ga0495648_0007964 3300046524 Bacteria 8404
207 Ga0495648_0012641 3300046524 Bacteria 6278
208 Ga0495666_0000923 3300046526 Bacteria 13825
209 Ga0495666_0013659 3300046526 Bacteria 4049
210 Ga0495666_0073246 3300046526 Bacteria 1625
211 Ga0495654_0003761 3300046530 Bacteria 9192
212 Ga0495665_0029429 3300046531 Bacteria 2943
213 Ga0495665_0048337 3300046531 Bacteria 2255
214 Ga0495586_0002053 3300046535 Bacteria 10938
215 Ga0495587_0001330 3300046536 Bacteria 16412
216 Ga0495597_0002064 3300046542 Bacteria 13397
217 Ga0495645_0056587 3300046543 Bacteria 2847
218 Ga0495645_0236758 3300046543 Bacteria 1220
219 Ga0495622_0007978 3300046557 Bacteria 4908
220 Ga0495622_0054733 3300046557 Bacteria 1851
221 Ga0495656_0004721 3300046615 Bacteria 4683
222 Ga0495634_0001217 3300046642 Bacteria 23743
223 Ga0495634_0136118 3300046642 Bacteria 1563
224 Ga0495625_0001537 3300046660 Bacteria 27559
225 Ga0495625_0005428 3300046660 Bacteria 11638
226 Ga0495635_0000478 3300046663 Bacteria 25287
227 Ga0495659_0000022 3300046664 Bacteria 72378
228 Ga0495661_0081415 3300046665 Bacteria 1866
229 Ga0495661_0085935 3300046665 Bacteria 1802
230 Ga0495588_0027462 3300046674 Bacteria 2844
231 Ga0495588_0041330 3300046674 Bacteria 2354
232 Ga0495657_0015936 3300046675 Bacteria 5486
233 Ga0495599_0120963 3300046678 Bacteria 1628
234 Ga0495599_0348035 3300046678 Bacteria 889
235 Ga0495623_0003127 3300046679 Bacteria 10909
236 Ga0495623_0005374 3300046679 Bacteria 8381
237 Ga0495646_0000376 3300046680 Bacteria 23282
238 Ga0495646_0003831 3300046680 Bacteria 9396
239 Ga0495613_0002368 3300046689 Bacteria 14285
240 Ga0495670_0025008 3300046691 Bacteria 2953
241 Ga0495670_0038162 3300046691 Bacteria 2395
242 Ga0495671_0052308 3300046692 Bacteria 2030
243 Ga0495649_0000036 3300046694 Bacteria 134537
244 Ga0495649_0000202 3300046694 Bacteria 52910
245 Ga0495649_0001349 3300046694 Bacteria 18658
246 Ga0495649_0003058 3300046694 Bacteria 11456
247 Ga0495649_0022900 3300046694 Bacteria 3493
248 Ga0495589_0000711 3300046794 Bacteria 21577
249 Ga0495589_0001234 3300046794 Bacteria 15147
250 Ga0495589_0098260 3300046794 Bacteria 1418
251 Ga0495600_0014597 3300046809 Bacteria 4951
252 Ga0495660_0003169 3300046810 Bacteria 10245
253 Ga0495581_0031122 3300047315 Bacteria 3092
254 Ga0495604_0001884 3300047317 Bacteria 17046
255 Ga0495604_0009365 3300047317 Bacteria 7747
256 Ga0495604_0026289 3300047317 Bacteria 4634
257 Ga0495674_0001838 3300047319 Bacteria 20925
258 Ga0495672_0022949 3300047320 Bacteria 4048
259 Ga0495680_0000645 3300047322 Bacteria 39120
260 Ga0495680_0003589 3300047322 Bacteria 15193
261 Ga0495680_0016115 3300047322 Bacteria 6426
262 Ga0495680_0058939 3300047322 Bacteria 2965
263 Ga0495680_0116848 3300047322 Bacteria 1972
264 Ga0495683_0002684 3300047323 Bacteria 10614
265 Ga0495687_000822 3300047443 Bacteria 33205
266 Ga0495687_063793 3300047443 Bacteria 1507
267 Ga0495675_0001391 3300047444 Bacteria 14679
268 Ga0495675_0010086 3300047444 Bacteria 5893
269 Ga0495675_0098344 3300047444 Bacteria 1833
270 Ga0495675_0110180 3300047444 Bacteria 1719
271 Ga0495681_0091994 3300047470 Bacteria 1337
272 Ga0495684_0027342 3300047471 Bacteria 4379
273 Ga0495686_0000556 3300047472 Bacteria 53309
274 Ga0495686_0001910 3300047472 Bacteria 20811
275 Ga0495686_0150917 3300047472 Bacteria 1364
276 Ga0495593_0002125 3300047673 Bacteria 11847
277 Ga0495593_0016068 3300047673 Bacteria 4225
278 Ga0495593_0038118 3300047673 Bacteria 2597
279 Ga0495593_0102802 3300047673 Bacteria 1464
280 Ga0495593_0155285 3300047673 Bacteria 1156
281 Ga0495602_0056287 3300048088 Bacteria 3459
282 Ga0496104_0706132 3300048907 Bacteria 916
283 Ga0496105_0018615 3300048908 Bacteria 5589
284 Ga0496106_0014056 3300048909 Bacteria 5915
285 Ga0496107_0074350 3300048910 Bacteria 2472
286 Ga0496112_0013355 3300048915 Bacteria 7581
287 Ga0496113_0020262 3300048916 Bacteria 4673
288 Ga0496116_0001588 3300048919 Bacteria 25003
289 Ga0496116_0033242 3300048919 Bacteria 3662
290 Ga0496117_0014535 3300048920 Bacteria 6775
291 Ga0496118_0025629 3300048921 Bacteria 5048
292 Ga0496118_0086251 3300048921 Bacteria 2182
293 Ga0496119_0035847 3300048922 Bacteria 3244
294 Ga0496121_0009631 3300048924 Bacteria 11067
295 Ga0496121_0023127 3300048924 Bacteria 5999
296 Ga0496122_0000244 3300048925 Bacteria 122107
297 Ga0496122_0001098 3300048925 Bacteria 46802
298 Ga0496122_0006544 3300048925 Bacteria 13325
299 Ga0496123_0000201 3300048926 Bacteria 121915
300 Ga0496123_0018936 3300048926 Bacteria 5446
301 Ga0496123_0184371 3300048926 Bacteria 1086
302 Ga0496124_0064843 3300048927 Bacteria 3048
303 Ga0496124_0133783 3300048927 Bacteria 1966
304 Ga0496125_0000083 3300048928 Bacteria 227168
305 Ga0496125_0048058 3300048928 Bacteria 3562
306 Ga0496126_0010318 3300048929 Bacteria 9806
307 Ga0501031_0443822 3300049568 Bacteria 838
308 Ga0501032_0143226 3300049569 Bacteria 1574
309 Ga0501032_0212619 3300049569 Bacteria 1260
310 Ga0501033_0224251 3300049570 Bacteria 1337
311 Ga0501034_0000944 3300049571 Bacteria 42142
312 Ga0501034_0116791 3300049571 Bacteria 2656
313 Ga0501034_0310564 3300049571 Bacteria 1511
314 Ga0501034_0318065 3300049571 Bacteria 1490
315 Ga0501034_0571227 3300049571 Bacteria 1038
316 Ga0501038_0199667 3300049574 Bacteria 1606
317 Ga0501038_0211984 3300049574 Bacteria 1549
318 Ga0501038_0330146 3300049574 Bacteria 1191
319 Ga0501039_0739816 3300049575 Bacteria 768
320 Ga0501043_0056013 3300049579 Bacteria 3097
321 Ga0501047_0074320 3300049581 Bacteria 3272
322 Ga0501074_0526929 3300049590 Bacteria 837
323 Ga0501035_0021190 3300049822 Bacteria 5974
324 Ga0501045_0297943 3300049824 Bacteria 1200
325 nmdc:mga03683_115414_c1 3300050489 Bacteria 1191
326 nmdc:mga03n38_52176_c1 3300050490 Bacteria 1829
327 nmdc:mga0yw44_18797_c1 3300050492 Bacteria 3795
328 nmdc:mga0k408_57878_c1 3300050493 Bacteria 2251
329 nmdc:mga07m45_5402_c1 3300050496 Bacteria 6355
330 Ga0500654_174895 3300053099 Bacteria 697
331 Ga0500608_115247 3300053122 Bacteria 1227
332 Ga0500568_0024236 3300053139 Bacteria 2572
333 Ga0500636_0000095 3300053177 Bacteria 44876

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005937 Ga0081455_10145112 Ga0081455_101451123 191
2 3300005981 Ga0081538_10004588 Ga0081538_100045887 192
3 3300046694 Ga0495649_0000036 Ga0495649_0000036_101909_102574 194
4 3300005329 Ga0070683_100217589 Ga0070683_1002175891 195
5 3300013307 Ga0157372_11394652 Ga0157372_113946521 195
6 3300025901 Ga0207688_10056684 Ga0207688_100566843 197
7 3300005466 Ga0070685_10345784 Ga0070685_103457841 198
8 3300049568 Ga0501031_0443822 Ga0501031_0443822_108_773 198
9 3300049571 Ga0501034_0571227 Ga0501034_0571227_227_892 198
10 3300049579 Ga0501043_0056013 Ga0501043_0056013_2266_2931 198
11 3300049581 Ga0501047_0074320 Ga0501047_0074320_293_958 198
12 3300013104 Ga0157370_10022288 Ga0157370_100222883 199
13 3300046463 Ga0495653_0006986 Ga0495653_0006986_4681_5346 199
14 3300046517 Ga0495630_0003330 Ga0495630_0003330_2805_3470 199
15 3300046526 Ga0495666_0013659 Ga0495666_0013659_3084_3749 199
16 3300046642 Ga0495634_0001217 Ga0495634_0001217_6546_7211 199
17 3300046663 Ga0495635_0000478 Ga0495635_0000478_16545_17210 199
18 3300046679 Ga0495623_0003127 Ga0495623_0003127_6294_6959 199
19 3300046680 Ga0495646_0003831 Ga0495646_0003831_8563_9228 199
20 3300047317 Ga0495604_0026289 Ga0495604_0026289_3616_4281 199
21 3300047319 Ga0495674_0001838 Ga0495674_0001838_8075_8740 199
22 3300047322 Ga0495680_0003589 Ga0495680_0003589_6616_7281 199
23 3300047444 Ga0495675_0010086 Ga0495675_0010086_3620_4285 199
24 3300047673 Ga0495593_0155285 Ga0495593_0155285_245_910 199
25 3300048929 Ga0496126_0010318 Ga0496126_0010318_3951_4616 199
26 iso_pu_bacteria 2856342000 2856343094 199
27 3300049571 Ga0501034_0310564 Ga0501034_0310564_886_1491 201
28 3300041411 Ga0439466_0016051 Ga0439466_0016051_1564_2229 202
29 3300042010 Ga0439452_000072 Ga0439452_000072_80892_81557 202
30 3300005327 Ga0070658_10049106 Ga0070658_100491064 204
31 3300005339 Ga0070660_100000020 Ga0070660_10000002048 204
32 3300005366 Ga0070659_100000047 Ga0070659_10000004748 204
33 3300005614 Ga0068856_100369980 Ga0068856_1003699802 204
34 3300009092 Ga0105250_10004934 Ga0105250_100049344 204
35 3300009551 Ga0105238_10009567 Ga0105238_100095676 204
36 3300010375 Ga0105239_10005879 Ga0105239_100058795 204
37 3300013100 Ga0157373_10211748 Ga0157373_102117482 204
38 3300013105 Ga0157369_10138693 Ga0157369_101386933 204
39 3300025909 Ga0207705_10036303 Ga0207705_100363034 204
40 3300025919 Ga0207657_10000390 Ga0207657_1000039048 204
41 3300025920 Ga0207649_10384538 Ga0207649_103845382 204
42 3300025932 Ga0207690_10000037 Ga0207690_1000003757 204
43 3300026078 Ga0207702_10317460 Ga0207702_103174602 204
44 3300042002 Ga0439442_009557 Ga0439442_009557_964_1707 204
45 3300048915 Ga0496112_0013355 Ga0496112_0013355_4168_4833 204
46 3300048916 Ga0496113_0020262 Ga0496113_0020262_774_1439 204
47 3300048919 Ga0496116_0033242 Ga0496116_0033242_449_1114 204
48 3300048921 Ga0496118_0086251 Ga0496118_0086251_493_1158 204
49 3300048927 Ga0496124_0133783 Ga0496124_0133783_47_712 204
50 3300048928 Ga0496125_0048058 Ga0496125_0048058_2621_3286 204
51 3300006058 Ga0075432_10000599 Ga0075432_100005997 205
52 3300027907 Ga0207428_10002525 Ga0207428_100025257 205
53 3300041405 Ga0439438_001222 Ga0439438_001222_2466_3131 205
54 3300041407 Ga0439447_009478 Ga0439447_009478_147_812 205
55 3300041411 Ga0439466_0008929 Ga0439466_0008929_483_1148 205
56 3300046460 Ga0495638_0060974 Ga0495638_0060974_545_1210 205
57 3300046501 Ga0495607_0017376 Ga0495607_0017376_3831_4496 205
58 3300046513 Ga0495616_0006862 Ga0495616_0006862_550_1221 205
59 3300046520 Ga0495637_0000104 Ga0495637_0000104_26107_26778 205
60 3300046524 Ga0495648_0012641 Ga0495648_0012641_3806_4471 205
61 3300046557 Ga0495622_0007978 Ga0495622_0007978_2640_3305 205
62 3300046615 Ga0495656_0004721 Ga0495656_0004721_2931_3596 205
63 3300046665 Ga0495661_0081415 Ga0495661_0081415_257_922 205
64 3300046674 Ga0495588_0027462 Ga0495588_0027462_1489_2154 205
65 3300046691 Ga0495670_0038162 Ga0495670_0038162_276_947 205
66 3300046694 Ga0495649_0001349 Ga0495649_0001349_7096_7761 205
67 3300046794 Ga0495589_0000711 Ga0495589_0000711_12343_13008 205
68 3300046543 Ga0495645_0236758 Ga0495645_0236758_19_642 207
69 3300031731 Ga0307405_10141687 Ga0307405_101416872 208
70 3300031824 Ga0307413_10055294 Ga0307413_100552942 208
71 3300031852 Ga0307410_10411796 Ga0307410_104117961 208
72 3300031901 Ga0307406_10093425 Ga0307406_100934252 208
73 3300031995 Ga0307409_100113298 Ga0307409_1001132982 208
74 3300031852 Ga0307410_10145813 Ga0307410_101458132 210
75 3300031901 Ga0307406_10016078 Ga0307406_100160783 210
76 3300031903 Ga0307407_10020138 Ga0307407_100201383 210
77 3300032002 Ga0307416_100007287 Ga0307416_1000072877 210
78 iso_pu_bacteria 8004703790 8004711842 210
79 3300025254 Ga0209148_1000331 Ga0209148_100033169 211
80 3300025272 Ga0209455_1000371 Ga0209455_10003718 211
81 iso_pu_bacteria 2855839649 2855846326 213
82 3300031548 Ga0307408_100355446 Ga0307408_1003554462 215
83 3300031731 Ga0307405_10029046 Ga0307405_100290462 215
84 3300031824 Ga0307413_10027454 Ga0307413_100274542 215
85 3300031901 Ga0307406_10425518 Ga0307406_104255182 215
86 3300031995 Ga0307409_100382540 Ga0307409_1003825402 215
87 3300032126 Ga0307415_100129578 Ga0307415_1001295782 215
88 3300048922 Ga0496119_0035847 Ga0496119_0035847_639_1298 215
89 3300048925 Ga0496122_0006544 Ga0496122_0006544_10805_11464 215
90 3300048926 Ga0496123_0184371 Ga0496123_0184371_200_859 215
91 3300048928 Ga0496125_0000083 Ga0496125_0000083_33835_34494 215
92 iso_pu_bacteria 2513237085 2513580956 215
93 iso_pu_bacteria 2693429784 2694636653 215
94 iso_pu_bacteria 2756170246 2756676618 215
95 iso_pu_bacteria 2847686936 2847689001 215
96 iso_pu_bacteria 2847686936 2847689007 215
97 iso_pu_bacteria 2856342000 2856346606 215
98 iso_pu_bacteria 2869234852 2869240480 215
99 iso_pu_bacteria 2869278585 2869282153 215
100 iso_pu_bacteria 2874109183 2874111347 215
101 iso_pu_bacteria 2874139085 2874140419 215
102 iso_pu_bacteria 2878730984 2878733905 215
103 iso_pu_bacteria 2881155292 2881159939 215
104 iso_pu_bacteria 2881155292 2881159944 215
105 iso_pu_bacteria 2881861095 2881867552 215
106 iso_pu_bacteria 2882912400 2882915282 215
107 iso_pu_bacteria 2888337043 2888337327 215
108 iso_pu_bacteria 2888337043 2888337333 215
109 iso_pu_bacteria 2903513507 2903514613 215
110 iso_pu_bacteria 2924718760 2924721020 215
111 iso_pu_bacteria 2924726620 2924731528 215
112 iso_pu_bacteria 2924754689 2924758162 215
113 iso_pu_bacteria 2924784321 2924788754 215
114 iso_pu_bacteria 2937843397 2937845022 215
115 iso_pu_bacteria 2937877337 2937880654 215
116 iso_pu_bacteria 2958034702 2958037950 215
117 iso_pu_bacteria 2958041894 2958049076 215
118 iso_pu_bacteria 2958084443 2958087786 215
119 iso_pu_bacteria 2958092219 2958099488 215
120 iso_pu_bacteria 2965062239 2965067827 215
121 iso_pu_bacteria 2968128360 2968129408 215
122 iso_pu_bacteria 2970593180 2970596758 215
123 iso_pu_bacteria 3004232784 3004236369 215
124 iso_pu_bacteria 3004289098 3004294094 215
125 iso_pu_bacteria 8002285264 8002286900 215
126 3300037471 Ga0395905_0000024 Ga0395905_0000024_146813_147463 216
127 iso_pu_bacteria 2513237083 2513566011 216
128 iso_pu_bacteria 8003955200 8003962178 216
129 iso_pu_bacteria 2508501050 2508731924 217
130 iso_pu_bacteria 2509276033 2509445463 217
131 iso_pu_bacteria 2510461076 2510892559 217
132 iso_pu_bacteria 2511231022 2511365551 217
133 iso_pu_bacteria 2512047086 2512528875 217
134 iso_pu_bacteria 2513237084 2513568317 217
135 iso_pu_bacteria 2513237088 2513597402 217
136 iso_pu_bacteria 2513237093 2513634777 217
137 iso_pu_bacteria 2513237146 2513924102 217
138 iso_pu_bacteria 2513237162 2514018568 217
139 iso_pu_bacteria 2513237166 2514050467 217
140 iso_pu_bacteria 2515154189 2516018730 217
141 iso_pu_bacteria 2526164713 2527080879 217
142 iso_pu_bacteria 2585427528 2585541717 217
143 iso_pu_bacteria 2585427593 2585840064 217
144 iso_pu_bacteria 2599185170 2599416148 217
145 iso_pu_bacteria 2617270742 2617384087 217
146 iso_pu_bacteria 2643221636 2644200483 217
147 iso_pu_bacteria 2738541296 2738824343 217
148 iso_pu_bacteria 2738541298 2738836726 217
149 iso_pu_bacteria 2738541306 2738878257 217
150 iso_pu_bacteria 2738541333 2739036331 217
151 iso_pu_bacteria 2738543002 2739189949 217
152 iso_pu_bacteria 2738543008 2739224850 217
153 iso_pu_bacteria 2751185846 2753566914 217
154 iso_pu_bacteria 2773857670 2774120049 217
155 iso_pu_bacteria 2773857925 2774872470 217
156 iso_pu_bacteria 2775506902 2776266898 217
157 iso_pu_bacteria 2775506902 2776267805 217
158 iso_pu_bacteria 2775506904 2776281776 217
159 iso_pu_bacteria 2775506904 2776283134 217
160 iso_pu_bacteria 2775507266 2778176605 217
161 iso_pu_bacteria 2784132072 2784312020 217
162 iso_pu_bacteria 2791355082 2792580021 217
163 iso_pu_bacteria 2791355094 2792642174 217
164 iso_pu_bacteria 2791355137 2792833954 217
165 iso_pu_bacteria 2791355259 2793317412 217
166 iso_pu_bacteria 2791355266 2793362354 217
167 iso_pu_bacteria 2802429633 2806046434 217
168 iso_pu_bacteria 2802429634 2806053030 217
169 iso_pu_bacteria 2802429635 2806059762 217
170 iso_pu_bacteria 2802429636 2806068500 217
171 iso_pu_bacteria 2802429637 2806074922 217
172 iso_pu_bacteria 2838035591 2838036269 217
173 iso_pu_bacteria 2842482326 2842487388 217
174 iso_pu_bacteria 2844163670 2844166080 217
175 iso_pu_bacteria 2852387548 2852392846 217
176 iso_pu_bacteria 2855872281 2855876408 217
177 iso_pu_bacteria 2882456835 2882460181 217
178 iso_pu_bacteria 2883087390 2883090168 217
179 iso_pu_bacteria 2885270888 2885271008 217
180 iso_pu_bacteria 2885270888 2885271241 217
181 iso_pu_bacteria 2885270888 2885271618 217
182 iso_pu_bacteria 2885270888 2885272286 217
183 iso_pu_bacteria 2885270888 2885277000 217
184 iso_pu_bacteria 2891373044 2891377988 217
185 iso_pu_bacteria 2900634093 2900643567 217
186 iso_pu_bacteria 2902682994 2902689963 217
187 iso_pu_bacteria 2904615490 2904623844 217
188 iso_pu_bacteria 2913295892 2913301678 217
189 iso_pu_bacteria 2916028427 2916031352 217
190 iso_pu_bacteria 2921296804 2921298370 217
191 iso_pu_bacteria 2928157003 2928161094 217
192 iso_pu_bacteria 2936375103 2936375345 217
193 iso_pu_bacteria 2981990288 2981991232 217
194 iso_pu_bacteria 2989349275 2989350260 217
195 iso_pu_bacteria 3007419365 3007423904 217
196 iso_pu_bacteria 8005258706 8005260591 217
197 iso_pu_bacteria 8005556819 8005563508 217
198 iso_pu_bacteria 8005563573 8005565287 217
199 iso_pu_bacteria 8005570704 8005572439 217
200 iso_pu_bacteria 8018163183 8018168680 217
201 iso_pu_bacteria 8020938398 8020943672 217
202 iso_pu_bacteria 8020953355 8020953688 217
203 iso_pu_bacteria 8039098773 8039103045 217
204 iso_pu_bacteria 8055266321 8055273567 217
205 iso_pu_bacteria 8056137416 8056139940 217
206 iso_pu_bacteria 8056155041 8056157472 217
207 iso_pu_bacteria 8056177738 8056182625 217
208 iso_pu_bacteria 2509276021 2509391277 218
209 iso_pu_bacteria 2511231052 2511499490 218
210 iso_pu_bacteria 2513237086 2513586236 218
211 iso_pu_bacteria 2551306084 2551676119 218
212 iso_pu_bacteria 2551306085 2551683926 218
213 iso_pu_bacteria 2551306086 2551693256 218
214 iso_pu_bacteria 2551306087 2551704877 218
215 iso_pu_bacteria 2551306090 2551721491 218
216 iso_pu_bacteria 2551306092 2551732173 218
217 iso_pu_bacteria 2551306093 2551739681 218
218 iso_pu_bacteria 2791355267 2793365161 218
219 iso_pu_bacteria 2841864319 2841868598 218
220 iso_pu_bacteria 2842341865 2842342547 218
221 iso_pu_bacteria 2842363717 2842365680 218
222 iso_pu_bacteria 2855825444 2855830280 218
223 iso_pu_bacteria 2855839649 2855845942 218
224 iso_pu_bacteria 2908669403 2908673484 218
225 iso_pu_bacteria 2915993759 2915995861 218
226 iso_pu_bacteria 2916007675 2916008943 218
227 iso_pu_bacteria 2916014648 2916017689 218
228 iso_pu_bacteria 2916055098 2916058091 218
229 iso_pu_bacteria 2916068649 2916071346 218
230 iso_pu_bacteria 2921237296 2921238490 218
231 iso_pu_bacteria 2921263974 2921266818 218
232 iso_pu_bacteria 2921289301 2921293911 218
233 iso_pu_bacteria 2924150972 2924155602 218
234 iso_pu_bacteria 2924158325 2924162936 218
235 iso_pu_bacteria 2924165586 2924169607 218
236 iso_pu_bacteria 2924172951 2924175586 218
237 iso_pu_bacteria 2924186466 2924190048 218
238 iso_pu_bacteria 2924214083 2924220392 218
239 iso_pu_bacteria 2924221636 2924224557 218
240 iso_pu_bacteria 2924228884 2924233304 218
241 iso_pu_bacteria 2937002841 2937006551 218
242 iso_pu_bacteria 2937042894 2937043088 218
243 iso_pu_bacteria 2937049772 2937055863 218
244 iso_pu_bacteria 2937056579 2937061252 218
245 iso_pu_bacteria 2937071275 2937072522 218
246 iso_pu_bacteria 2937091812 2937096252 218
247 iso_pu_bacteria 2937098957 2937103870 218
248 iso_pu_bacteria 2937126314 2937132804 218
249 iso_pu_bacteria 2957422303 2957429696 218
250 iso_pu_bacteria 2957430029 2957436223 218
251 iso_pu_bacteria 2957457609 2957458299 218
252 iso_pu_bacteria 2957471148 2957474970 218
253 iso_pu_bacteria 2957478035 2957480827 218
254 iso_pu_bacteria 2957484790 2957485188 218
255 iso_pu_bacteria 2957498199 2957503151 218
256 iso_pu_bacteria 2957505466 2957509527 218
257 iso_pu_bacteria 2960603979 2960608198 218
258 iso_pu_bacteria 2960624210 2960627500 218
259 iso_pu_bacteria 2960637947 2960644970 218
260 iso_pu_bacteria 2960645483 2960649326 218
261 iso_pu_bacteria 2960652885 2960655569 218
262 iso_pu_bacteria 2964607997 2964612649 218
263 iso_pu_bacteria 2964628898 2964633441 218
264 iso_pu_bacteria 2964649959 2964654227 218
265 iso_pu_bacteria 2964656573 2964661361 218
266 iso_pu_bacteria 2964678106 2964683977 218
267 iso_pu_bacteria 2964719344 2964726374 218
268 iso_pu_bacteria 2967678726 2967683575 218
269 iso_pu_bacteria 2967693043 2967695849 218
270 iso_pu_bacteria 2967706974 2967707908 218
271 iso_pu_bacteria 2967714385 2967719135 218
272 iso_pu_bacteria 2967721400 2967725613 218
273 iso_pu_bacteria 2967735183 2967739089 218
274 iso_pu_bacteria 2967762386 2967763049 218
275 iso_pu_bacteria 2967775926 2967777427 218
276 iso_pu_bacteria 2970019648 2970026308 218
277 iso_pu_bacteria 2970040964 2970043098 218
278 iso_pu_bacteria 2970047711 2970047756 218
279 iso_pu_bacteria 2970054988 2970058129 218
280 iso_pu_bacteria 2970061556 2970066055 218
281 iso_pu_bacteria 2970088815 2970092963 218
282 iso_pu_bacteria 2970109326 2970114867 218
283 iso_pu_bacteria 2970116247 2970117481 218
284 iso_pu_bacteria 2970129317 2970132343 218
285 iso_pu_bacteria 2970136068 2970139470 218
286 iso_pu_bacteria 2970149975 2970150934 218
287 iso_pu_bacteria 2970164137 2970168036 218
288 iso_pu_bacteria 2970170962 2970174606 218
289 iso_pu_bacteria 2970184632 2970189105 218
290 iso_pu_bacteria 2970191845 2970195503 218
291 iso_pu_bacteria 2977537788 2977542123 218
292 iso_pu_bacteria 2977551784 2977556609 218
293 iso_pu_bacteria 2977572785 2977575836 218
294 iso_pu_bacteria 2977579622 2977581906 218
295 iso_pu_bacteria 8056375014 8056377670 218
296 3300039062 Ga0400483_044762 Ga0400483_044762_112_780 219
297 3300039062 Ga0400483_188268 Ga0400483_188268_1184_1852 219
298 3300049569 Ga0501032_0212619 Ga0501032_0212619_311_976 219
299 3300049571 Ga0501034_0000944 Ga0501034_0000944_30932_31597 219
300 3300049574 Ga0501038_0211984 Ga0501038_0211984_613_1278 219
301 iso_pu_bacteria 2808606357 2808828809 219
302 iso_pu_bacteria 2834578030 2834580304 219
303 3300037466 Ga0395898_0147701 Ga0395898_0147701_389_1057 220
304 3300038443 Ga0395901_0199731 Ga0395901_0199731_192_860 220
305 3300049574 Ga0501038_0199667 Ga0501038_0199667_690_1358 220
306 3300049822 Ga0501035_0021190 Ga0501035_0021190_3612_4280 220
307 iso_pu_bacteria 2558860112 2558906782 220
308 2124908027 MRS2a_Contig_2265 MRS2a_00167270 221
309 3300002987 JGI25159J45721_1000080 JGI25159J45721_100008040 221
310 3300003187 JGI25151J46595_10003218 JGI25151J46595_100032185 221
311 3300003215 JGI25153J46596_10004438 JGI25153J46596_100044385 221
312 3300003320 rootH2_10214548 rootH2_102145482 221
313 3300003354 JGI25160J50197_1000160 JGI25160J50197_100016012 221
314 3300003354 JGI25160J50197_1001380 JGI25160J50197_10013802 221
315 3300003374 JGI25161J50226_1000644 JGI25161J50226_100064413 221
316 3300003374 JGI25161J50226_1007165 JGI25161J50226_10071651 221
317 3300003771 Ga0055526_1000913 Ga0055526_100091320 221
318 3300003771 Ga0055526_1001250 Ga0055526_100125012 221
319 3300003771 Ga0055526_1001730 Ga0055526_10017303 221
320 3300003775 Ga0055524_1001595 Ga0055524_10015957 221
321 3300003775 Ga0055524_1034056 Ga0055524_10340562 221
322 3300003781 Ga0055536_1010628 Ga0055536_10106282 221
323 3300003790 Ga0055528_1000496 Ga0055528_100049615 221
324 3300003790 Ga0055528_1008574 Ga0055528_10085743 221
325 3300003792 Ga0055540_1000077 Ga0055540_100007749 221
326 3300003792 Ga0055540_1000095 Ga0055540_100009591 221
327 3300003792 Ga0055540_1008583 Ga0055540_10085832 221
328 3300003794 Ga0055531_10003881 Ga0055531_100038814 221
329 3300003856 Ga0058692_1000056 Ga0058692_100005656 221
330 3300004625 Ga0055543_1000410 Ga0055543_100041027 221
331 3300004625 Ga0055543_1000625 Ga0055543_100062517 221
332 3300005262 Ga0065165_1000534 Ga0065165_100053413 221
333 3300005262 Ga0065165_1011591 Ga0065165_10115911 221
334 3300005288 Ga0065714_10002449 Ga0065714_100024499 221
335 3300005288 Ga0065714_10002712 Ga0065714_100027127 221
336 3300005366 Ga0070659_100271906 Ga0070659_1002719061 221
337 3300005842 Ga0068858_100275034 Ga0068858_1002750342 221
338 3300006038 Ga0075365_10026094 Ga0075365_100260942 221
339 3300006048 Ga0075363_100089546 Ga0075363_1000895461 221
340 3300006177 Ga0075362_10120493 Ga0075362_101204932 221
341 3300006186 Ga0075369_10034998 Ga0075369_100349982 221
342 3300006195 Ga0075366_10013907 Ga0075366_100139073 221
343 3300006946 Ga0079104_1001104 Ga0079104_10011045 221
344 3300009011 Ga0105251_10000038 Ga0105251_1000003881 221
345 3300009011 Ga0105251_10010946 Ga0105251_100109466 221
346 3300009036 Ga0105244_10002923 Ga0105244_100029238 221
347 3300009036 Ga0105244_10053974 Ga0105244_100539742 221
348 3300009101 Ga0105247_10662791 Ga0105247_106627911 221
349 3300009148 Ga0105243_10068349 Ga0105243_100683493 221
350 3300009176 Ga0105242_10178827 Ga0105242_101788272 221
351 3300009765 Ga0123341_1000082 Ga0123341_10000826 221
352 3300010375 Ga0105239_10128292 Ga0105239_101282923 221
353 3300014497 Ga0182008_10000970 Ga0182008_100009708 221
354 3300015261 Ga0182006_1002548 Ga0182006_10025488 221
355 3300015262 Ga0182007_10000152 Ga0182007_1000015234 221
356 3300015265 Ga0182005_1000181 Ga0182005_10001817 221
357 3300025208 Ga0209436_100101 Ga0209436_10010113 221
358 3300025245 Ga0207425_1002551 Ga0207425_10025513 221
359 3300025256 Ga0209759_1020394 Ga0209759_10203942 221
360 3300025258 Ga0209129_1000917 Ga0209129_100091710 221
361 3300025258 Ga0209129_1024250 Ga0209129_10242502 221
362 3300025273 Ga0209673_1000294 Ga0209673_100029416 221
363 3300025273 Ga0209673_1000968 Ga0209673_10009683 221
364 3300025284 Ga0209130_1000309 Ga0209130_100030913 221
365 3300025284 Ga0209130_1023894 Ga0209130_10238942 221
366 3300025292 Ga0209676_1002316 Ga0209676_100231611 221
367 3300025294 Ga0209025_1000260 Ga0209025_1000260108 221
368 3300025294 Ga0209025_1001911 Ga0209025_10019118 221
369 3300025294 Ga0209025_1022425 Ga0209025_10224253 221
370 3300025295 Ga0209564_1000341 Ga0209564_100034111 221
371 3300025295 Ga0209564_1001129 Ga0209564_100112930 221
372 3300025297 Ga0209758_1001982 Ga0209758_100198217 221
373 3300025297 Ga0209758_1003817 Ga0209758_10038175 221
374 3300025298 Ga0209050_1010756 Ga0209050_10107563 221
375 3300025298 Ga0209050_1011672 Ga0209050_10116722 221
376 3300025299 Ga0209256_1000719 Ga0209256_100071930 221
377 3300025299 Ga0209256_1003376 Ga0209256_100337610 221
378 3300025302 Ga0207426_1000503 Ga0207426_100050313 221
379 3300025302 Ga0207426_1001199 Ga0207426_100119916 221
380 3300025303 Ga0209051_1000027 Ga0209051_1000027288 221
381 3300025303 Ga0209051_1003762 Ga0209051_10037625 221
382 3300025303 Ga0209051_1041767 Ga0209051_10417672 221
383 3300025304 Ga0209257_1000599 Ga0209257_100059957 221
384 3300025304 Ga0209257_1002580 Ga0209257_10025804 221
385 3300025711 Ga0207696_1000018 Ga0207696_1000018305 221
386 3300025728 Ga0207655_1001322 Ga0207655_10013228 221
387 3300025728 Ga0207655_1011199 Ga0207655_10111992 221
388 3300025735 Ga0207713_1000185 Ga0207713_100018549 221
389 3300025735 Ga0207713_1002035 Ga0207713_10020356 221
390 3300025932 Ga0207690_10225952 Ga0207690_102259522 221
391 3300027111 Ga0209281_1000778 Ga0209281_100077819 221
392 3300027312 Ga0209371_1000121 Ga0209371_100012142 221
393 3300030500 Ga0268256_1000107 Ga0268256_100010776 221
394 3300036401 Ga0373937_0197626 Ga0373937_0197626_376_1047 221
395 3300037068 Ga0373925_0052189 Ga0373925_0052189_1969_2640 221
396 3300037312 Ga0395899_0002826 Ga0395899_0002826_10851_11516 221
397 3300037312 Ga0395899_0008512 Ga0395899_0008512_6123_6875 221
398 3300037418 Ga0395900_0008030 Ga0395900_0008030_6027_6692 221
399 3300037418 Ga0395900_0109630 Ga0395900_0109630_1576_2328 221
400 3300037466 Ga0395898_0003468 Ga0395898_0003468_5548_6300 221
401 3300037466 Ga0395898_0010331 Ga0395898_0010331_2942_3658 221
402 3300037471 Ga0395905_0001801 Ga0395905_0001801_15767_16432 221
403 3300037471 Ga0395905_0080861 Ga0395905_0080861_1772_2437 221
404 3300038443 Ga0395901_0000434 Ga0395901_0000434_18989_19654 221
405 3300038443 Ga0395901_0027622 Ga0395901_0027622_4572_5324 221
406 3300038443 Ga0395901_0096386 Ga0395901_0096386_1067_1783 221
407 3300041413 Ga0439465_0009838 Ga0439465_0009838_1324_1992 221
408 3300041492 Ga0451835_0189026 Ga0451835_0189026_37_702 221
409 3300041492 Ga0451835_0889751 Ga0451835_0889751_61_726 221
410 3300041494 Ga0451837_1430986 Ga0451837_1430986_1215_1880 221
411 3300041496 Ga0451839_1280463 Ga0451839_1280463_39_704 221
412 3300041498 Ga0451841_0648979 Ga0451841_0648979_91_759 221
413 3300041501 Ga0451845_0509085 Ga0451845_0509085_752_1417 221
414 3300041503 Ga0451847_0054784 Ga0451847_0054784_1390_2055 221
415 3300041505 Ga0451849_0219018 Ga0451849_0219018_2763_3428 221
416 3300041507 Ga0451851_0579564 Ga0451851_0579564_77_742 221
417 3300041512 Ga0451853_0692887 Ga0451853_0692887_2588_3253 221
418 3300042007 Ga0439449_0089202 Ga0439449_0089202_368_1036 221
419 3300042007 Ga0439449_0148502 Ga0439449_0148502_93_761 221
420 3300042009 Ga0439451_010933 Ga0439451_010933_1049_1714 221
421 3300042993 Ga0439440_0002240 Ga0439440_0002240_1737_2402 221
422 3300044694 Ga0466963_0250889 Ga0466963_0250889_547_1212 221
423 3300044694 Ga0466963_0302111 Ga0466963_0302111_90_824 221
424 3300044842 Ga0466957_0000424 Ga0466957_0000424_8131_8796 221
425 3300044901 Ga0466960_0027509 Ga0466960_0027509_1505_2239 221
426 3300046453 Ga0495627_003113 Ga0495627_003113_1629_2294 221
427 3300046454 Ga0495592_0049789 Ga0495592_0049789_677_1345 221
428 3300046458 Ga0495591_001339 Ga0495591_001339_9180_9845 221
429 3300046458 Ga0495591_001915 Ga0495591_001915_3366_4031 221
430 3300046460 Ga0495638_0000337 Ga0495638_0000337_39832_40497 221
431 3300046460 Ga0495638_0032044 Ga0495638_0032044_81_746 221
432 3300046462 Ga0495651_0028015 Ga0495651_0028015_1556_2227 221
433 3300046463 Ga0495653_0061261 Ga0495653_0061261_379_1044 221
434 3300046463 Ga0495653_0068971 Ga0495653_0068971_1637_2302 221
435 3300046473 Ga0495582_0002108 Ga0495582_0002108_2686_3351 221
436 3300046474 Ga0495605_0012525 Ga0495605_0012525_2493_3158 221
437 3300046475 Ga0495639_0006288 Ga0495639_0006288_3049_3714 221
438 3300046475 Ga0495639_0142014 Ga0495639_0142014_111_776 221
439 3300046477 Ga0495664_0005994 Ga0495664_0005994_1494_2162 221
440 3300046492 Ga0495585_0000012 Ga0495585_0000012_97660_98325 221
441 3300046492 Ga0495585_0031944 Ga0495585_0031944_1578_2243 221
442 3300046499 Ga0495594_0140572 Ga0495594_0140572_656_1321 221
443 3300046506 Ga0495583_0002549 Ga0495583_0002549_8206_8871 221
444 3300046507 Ga0495606_0002150 Ga0495606_0002150_17282_17947 221
445 3300046512 Ga0495610_0001335 Ga0495610_0001335_17356_18021 221
446 3300046512 Ga0495610_0002873 Ga0495610_0002873_8004_8669 221
447 3300046512 Ga0495610_0041811 Ga0495610_0041811_45_710 221
448 3300046512 Ga0495610_0061814 Ga0495610_0061814_183_848 221
449 3300046513 Ga0495616_0049818 Ga0495616_0049818_1236_1901 221
450 3300046515 Ga0495620_0031262 Ga0495620_0031262_424_1089 221
451 3300046517 Ga0495630_0005890 Ga0495630_0005890_3104_3769 221
452 3300046517 Ga0495630_0013664 Ga0495630_0013664_2602_3267 221
453 3300046517 Ga0495630_0025235 Ga0495630_0025235_2402_3067 221
454 3300046519 Ga0495632_0002236 Ga0495632_0002236_7312_7977 221
455 3300046520 Ga0495637_0006512 Ga0495637_0006512_3039_3704 221
456 3300046524 Ga0495648_0007964 Ga0495648_0007964_5680_6345 221
457 3300046526 Ga0495666_0000923 Ga0495666_0000923_10796_11461 221
458 3300046526 Ga0495666_0073246 Ga0495666_0073246_637_1302 221
459 3300046530 Ga0495654_0003761 Ga0495654_0003761_5433_6098 221
460 3300046531 Ga0495665_0029429 Ga0495665_0029429_2151_2816 221
461 3300046531 Ga0495665_0048337 Ga0495665_0048337_554_1291 221
462 3300046535 Ga0495586_0002053 Ga0495586_0002053_2496_3161 221
463 3300046536 Ga0495587_0001330 Ga0495587_0001330_15309_15974 221
464 3300046542 Ga0495597_0002064 Ga0495597_0002064_5178_5843 221
465 3300046543 Ga0495645_0056587 Ga0495645_0056587_540_1208 221
466 3300046557 Ga0495622_0054733 Ga0495622_0054733_139_804 221
467 3300046642 Ga0495634_0136118 Ga0495634_0136118_438_1103 221
468 3300046660 Ga0495625_0001537 Ga0495625_0001537_18984_19649 221
469 3300046660 Ga0495625_0005428 Ga0495625_0005428_7022_7687 221
470 3300046664 Ga0495659_0000022 Ga0495659_0000022_19463_20128 221
471 3300046665 Ga0495661_0085935 Ga0495661_0085935_956_1621 221
472 3300046674 Ga0495588_0041330 Ga0495588_0041330_184_849 221
473 3300046675 Ga0495657_0015936 Ga0495657_0015936_4159_4824 221
474 3300046678 Ga0495599_0120963 Ga0495599_0120963_352_1023 221
475 3300046678 Ga0495599_0348035 Ga0495599_0348035_68_733 221
476 3300046679 Ga0495623_0005374 Ga0495623_0005374_3599_4264 221
477 3300046680 Ga0495646_0000376 Ga0495646_0000376_15687_16352 221
478 3300046689 Ga0495613_0002368 Ga0495613_0002368_3767_4432 221
479 3300046691 Ga0495670_0025008 Ga0495670_0025008_1404_2069 221
480 3300046692 Ga0495671_0052308 Ga0495671_0052308_1101_1766 221
481 3300046694 Ga0495649_0000202 Ga0495649_0000202_15669_16334 221
482 3300046694 Ga0495649_0003058 Ga0495649_0003058_7362_8027 221
483 3300046694 Ga0495649_0022900 Ga0495649_0022900_38_703 221
484 3300046794 Ga0495589_0001234 Ga0495589_0001234_5822_6487 221
485 3300046794 Ga0495589_0098260 Ga0495589_0098260_278_943 221
486 3300046809 Ga0495600_0014597 Ga0495600_0014597_1264_1929 221
487 3300046810 Ga0495660_0003169 Ga0495660_0003169_5710_6375 221
488 3300047315 Ga0495581_0031122 Ga0495581_0031122_541_1278 221
489 3300047317 Ga0495604_0001884 Ga0495604_0001884_14700_15365 221
490 3300047317 Ga0495604_0009365 Ga0495604_0009365_4815_5480 221
491 3300047320 Ga0495672_0022949 Ga0495672_0022949_2706_3371 221
492 3300047322 Ga0495680_0000645 Ga0495680_0000645_19664_20329 221
493 3300047322 Ga0495680_0016115 Ga0495680_0016115_4319_4984 221
494 3300047322 Ga0495680_0058939 Ga0495680_0058939_511_1176 221
495 3300047322 Ga0495680_0116848 Ga0495680_0116848_1228_1893 221
496 3300047323 Ga0495683_0002684 Ga0495683_0002684_3992_4657 221
497 3300047443 Ga0495687_000822 Ga0495687_000822_22608_23273 221
498 3300047443 Ga0495687_063793 Ga0495687_063793_280_945 221
499 3300047444 Ga0495675_0001391 Ga0495675_0001391_4311_4976 221
500 3300047444 Ga0495675_0098344 Ga0495675_0098344_478_1146 221
501 3300047444 Ga0495675_0110180 Ga0495675_0110180_696_1361 221
502 3300047470 Ga0495681_0091994 Ga0495681_0091994_446_1111 221
503 3300047471 Ga0495684_0027342 Ga0495684_0027342_247_912 221
504 3300047472 Ga0495686_0000556 Ga0495686_0000556_13498_14163 221
505 3300047472 Ga0495686_0001910 Ga0495686_0001910_5737_6402 221
506 3300047472 Ga0495686_0150917 Ga0495686_0150917_414_1079 221
507 3300047673 Ga0495593_0002125 Ga0495593_0002125_2333_2998 221
508 3300047673 Ga0495593_0016068 Ga0495593_0016068_2602_3267 221
509 3300047673 Ga0495593_0038118 Ga0495593_0038118_1523_2188 221
510 3300047673 Ga0495593_0102802 Ga0495593_0102802_228_893 221
511 3300048088 Ga0495602_0056287 Ga0495602_0056287_2357_3022 221
512 3300048907 Ga0496104_0706132 Ga0496104_0706132_40_705 221
513 3300048908 Ga0496105_0018615 Ga0496105_0018615_2108_2773 221
514 3300048909 Ga0496106_0014056 Ga0496106_0014056_5123_5788 221
515 3300048910 Ga0496107_0074350 Ga0496107_0074350_336_1001 221
516 3300048919 Ga0496116_0001588 Ga0496116_0001588_20134_20799 221
517 3300048920 Ga0496117_0014535 Ga0496117_0014535_5019_5684 221
518 3300048921 Ga0496118_0025629 Ga0496118_0025629_4239_4904 221
519 3300048924 Ga0496121_0009631 Ga0496121_0009631_4372_5037 221
520 3300048924 Ga0496121_0023127 Ga0496121_0023127_4526_5191 221
521 3300048925 Ga0496122_0000244 Ga0496122_0000244_100272_100937 221
522 3300048925 Ga0496122_0001098 Ga0496122_0001098_40534_41199 221
523 3300048926 Ga0496123_0000201 Ga0496123_0000201_100325_100990 221
524 3300048926 Ga0496123_0018936 Ga0496123_0018936_1049_1714 221
525 3300048927 Ga0496124_0064843 Ga0496124_0064843_941_1606 221
526 3300049569 Ga0501032_0143226 Ga0501032_0143226_153_818 221
527 3300049570 Ga0501033_0224251 Ga0501033_0224251_456_1121 221
528 3300049571 Ga0501034_0116791 Ga0501034_0116791_839_1504 221
529 3300049571 Ga0501034_0318065 Ga0501034_0318065_148_813 221
530 3300049574 Ga0501038_0330146 Ga0501038_0330146_58_723 221
531 3300049575 Ga0501039_0739816 Ga0501039_0739816_40_705 221
532 3300049590 Ga0501074_0526929 Ga0501074_0526929_106_771 221
533 3300049824 Ga0501045_0297943 Ga0501045_0297943_366_1031 221
534 3300050489 nmdc:mga03683_115414_c1 nmdc:mga03683_115414_c1_338_1003 221
535 3300050490 nmdc:mga03n38_52176_c1 nmdc:mga03n38_52176_c1_1098_1763 221
536 3300050492 nmdc:mga0yw44_18797_c1 nmdc:mga0yw44_18797_c1_2023_2688 221
537 3300050493 nmdc:mga0k408_57878_c1 nmdc:mga0k408_57878_c1_504_1169 221
538 3300050496 nmdc:mga07m45_5402_c1 nmdc:mga07m45_5402_c1_4743_5408 221
539 3300053099 Ga0500654_174895 Ga0500654_174895_17_682 221
540 3300053122 Ga0500608_115247 Ga0500608_115247_526_1194 221
541 3300053139 Ga0500568_0024236 Ga0500568_0024236_956_1621 221
542 3300053177 Ga0500636_0000095 Ga0500636_0000095_37877_38542 221

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00528

BPD_transp_1

Binding-protein-dependent transport system inner membrane component

32

219

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
4ymu-assembly1.cif.gz_C crystal structure of an amino acid abc transporter complex with arginines and atps 0.8175 1 210
4ymu-assembly1.cif.gz_C crystal structure of an amino acid abc transporter complex with arginines and atps 0.8007 1 210
3dhw-assembly1.cif.gz_A crystal structure of methionine importer metni 0.76 13 201
3dhw-assembly2.cif.gz_E crystal structure of methionine importer metni 0.7359 14 205
4jbw-assembly2.cif.gz_H crystal structure of e. coli maltose transporter malfgk2 in complex with its regulatory protein eiiaglc 0.7315 1 204
ID Description Score Start End Superfamily
af_P45768_144_364_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.8385 18 211 1.10.3720.10
af_P0AEU3_9_230_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.8358 21 212 1.10.3720.10
af_P0AFT2_3_219_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.8308 8 215 1.10.3720.10
af_P0AEQ6_1_218_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.8258 1 211 1.10.3720.10
af_P0AE34_6_232_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.8134 15 211 1.10.3720.10
ID Description Score Start End GO Terms
AF-A0A522RPC8-F1-model_v4 Amino acid ABC transporter permease 0.917 2 216 GO:0006865
GO:0022857
GO:0043190
AF-A0A522RPC8-F1-model_v4 Amino acid ABC transporter permease 0.9051 2 216 GO:0006865
GO:0022857
GO:0043190
AF-A0A1Y0L8V6-F1-model_v4 Amino acid ABC transporter permease 0.8999 1 215 GO:0006865
GO:0022857
GO:0043190
AF-A0A366DZI9-F1-model_v4 Polar amino acid transport system permease protein 0.8992 1 211 GO:0006865
GO:0022857
GO:0043190
AF-A0A7C9RBR3-F1-model_v4 Amino acid ABC transporter permease 0.8981 2 216 GO:0006865
GO:0022857
GO:0043190

Feature Viewer

pLDDT pTM Quality
89.57 0.82 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map